F394442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 203 | 298 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300046476|Ga0495662_0011321|Ga0495662_0011321_2935_3408 |
| Length | 157 |
| Sequence | MKTAGEIMDTDAPSVSPGDDARTAIDLLAKTDLGAIPVVDEERKVVGIVSXSDLVLSEEESDLHLPHYLNIMGGIVFVGSMKGFEERLEKAFATDVSELMTADPIVAHDYESADRVAKKIADKHHNHLPVVDADGHLMGMVTRADALAALVADGEDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 121 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 123 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 128 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 185 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 186 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 187 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 12.75 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031842 | 3300001979 | Bacteria | 1694 |
| 2 | JGI25404J52841_10049051 | 3300003659 | Bacteria | 888 |
| 3 | Ga0070683_100005586 | 3300005329 | Bacteria | 10503 |
| 4 | Ga0070683_100012615 | 3300005329 | Bacteria | 7347 |
| 5 | Ga0070683_100147213 | 3300005329 | Bacteria | 2232 |
| 6 | Ga0070683_100645921 | 3300005329 | Bacteria | 1013 |
| 7 | Ga0068869_100114324 | 3300005334 | Bacteria | 2057 |
| 8 | Ga0070682_100000026 | 3300005337 | Bacteria | 191388 |
| 9 | Ga0070682_100157754 | 3300005337 | Bacteria | 1564 |
| 10 | Ga0068868_100001800 | 3300005338 | Bacteria | 14722 |
| 11 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 12 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 13 | Ga0070661_101532546 | 3300005344 | Bacteria | 563 |
| 14 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 15 | Ga0070688_100000077 | 3300005365 | Bacteria | 48743 |
| 16 | Ga0070688_100000161 | 3300005365 | Bacteria | 35812 |
| 17 | Ga0070688_100035508 | 3300005365 | Bacteria | 3028 |
| 18 | Ga0070659_100023857 | 3300005366 | Bacteria | 4685 |
| 19 | Ga0070667_100013639 | 3300005367 | Bacteria | 6715 |
| 20 | Ga0070667_100527408 | 3300005367 | Bacteria | 1084 |
| 21 | Ga0070714_100117097 | 3300005435 | Bacteria | 2366 |
| 22 | Ga0070714_101185775 | 3300005435 | Bacteria | 745 |
| 23 | Ga0070713_100006777 | 3300005436 | Bacteria | 7982 |
| 24 | Ga0070713_100097029 | 3300005436 | Bacteria | 2546 |
| 25 | Ga0070710_10432914 | 3300005437 | Bacteria | 888 |
| 26 | Ga0070701_10220442 | 3300005438 | Bacteria | 1131 |
| 27 | Ga0070711_100012790 | 3300005439 | Bacteria | 5255 |
| 28 | Ga0070711_100428119 | 3300005439 | Bacteria | 1080 |
| 29 | Ga0070663_100003185 | 3300005455 | Bacteria | 9419 |
| 30 | Ga0070678_100014248 | 3300005456 | Bacteria | 5009 |
| 31 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 32 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 33 | Ga0070679_100006435 | 3300005530 | Bacteria | 10943 |
| 34 | Ga0070684_100004420 | 3300005535 | Bacteria | 10697 |
| 35 | Ga0070684_100028439 | 3300005535 | Bacteria | 4729 |
| 36 | Ga0068853_100026109 | 3300005539 | Bacteria | 4904 |
| 37 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 38 | Ga0070693_100000422 | 3300005547 | Bacteria | 19196 |
| 39 | Ga0070665_100006702 | 3300005548 | Bacteria | 11707 |
| 40 | Ga0070665_100329173 | 3300005548 | Bacteria | 1532 |
| 41 | Ga0068857_100118832 | 3300005577 | Bacteria | 2379 |
| 42 | Ga0068854_100000082 | 3300005578 | Bacteria | 68340 |
| 43 | Ga0068856_100000417 | 3300005614 | Bacteria | 46946 |
| 44 | Ga0068856_100055114 | 3300005614 | Bacteria | 3924 |
| 45 | Ga0070702_101039793 | 3300005615 | Unclassified | 651 |
| 46 | Ga0068852_100000966 | 3300005616 | Bacteria | 18875 |
| 47 | Ga0068852_100198403 | 3300005616 | Bacteria | 1898 |
| 48 | Ga0068864_100000043 | 3300005618 | Bacteria | 162928 |
| 49 | Ga0068866_10000296 | 3300005718 | Bacteria | 23705 |
| 50 | Ga0068861_100106735 | 3300005719 | Bacteria | 2238 |
| 51 | Ga0068861_100664634 | 3300005719 | Bacteria | 964 |
| 52 | Ga0068851_10000141 | 3300005834 | Bacteria | 38800 |
| 53 | Ga0068851_10007310 | 3300005834 | Bacteria | 5066 |
| 54 | Ga0068863_100007352 | 3300005841 | Bacteria | 10782 |
| 55 | Ga0068863_101234594 | 3300005841 | Bacteria | 754 |
| 56 | Ga0068858_100000046 | 3300005842 | Bacteria | 127519 |
| 57 | Ga0081540_1000868 | 3300005983 | Bacteria | 27372 |
| 58 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 59 | Ga0070716_101303468 | 3300006173 | Unclassified | 587 |
| 60 | Ga0070712_100032187 | 3300006175 | Bacteria | 3539 |
| 61 | Ga0068871_100412296 | 3300006358 | Bacteria | 1205 |
| 62 | Ga0075431_100037539 | 3300006847 | Bacteria | 4990 |
| 63 | Ga0075433_10000592 | 3300006852 | Bacteria | 24054 |
| 64 | Ga0068865_100000499 | 3300006881 | Bacteria | 22000 |
| 65 | Ga0068865_100826585 | 3300006881 | Unclassified | 801 |
| 66 | Ga0105240_10482906 | 3300009093 | Bacteria | 1381 |
| 67 | Ga0111539_11008356 | 3300009094 | Bacteria | 968 |
| 68 | Ga0111539_11830668 | 3300009094 | Bacteria | 704 |
| 69 | Ga0105245_10000314 | 3300009098 | Bacteria | 46175 |
| 70 | Ga0105245_10021024 | 3300009098 | Bacteria | 5724 |
| 71 | Ga0105247_10000131 | 3300009101 | Bacteria | 72578 |
| 72 | Ga0105247_10402616 | 3300009101 | Bacteria | 976 |
| 73 | Ga0114129_10893167 | 3300009147 | Bacteria | 1126 |
| 74 | Ga0105243_10062405 | 3300009148 | Bacteria | 2983 |
| 75 | Ga0105243_10651085 | 3300009148 | Bacteria | 1021 |
| 76 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 77 | Ga0105242_11156714 | 3300009176 | Bacteria | 791 |
| 78 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 79 | Ga0105249_10547428 | 3300009553 | Bacteria | 1207 |
| 80 | Ga0105249_10925752 | 3300009553 | Bacteria | 939 |
| 81 | Ga0105239_10910713 | 3300010375 | Bacteria | 1009 |
| 82 | Ga0157373_10752893 | 3300013100 | Bacteria | 716 |
| 83 | Ga0157371_10027844 | 3300013102 | Bacteria | 4095 |
| 84 | Ga0157370_10012447 | 3300013104 | Bacteria | 8821 |
| 85 | Ga0157370_10993698 | 3300013104 | Bacteria | 760 |
| 86 | Ga0157369_10001730 | 3300013105 | Bacteria | 26528 |
| 87 | Ga0157374_10639148 | 3300013296 | Bacteria | 1075 |
| 88 | Ga0157378_10015261 | 3300013297 | Bacteria | 6727 |
| 89 | Ga0157378_10019758 | 3300013297 | Bacteria | 5924 |
| 90 | Ga0157378_10434655 | 3300013297 | Bacteria | 1300 |
| 91 | Ga0163162_10392787 | 3300013306 | Bacteria | 1520 |
| 92 | Ga0157372_10001749 | 3300013307 | Bacteria | 23545 |
| 93 | Ga0157375_10000365 | 3300013308 | Bacteria | 41388 |
| 94 | Ga0157375_10003564 | 3300013308 | Bacteria | 13514 |
| 95 | Ga0157377_10154410 | 3300014745 | Bacteria | 1422 |
| 96 | Ga0163161_10029785 | 3300017792 | Bacteria | 3880 |
| 97 | Ga0206354_11074552 | 3300020081 | Bacteria | 1260 |
| 98 | Ga0224712_10385444 | 3300022467 | Unclassified | 666 |
| 99 | Ga0207656_10051285 | 3300025321 | Bacteria | 1784 |
| 100 | Ga0207656_10057629 | 3300025321 | Bacteria | 1695 |
| 101 | Ga0207692_10209351 | 3300025898 | Bacteria | 1151 |
| 102 | Ga0207642_10000173 | 3300025899 | Bacteria | 18494 |
| 103 | Ga0207710_10000384 | 3300025900 | Bacteria | 30192 |
| 104 | Ga0207710_10295533 | 3300025900 | Bacteria | 817 |
| 105 | Ga0207680_10010092 | 3300025903 | Bacteria | 4712 |
| 106 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 107 | Ga0207695_10318638 | 3300025913 | Bacteria | 1444 |
| 108 | Ga0207693_10001350 | 3300025915 | Bacteria | 21696 |
| 109 | Ga0207663_10277571 | 3300025916 | Bacteria | 1243 |
| 110 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 111 | Ga0207652_10004947 | 3300025921 | Bacteria | 10790 |
| 112 | Ga0207650_10020601 | 3300025925 | Bacteria | 4652 |
| 113 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 114 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 115 | Ga0207687_10011779 | 3300025927 | Bacteria | 5721 |
| 116 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 117 | Ga0207700_10179080 | 3300025928 | Bacteria | 1774 |
| 118 | Ga0207664_11107331 | 3300025929 | Bacteria | 708 |
| 119 | Ga0207690_10021716 | 3300025932 | Bacteria | 3984 |
| 120 | Ga0207686_10000230 | 3300025934 | Bacteria | 42566 |
| 121 | Ga0207686_10000517 | 3300025934 | Bacteria | 24947 |
| 122 | Ga0207686_10112680 | 3300025934 | Bacteria | 1838 |
| 123 | Ga0207686_10334321 | 3300025934 | Bacteria | 1136 |
| 124 | Ga0207709_10031823 | 3300025935 | Bacteria | 3084 |
| 125 | Ga0207709_10726987 | 3300025935 | Bacteria | 796 |
| 126 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 127 | Ga0207704_10940183 | 3300025938 | Unclassified | 729 |
| 128 | Ga0207665_10255774 | 3300025939 | Bacteria | 1296 |
| 129 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 130 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 131 | Ga0207689_10132822 | 3300025942 | Bacteria | 2049 |
| 132 | Ga0207661_10000858 | 3300025944 | Bacteria | 19953 |
| 133 | Ga0207661_10001136 | 3300025944 | Bacteria | 17743 |
| 134 | Ga0207661_10136746 | 3300025944 | Bacteria | 2105 |
| 135 | Ga0207661_10158670 | 3300025944 | Bacteria | 1961 |
| 136 | Ga0207679_10045829 | 3300025945 | Bacteria | 3165 |
| 137 | Ga0207712_10940711 | 3300025961 | Bacteria | 765 |
| 138 | Ga0207640_10000054 | 3300025981 | Bacteria | 95136 |
| 139 | Ga0207658_10009339 | 3300025986 | Bacteria | 6653 |
| 140 | Ga0207677_10001225 | 3300026023 | Bacteria | 13820 |
| 141 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 142 | Ga0207639_10110851 | 3300026041 | Bacteria | 2236 |
| 143 | Ga0207678_10005910 | 3300026067 | Bacteria | 10904 |
| 144 | Ga0207708_10742550 | 3300026075 | Unclassified | 842 |
| 145 | Ga0207702_10000105 | 3300026078 | Bacteria | 97835 |
| 146 | Ga0207702_10022827 | 3300026078 | Bacteria | 5190 |
| 147 | Ga0207641_10005248 | 3300026088 | Bacteria | 11075 |
| 148 | Ga0207676_10000042 | 3300026095 | Bacteria | 163475 |
| 149 | Ga0207674_10084683 | 3300026116 | Bacteria | 3168 |
| 150 | Ga0207675_100050390 | 3300026118 | Bacteria | 3885 |
| 151 | Ga0207683_10011240 | 3300026121 | Bacteria | 7632 |
| 152 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 153 | Ga0207698_10013832 | 3300026142 | Bacteria | 5342 |
| 154 | Ga0268266_10000526 | 3300028379 | Bacteria | 53404 |
| 155 | Ga0268266_10372993 | 3300028379 | Bacteria | 1344 |
| 156 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 157 | Ga0265336_10098925 | 3300028666 | Bacteria | 869 |
| 158 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 159 | Ga0265324_10066439 | 3300029957 | Bacteria | 1230 |
| 160 | Ga0307511_10186981 | 3300030521 | Bacteria | 1103 |
| 161 | Ga0265325_10004849 | 3300031241 | Bacteria | 8410 |
| 162 | Ga0265327_10100801 | 3300031251 | Bacteria | 1394 |
| 163 | Ga0265313_10047571 | 3300031595 | Bacteria | 2075 |
| 164 | Ga0307415_100022166 | 3300032126 | Bacteria | 3916 |
| 165 | Ga0316583_10180128 | 3300032133 | Bacteria | 735 |
| 166 | Ga0373956_0135683 | 3300035119 | Bacteria | 1154 |
| 167 | Ga0373957_0301914 | 3300035120 | Unclassified | 679 |
| 168 | Ga0373955_0161312 | 3300035172 | Bacteria | 1323 |
| 169 | Ga0373937_0019902 | 3300036401 | Bacteria | 6012 |
| 170 | Ga0373937_0321596 | 3300036401 | Bacteria | 1464 |
| 171 | Ga0451800_1002997 | 3300041459 | Bacteria | 1289 |
| 172 | Ga0451807_2420247 | 3300041486 | Bacteria | 535 |
| 173 | Ga0451839_1609670 | 3300041496 | Bacteria | 683 |
| 174 | Ga0451845_0039832 | 3300041501 | Bacteria | 529 |
| 175 | Ga0451853_0080552 | 3300041512 | Bacteria | 768 |
| 176 | Ga0451853_2817954 | 3300041512 | Bacteria | 691 |
| 177 | Ga0466963_0000141 | 3300044694 | Bacteria | 28151 |
| 178 | Ga0466963_0020529 | 3300044694 | Bacteria | 4154 |
| 179 | Ga0466957_0309889 | 3300044842 | Bacteria | 1063 |
| 180 | Ga0466958_0061914 | 3300045836 | Bacteria | 2280 |
| 181 | Ga0466967_0000002 | 3300045976 | Bacteria | 219994 |
| 182 | Ga0495592_0133487 | 3300046454 | Bacteria | 1734 |
| 183 | Ga0495592_0139418 | 3300046454 | Bacteria | 1688 |
| 184 | Ga0495629_0001042 | 3300046459 | Bacteria | 22205 |
| 185 | Ga0495629_0016047 | 3300046459 | Bacteria | 5382 |
| 186 | Ga0495629_0354071 | 3300046459 | Bacteria | 1001 |
| 187 | Ga0495641_0013717 | 3300046461 | Bacteria | 4431 |
| 188 | Ga0495651_0678368 | 3300046462 | Bacteria | 644 |
| 189 | Ga0495653_0101341 | 3300046463 | Bacteria | 2086 |
| 190 | Ga0495653_0120254 | 3300046463 | Bacteria | 1873 |
| 191 | Ga0495662_0011321 | 3300046476 | Bacteria | 4359 |
| 192 | Ga0495662_0094510 | 3300046476 | Bacteria | 1460 |
| 193 | Ga0495664_0552811 | 3300046477 | Bacteria | 686 |
| 194 | Ga0495594_0000009 | 3300046499 | Bacteria | 122139 |
| 195 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 196 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 197 | Ga0495608_0097387 | 3300046511 | Bacteria | 1899 |
| 198 | Ga0495618_0144960 | 3300046514 | Bacteria | 1518 |
| 199 | Ga0495628_0004134 | 3300046516 | Bacteria | 12910 |
| 200 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 201 | Ga0495630_0415956 | 3300046517 | Bacteria | 1030 |
| 202 | Ga0495637_0048223 | 3300046520 | Bacteria | 1795 |
| 203 | Ga0495643_0205895 | 3300046522 | Bacteria | 942 |
| 204 | Ga0495587_0001456 | 3300046536 | Bacteria | 15786 |
| 205 | Ga0495621_0023944 | 3300046539 | Bacteria | 2034 |
| 206 | Ga0495622_0001307 | 3300046557 | Bacteria | 12771 |
| 207 | Ga0495667_0049109 | 3300046559 | Bacteria | 2785 |
| 208 | Ga0495656_0000466 | 3300046615 | Bacteria | 13187 |
| 209 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 210 | Ga0495634_0672425 | 3300046642 | Bacteria | 597 |
| 211 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 212 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 213 | Ga0495647_0006720 | 3300046681 | Bacteria | 3827 |
| 214 | Ga0495613_0000233 | 3300046689 | Bacteria | 53074 |
| 215 | Ga0495613_0024473 | 3300046689 | Bacteria | 4499 |
| 216 | Ga0495613_0078210 | 3300046689 | Bacteria | 2407 |
| 217 | Ga0495624_0000400 | 3300046690 | Bacteria | 34373 |
| 218 | Ga0495624_0382887 | 3300046690 | Bacteria | 845 |
| 219 | Ga0495600_0093525 | 3300046809 | Bacteria | 1960 |
| 220 | Ga0495660_0366160 | 3300046810 | Bacteria | 638 |
| 221 | Ga0495604_0006007 | 3300047317 | Bacteria | 9641 |
| 222 | Ga0495604_0037979 | 3300047317 | Bacteria | 3789 |
| 223 | Ga0495672_0103516 | 3300047320 | Bacteria | 1540 |
| 224 | Ga0495676_0005983 | 3300047321 | Bacteria | 11177 |
| 225 | Ga0495676_0072204 | 3300047321 | Bacteria | 2651 |
| 226 | Ga0495676_0244426 | 3300047321 | Bacteria | 1227 |
| 227 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 228 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 229 | Ga0495602_0004130 | 3300048088 | Bacteria | 15127 |
| 230 | Ga0495602_0722498 | 3300048088 | Bacteria | 674 |
| 231 | Ga0495614_0101496 | 3300048089 | Bacteria | 1258 |
| 232 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 233 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 234 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 235 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 236 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 237 | Ga0496102_0605411 | 3300048905 | Bacteria | 1019 |
| 238 | Ga0496102_1759222 | 3300048905 | Bacteria | 537 |
| 239 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 240 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 241 | Ga0496104_0000230 | 3300048907 | Bacteria | 49225 |
| 242 | Ga0496104_0072271 | 3300048907 | Bacteria | 3280 |
| 243 | Ga0496104_1297892 | 3300048907 | Bacteria | 631 |
| 244 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 245 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 246 | Ga0496105_0031461 | 3300048908 | Bacteria | 4350 |
| 247 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 248 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 249 | Ga0496106_0000134 | 3300048909 | Bacteria | 55531 |
| 250 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 251 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 252 | Ga0496107_0187513 | 3300048910 | Bacteria | 1536 |
| 253 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 254 | Ga0496108_0000537 | 3300048911 | Bacteria | 29610 |
| 255 | Ga0496108_0051894 | 3300048911 | Bacteria | 3435 |
| 256 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 257 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 258 | Ga0496109_0003599 | 3300048912 | Bacteria | 12942 |
| 259 | Ga0496109_0251895 | 3300048912 | Bacteria | 1663 |
| 260 | Ga0496110_0000052 | 3300048913 | Bacteria | 58549 |
| 261 | Ga0496110_0020706 | 3300048913 | Bacteria | 5555 |
| 262 | Ga0496110_0093951 | 3300048913 | Bacteria | 2685 |
| 263 | Ga0496111_0000209 | 3300048914 | Bacteria | 27572 |
| 264 | Ga0496111_0074371 | 3300048914 | Bacteria | 2475 |
| 265 | Ga0496112_0001298 | 3300048915 | Bacteria | 18986 |
| 266 | Ga0496113_0000065 | 3300048916 | Bacteria | 45403 |
| 267 | Ga0496114_0143902 | 3300048917 | Bacteria | 2066 |
| 268 | Ga0496118_0351847 | 3300048921 | Bacteria | 785 |
| 269 | Ga0496119_0024814 | 3300048922 | Bacteria | 4205 |
| 270 | Ga0496120_0211872 | 3300048923 | Bacteria | 931 |
| 271 | Ga0496124_0757707 | 3300048927 | Bacteria | 607 |
| 272 | Ga0501042_0089912 | 3300049578 | Bacteria | 2203 |
| 273 | Ga0501047_0743913 | 3300049581 | Bacteria | 797 |
| 274 | Ga0501070_0133810 | 3300049586 | Bacteria | 2047 |
| 275 | Ga0501070_0261650 | 3300049586 | Bacteria | 1414 |
| 276 | Ga0501075_1040459 | 3300049591 | Unclassified | 622 |
| 277 | Ga0501076_0148711 | 3300049592 | Bacteria | 1905 |
| 278 | Ga0501077_0660512 | 3300049593 | Bacteria | 672 |
| 279 | Ga0501079_0248939 | 3300049741 | Bacteria | 1389 |
| 280 | nmdc:mga05p37_533763_c1 | 3300050507 | Bacteria | 1339 |
| 281 | nmdc:mga06r32_50233_c1 | 3300050510 | Bacteria | 3989 |
| 282 | nmdc:mga08x19_558559_c1 | 3300050514 | Bacteria | 810 |
| 283 | nmdc:mga08x19_744256_c1 | 3300050514 | Bacteria | 696 |
| 284 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 285 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 286 | Ga0495601_0005883 | 3300053077 | Bacteria | 7151 |
| 287 | Ga0495601_0668285 | 3300053077 | Unclassified | 664 |
| 288 | Ga0495612_0004941 | 3300053078 | Bacteria | 5517 |
| 289 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 290 | Ga0495655_0190993 | 3300053083 | Bacteria | 665 |
| 291 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 292 | Ga0495595_0006885 | 3300053084 | Bacteria | 4640 |
| 293 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 294 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 295 | Ga0495619_0000088 | 3300053085 | Bacteria | 69615 |
| 296 | Ga0495619_0000506 | 3300053085 | Bacteria | 25971 |
| 297 | Ga0495619_0000682 | 3300053085 | Bacteria | 22203 |
| 298 | Ga0500628_000072 | 3300053129 | Bacteria | 26251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046536 | Ga0495587_0001456 | Ga0495587_0001456_6060_6521 | 127 |
| 2 | 3300005719 | Ga0068861_100106735 | Ga0068861_1001067353 | 129 |
| 3 | 3300026118 | Ga0207675_100050390 | Ga0207675_1000503902 | 129 |
| 4 | 3300006881 | Ga0068865_100826585 | Ga0068865_1008265852 | 130 |
| 5 | 3300025938 | Ga0207704_10940183 | Ga0207704_109401831 | 130 |
| 6 | 3300048905 | Ga0496102_0000129 | Ga0496102_0000129_96508_96972 | 130 |
| 7 | 3300048906 | Ga0496103_0000087 | Ga0496103_0000087_96506_96970 | 130 |
| 8 | 3300048908 | Ga0496105_0031461 | Ga0496105_0031461_814_1275 | 131 |
| 9 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006327 | 132 |
| 10 | 3300025927 | Ga0207687_10000040 | Ga0207687_1000004015 | 132 |
| 11 | 3300025934 | Ga0207686_10000230 | Ga0207686_1000023027 | 132 |
| 12 | 3300046459 | Ga0495629_0016047 | Ga0495629_0016047_3791_4255 | 132 |
| 13 | 3300005329 | Ga0070683_100645921 | Ga0070683_1006459212 | 133 |
| 14 | 3300005455 | Ga0070663_100003185 | Ga0070663_1000031855 | 133 |
| 15 | 3300005530 | Ga0070679_100006435 | Ga0070679_1000064355 | 133 |
| 16 | 3300025921 | Ga0207652_10004947 | Ga0207652_100049474 | 133 |
| 17 | 3300025944 | Ga0207661_10136746 | Ga0207661_101367462 | 133 |
| 18 | 3300026067 | Ga0207678_10005910 | Ga0207678_100059105 | 133 |
| 19 | 3300044842 | Ga0466957_0309889 | Ga0466957_0309889_110_574 | 135 |
| 20 | 3300005365 | Ga0070688_100000161 | Ga0070688_10000016125 | 136 |
| 21 | 3300005466 | Ga0070685_10000061 | Ga0070685_1000006154 | 136 |
| 22 | 3300009098 | Ga0105245_10000314 | Ga0105245_1000031415 | 136 |
| 23 | 3300046689 | Ga0495613_0078210 | Ga0495613_0078210_1092_1556 | 136 |
| 24 | 3300049592 | Ga0501076_0148711 | Ga0501076_0148711_246_710 | 137 |
| 25 | 3300005435 | Ga0070714_101185775 | Ga0070714_1011857752 | 138 |
| 26 | 3300005614 | Ga0068856_100055114 | Ga0068856_1000551142 | 139 |
| 27 | 3300005616 | Ga0068852_100000966 | Ga0068852_10000096622 | 139 |
| 28 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037178 | 139 |
| 29 | 3300013105 | Ga0157369_10001730 | Ga0157369_100017302 | 139 |
| 30 | 3300025934 | Ga0207686_10334321 | Ga0207686_103343212 | 139 |
| 31 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011365 | 139 |
| 32 | 3300026078 | Ga0207702_10022827 | Ga0207702_100228275 | 139 |
| 33 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015123 | 139 |
| 34 | 3300046642 | Ga0495634_0672425 | Ga0495634_0672425_11_430 | 139 |
| 35 | 3300005615 | Ga0070702_101039793 | Ga0070702_1010397931 | 140 |
| 36 | 3300041459 | Ga0451800_1002997 | Ga0451800_1002997_106_570 | 140 |
| 37 | 3300041486 | Ga0451807_2420247 | Ga0451807_2420247_27_491 | 140 |
| 38 | 3300041512 | Ga0451853_0080552 | Ga0451853_0080552_47_511 | 140 |
| 39 | 3300005436 | Ga0070713_100097029 | Ga0070713_1000970293 | 145 |
| 40 | 3300005439 | Ga0070711_100428119 | Ga0070711_1004281192 | 145 |
| 41 | 3300025916 | Ga0207663_10277571 | Ga0207663_102775712 | 145 |
| 42 | 3300025928 | Ga0207700_10179080 | Ga0207700_101790802 | 145 |
| 43 | 3300032126 | Ga0307415_100022166 | Ga0307415_1000221662 | 146 |
| 44 | 3300045976 | Ga0466967_0000002 | Ga0466967_0000002_9915_10355 | 146 |
| 45 | 3300046463 | Ga0495653_0101341 | Ga0495653_0101341_1627_2067 | 146 |
| 46 | 3300003659 | JGI25404J52841_10049051 | JGI25404J52841_100490512 | 147 |
| 47 | 3300005329 | Ga0070683_100005586 | Ga0070683_1000055868 | 147 |
| 48 | 3300005329 | Ga0070683_100012615 | Ga0070683_1000126154 | 147 |
| 49 | 3300005337 | Ga0070682_100000026 | Ga0070682_100000026193 | 147 |
| 50 | 3300005338 | Ga0068868_100001800 | Ga0068868_1000018008 | 147 |
| 51 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004255 | 147 |
| 52 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005058 | 147 |
| 53 | 3300005365 | Ga0070688_100000077 | Ga0070688_10000007751 | 147 |
| 54 | 3300005365 | Ga0070688_100035508 | Ga0070688_1000355082 | 147 |
| 55 | 3300005367 | Ga0070667_100527408 | Ga0070667_1005274082 | 147 |
| 56 | 3300005436 | Ga0070713_100006777 | Ga0070713_1000067772 | 147 |
| 57 | 3300005438 | Ga0070701_10220442 | Ga0070701_102204422 | 147 |
| 58 | 3300005439 | Ga0070711_100012790 | Ga0070711_1000127905 | 147 |
| 59 | 3300005456 | Ga0070678_100014248 | Ga0070678_1000142484 | 147 |
| 60 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010136 | 147 |
| 61 | 3300005535 | Ga0070684_100004420 | Ga0070684_1000044204 | 147 |
| 62 | 3300005535 | Ga0070684_100028439 | Ga0070684_1000284394 | 147 |
| 63 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003183 | 147 |
| 64 | 3300005548 | Ga0070665_100006702 | Ga0070665_1000067028 | 147 |
| 65 | 3300005548 | Ga0070665_100329173 | Ga0070665_1003291732 | 147 |
| 66 | 3300005577 | Ga0068857_100118832 | Ga0068857_1001188322 | 147 |
| 67 | 3300005578 | Ga0068854_100000082 | Ga0068854_10000008235 | 147 |
| 68 | 3300005616 | Ga0068852_100198403 | Ga0068852_1001984032 | 147 |
| 69 | 3300005834 | Ga0068851_10000141 | Ga0068851_1000014124 | 147 |
| 70 | 3300005834 | Ga0068851_10007310 | Ga0068851_100073103 | 147 |
| 71 | 3300005983 | Ga0081540_1000868 | Ga0081540_100086814 | 147 |
| 72 | 3300006175 | Ga0070712_100032187 | Ga0070712_1000321873 | 147 |
| 73 | 3300006881 | Ga0068865_100000499 | Ga0068865_1000004999 | 147 |
| 74 | 3300025321 | Ga0207656_10051285 | Ga0207656_100512852 | 147 |
| 75 | 3300025321 | Ga0207656_10057629 | Ga0207656_100576292 | 147 |
| 76 | 3300025900 | Ga0207710_10295533 | Ga0207710_102955332 | 147 |
| 77 | 3300025903 | Ga0207680_10010092 | Ga0207680_100100922 | 147 |
| 78 | 3300025915 | Ga0207693_10001350 | Ga0207693_100013507 | 147 |
| 79 | 3300025920 | Ga0207649_10000003 | Ga0207649_100000034 | 147 |
| 80 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005560 | 147 |
| 81 | 3300025927 | Ga0207687_10011779 | Ga0207687_100117792 | 147 |
| 82 | 3300025929 | Ga0207664_11107331 | Ga0207664_111073311 | 147 |
| 83 | 3300025934 | Ga0207686_10000517 | Ga0207686_100005176 | 147 |
| 84 | 3300025935 | Ga0207709_10031823 | Ga0207709_100318232 | 147 |
| 85 | 3300025938 | Ga0207704_10000018 | Ga0207704_10000018166 | 147 |
| 86 | 3300025940 | Ga0207691_10000178 | Ga0207691_100001782 | 147 |
| 87 | 3300025944 | Ga0207661_10000858 | Ga0207661_100008587 | 147 |
| 88 | 3300025944 | Ga0207661_10001136 | Ga0207661_100011364 | 147 |
| 89 | 3300025961 | Ga0207712_10940711 | Ga0207712_109407112 | 147 |
| 90 | 3300025981 | Ga0207640_10000054 | Ga0207640_1000005410 | 147 |
| 91 | 3300026023 | Ga0207677_10001225 | Ga0207677_1000122511 | 147 |
| 92 | 3300026116 | Ga0207674_10084683 | Ga0207674_100846833 | 147 |
| 93 | 3300026121 | Ga0207683_10011240 | Ga0207683_100112404 | 147 |
| 94 | 3300026142 | Ga0207698_10013832 | Ga0207698_100138322 | 147 |
| 95 | 3300028379 | Ga0268266_10000526 | Ga0268266_1000052656 | 147 |
| 96 | 3300028379 | Ga0268266_10372993 | Ga0268266_103729932 | 147 |
| 97 | 3300041501 | Ga0451845_0039832 | Ga0451845_0039832_20_463 | 147 |
| 98 | 3300046516 | Ga0495628_0004134 | Ga0495628_0004134_3939_4382 | 147 |
| 99 | 3300048921 | Ga0496118_0351847 | Ga0496118_0351847_10_453 | 147 |
| 100 | 3300047317 | Ga0495604_0006007 | Ga0495604_0006007_6484_6948 | 148 |
| 101 | 3300005618 | Ga0068864_100000043 | Ga0068864_100000043165 | 152 |
| 102 | 3300005718 | Ga0068866_10000296 | Ga0068866_1000029619 | 152 |
| 103 | 3300005842 | Ga0068858_100000046 | Ga0068858_10000004652 | 152 |
| 104 | 3300009148 | Ga0105243_10651085 | Ga0105243_106510852 | 152 |
| 105 | 3300009176 | Ga0105242_11156714 | Ga0105242_111567142 | 152 |
| 106 | 3300013104 | Ga0157370_10012447 | Ga0157370_100124472 | 152 |
| 107 | 3300013308 | Ga0157375_10000365 | Ga0157375_1000036512 | 152 |
| 108 | 3300025899 | Ga0207642_10000173 | Ga0207642_100001737 | 152 |
| 109 | 3300025934 | Ga0207686_10112680 | Ga0207686_101126802 | 152 |
| 110 | 3300025935 | Ga0207709_10726987 | Ga0207709_107269872 | 152 |
| 111 | 3300026035 | Ga0207703_10000042 | Ga0207703_1000004217 | 152 |
| 112 | 3300026095 | Ga0207676_10000042 | Ga0207676_100000426 | 152 |
| 113 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_103988_104446 | 152 |
| 114 | 3300005334 | Ga0068869_100114324 | Ga0068869_1001143243 | 153 |
| 115 | 3300005547 | Ga0070693_100000422 | Ga0070693_1000004229 | 153 |
| 116 | 3300005841 | Ga0068863_101234594 | Ga0068863_1012345942 | 153 |
| 117 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000863 | 153 |
| 118 | 3300006173 | Ga0070716_101303468 | Ga0070716_1013034681 | 153 |
| 119 | 3300006358 | Ga0068871_100412296 | Ga0068871_1004122962 | 153 |
| 120 | 3300006852 | Ga0075433_10000592 | Ga0075433_1000059213 | 153 |
| 121 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001263 | 153 |
| 122 | 3300025939 | Ga0207665_10255774 | Ga0207665_102557742 | 153 |
| 123 | 3300025942 | Ga0207689_10132822 | Ga0207689_101328222 | 153 |
| 124 | 3300026075 | Ga0207708_10742550 | Ga0207708_107425501 | 153 |
| 125 | 3300030521 | Ga0307511_10186981 | Ga0307511_101869811 | 153 |
| 126 | 3300046454 | Ga0495592_0133487 | Ga0495592_0133487_49_510 | 153 |
| 127 | 3300046459 | Ga0495629_0354071 | Ga0495629_0354071_263_724 | 153 |
| 128 | 3300046462 | Ga0495651_0678368 | Ga0495651_0678368_72_533 | 153 |
| 129 | 3300046463 | Ga0495653_0120254 | Ga0495653_0120254_503_964 | 153 |
| 130 | 3300046476 | Ga0495662_0094510 | Ga0495662_0094510_648_1109 | 153 |
| 131 | 3300046511 | Ga0495608_0097387 | Ga0495608_0097387_189_650 | 153 |
| 132 | 3300046514 | Ga0495618_0144960 | Ga0495618_0144960_160_621 | 153 |
| 133 | 3300046517 | Ga0495630_0415956 | Ga0495630_0415956_408_869 | 153 |
| 134 | 3300046539 | Ga0495621_0023944 | Ga0495621_0023944_477_938 | 153 |
| 135 | 3300046557 | Ga0495622_0001307 | Ga0495622_0001307_2892_3353 | 153 |
| 136 | 3300046559 | Ga0495667_0049109 | Ga0495667_0049109_2104_2565 | 153 |
| 137 | 3300046615 | Ga0495656_0000466 | Ga0495656_0000466_5143_5604 | 153 |
| 138 | 3300046689 | Ga0495613_0024473 | Ga0495613_0024473_255_716 | 153 |
| 139 | 3300047321 | Ga0495676_0072204 | Ga0495676_0072204_1292_1753 | 153 |
| 140 | 3300048089 | Ga0495614_0101496 | Ga0495614_0101496_243_704 | 153 |
| 141 | 3300048907 | Ga0496104_0000230 | Ga0496104_0000230_32345_32806 | 153 |
| 142 | 3300048907 | Ga0496104_1297892 | Ga0496104_1297892_53_514 | 153 |
| 143 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_43478_43939 | 153 |
| 144 | 3300048909 | Ga0496106_0000042 | Ga0496106_0000042_78455_78916 | 153 |
| 145 | 3300048910 | Ga0496107_0187513 | Ga0496107_0187513_751_1212 | 153 |
| 146 | 3300048911 | Ga0496108_0000537 | Ga0496108_0000537_4057_4518 | 153 |
| 147 | 3300048912 | Ga0496109_0003599 | Ga0496109_0003599_8447_8908 | 153 |
| 148 | 3300048912 | Ga0496109_0251895 | Ga0496109_0251895_416_877 | 153 |
| 149 | 3300049586 | Ga0501070_0261650 | Ga0501070_0261650_319_780 | 153 |
| 150 | 3300049591 | Ga0501075_1040459 | Ga0501075_1040459_144_605 | 153 |
| 151 | 3300049593 | Ga0501077_0660512 | Ga0501077_0660512_192_653 | 153 |
| 152 | 3300049741 | Ga0501079_0248939 | Ga0501079_0248939_575_1036 | 153 |
| 153 | 3300050515 | nmdc:mga0a205_4_c1 | nmdc:mga0a205_4_c1_106874_107335 | 153 |
| 154 | 3300053077 | Ga0495601_0005883 | Ga0495601_0005883_5787_6248 | 153 |
| 155 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_421944_422405 | 153 |
| 156 | 3300053085 | Ga0495619_0000506 | Ga0495619_0000506_10381_10842 | 153 |
| 157 | 3300053085 | Ga0495619_0000682 | Ga0495619_0000682_11414_11875 | 153 |
| 158 | 3300001979 | JGI24740J21852_10031842 | JGI24740J21852_100318422 | 154 |
| 159 | 3300005329 | Ga0070683_100147213 | Ga0070683_1001472132 | 154 |
| 160 | 3300005337 | Ga0070682_100157754 | Ga0070682_1001577542 | 154 |
| 161 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000442 | 154 |
| 162 | 3300005344 | Ga0070661_101532546 | Ga0070661_1015325461 | 154 |
| 163 | 3300005366 | Ga0070659_100023857 | Ga0070659_1000238572 | 154 |
| 164 | 3300005367 | Ga0070667_100013639 | Ga0070667_1000136394 | 154 |
| 165 | 3300005435 | Ga0070714_100117097 | Ga0070714_1001170973 | 154 |
| 166 | 3300005437 | Ga0070710_10432914 | Ga0070710_104329141 | 154 |
| 167 | 3300005539 | Ga0068853_100026109 | Ga0068853_1000261092 | 154 |
| 168 | 3300005614 | Ga0068856_100000417 | Ga0068856_10000041730 | 154 |
| 169 | 3300005719 | Ga0068861_100664634 | Ga0068861_1006646342 | 154 |
| 170 | 3300005841 | Ga0068863_100007352 | Ga0068863_10000735212 | 154 |
| 171 | 3300006847 | Ga0075431_100037539 | Ga0075431_1000375394 | 154 |
| 172 | 3300009093 | Ga0105240_10482906 | Ga0105240_104829062 | 154 |
| 173 | 3300009094 | Ga0111539_11008356 | Ga0111539_110083562 | 154 |
| 174 | 3300009094 | Ga0111539_11830668 | Ga0111539_118306681 | 154 |
| 175 | 3300009098 | Ga0105245_10021024 | Ga0105245_100210247 | 154 |
| 176 | 3300009101 | Ga0105247_10000131 | Ga0105247_1000013123 | 154 |
| 177 | 3300009101 | Ga0105247_10402616 | Ga0105247_104026162 | 154 |
| 178 | 3300009147 | Ga0114129_10893167 | Ga0114129_108931672 | 154 |
| 179 | 3300009148 | Ga0105243_10062405 | Ga0105243_100624053 | 154 |
| 180 | 3300009553 | Ga0105249_10547428 | Ga0105249_105474282 | 154 |
| 181 | 3300009553 | Ga0105249_10925752 | Ga0105249_109257522 | 154 |
| 182 | 3300010375 | Ga0105239_10910713 | Ga0105239_109107131 | 154 |
| 183 | 3300013100 | Ga0157373_10752893 | Ga0157373_107528931 | 154 |
| 184 | 3300013102 | Ga0157371_10027844 | Ga0157371_100278445 | 154 |
| 185 | 3300013104 | Ga0157370_10993698 | Ga0157370_109936981 | 154 |
| 186 | 3300013296 | Ga0157374_10639148 | Ga0157374_106391481 | 154 |
| 187 | 3300013297 | Ga0157378_10015261 | Ga0157378_100152614 | 154 |
| 188 | 3300013297 | Ga0157378_10019758 | Ga0157378_100197584 | 154 |
| 189 | 3300013297 | Ga0157378_10434655 | Ga0157378_104346552 | 154 |
| 190 | 3300013306 | Ga0163162_10392787 | Ga0163162_103927872 | 154 |
| 191 | 3300013307 | Ga0157372_10001749 | Ga0157372_1000174911 | 154 |
| 192 | 3300013308 | Ga0157375_10003564 | Ga0157375_1000356411 | 154 |
| 193 | 3300014745 | Ga0157377_10154410 | Ga0157377_101544102 | 154 |
| 194 | 3300017792 | Ga0163161_10029785 | Ga0163161_100297853 | 154 |
| 195 | 3300020081 | Ga0206354_11074552 | Ga0206354_110745522 | 154 |
| 196 | 3300022467 | Ga0224712_10385444 | Ga0224712_103854441 | 154 |
| 197 | 3300025898 | Ga0207692_10209351 | Ga0207692_102093512 | 154 |
| 198 | 3300025900 | Ga0207710_10000384 | Ga0207710_100003848 | 154 |
| 199 | 3300025913 | Ga0207695_10318638 | Ga0207695_103186382 | 154 |
| 200 | 3300025925 | Ga0207650_10020601 | Ga0207650_100206012 | 154 |
| 201 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003156 | 154 |
| 202 | 3300025932 | Ga0207690_10021716 | Ga0207690_100217162 | 154 |
| 203 | 3300025944 | Ga0207661_10158670 | Ga0207661_101586702 | 154 |
| 204 | 3300025945 | Ga0207679_10045829 | Ga0207679_100458292 | 154 |
| 205 | 3300025986 | Ga0207658_10009339 | Ga0207658_100093394 | 154 |
| 206 | 3300026041 | Ga0207639_10110851 | Ga0207639_101108512 | 154 |
| 207 | 3300026078 | Ga0207702_10000105 | Ga0207702_1000010571 | 154 |
| 208 | 3300026088 | Ga0207641_10005248 | Ga0207641_100052487 | 154 |
| 209 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001069 | 154 |
| 210 | 3300028666 | Ga0265336_10098925 | Ga0265336_100989252 | 154 |
| 211 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028740 | 154 |
| 212 | 3300029957 | Ga0265324_10066439 | Ga0265324_100664392 | 154 |
| 213 | 3300031241 | Ga0265325_10004849 | Ga0265325_100048494 | 154 |
| 214 | 3300031251 | Ga0265327_10100801 | Ga0265327_101008012 | 154 |
| 215 | 3300031595 | Ga0265313_10047571 | Ga0265313_100475712 | 154 |
| 216 | 3300032133 | Ga0316583_10180128 | Ga0316583_101801282 | 154 |
| 217 | 3300035119 | Ga0373956_0135683 | Ga0373956_0135683_615_1079 | 154 |
| 218 | 3300035120 | Ga0373957_0301914 | Ga0373957_0301914_161_625 | 154 |
| 219 | 3300035172 | Ga0373955_0161312 | Ga0373955_0161312_74_538 | 154 |
| 220 | 3300036401 | Ga0373937_0019902 | Ga0373937_0019902_375_839 | 154 |
| 221 | 3300036401 | Ga0373937_0321596 | Ga0373937_0321596_917_1381 | 154 |
| 222 | 3300041496 | Ga0451839_1609670 | Ga0451839_1609670_99_563 | 154 |
| 223 | 3300041512 | Ga0451853_2817954 | Ga0451853_2817954_94_558 | 154 |
| 224 | 3300044694 | Ga0466963_0000141 | Ga0466963_0000141_9104_9568 | 154 |
| 225 | 3300044694 | Ga0466963_0020529 | Ga0466963_0020529_1395_1862 | 154 |
| 226 | 3300045836 | Ga0466958_0061914 | Ga0466958_0061914_1499_1963 | 154 |
| 227 | 3300046454 | Ga0495592_0139418 | Ga0495592_0139418_1075_1542 | 154 |
| 228 | 3300046459 | Ga0495629_0001042 | Ga0495629_0001042_9032_9499 | 154 |
| 229 | 3300046461 | Ga0495641_0013717 | Ga0495641_0013717_3783_4250 | 154 |
| 230 | 3300046476 | Ga0495662_0011321 | Ga0495662_0011321_2935_3408 | 154 |
| 231 | 3300046477 | Ga0495664_0552811 | Ga0495664_0552811_46_513 | 154 |
| 232 | 3300046499 | Ga0495594_0000009 | Ga0495594_0000009_15717_16181 | 154 |
| 233 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_37218_37685 | 154 |
| 234 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_112857_113321 | 154 |
| 235 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_55400_55867 | 154 |
| 236 | 3300046520 | Ga0495637_0048223 | Ga0495637_0048223_1243_1710 | 154 |
| 237 | 3300046522 | Ga0495643_0205895 | Ga0495643_0205895_378_845 | 154 |
| 238 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_194792_195259 | 154 |
| 239 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_164056_164520 | 154 |
| 240 | 3300046681 | Ga0495647_0006720 | Ga0495647_0006720_1656_2123 | 154 |
| 241 | 3300046689 | Ga0495613_0000233 | Ga0495613_0000233_43303_43767 | 154 |
| 242 | 3300046690 | Ga0495624_0000400 | Ga0495624_0000400_23957_24424 | 154 |
| 243 | 3300046690 | Ga0495624_0382887 | Ga0495624_0382887_44_511 | 154 |
| 244 | 3300046809 | Ga0495600_0093525 | Ga0495600_0093525_1260_1724 | 154 |
| 245 | 3300046810 | Ga0495660_0366160 | Ga0495660_0366160_94_561 | 154 |
| 246 | 3300047317 | Ga0495604_0037979 | Ga0495604_0037979_2605_3069 | 154 |
| 247 | 3300047320 | Ga0495672_0103516 | Ga0495672_0103516_161_625 | 154 |
| 248 | 3300047321 | Ga0495676_0005983 | Ga0495676_0005983_381_845 | 154 |
| 249 | 3300047321 | Ga0495676_0244426 | Ga0495676_0244426_349_816 | 154 |
| 250 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_164056_164520 | 154 |
| 251 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_60524_60988 | 154 |
| 252 | 3300048088 | Ga0495602_0004130 | Ga0495602_0004130_9573_10037 | 154 |
| 253 | 3300048088 | Ga0495602_0722498 | Ga0495602_0722498_44_511 | 154 |
| 254 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_60984_61448 | 154 |
| 255 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_102480_102944 | 154 |
| 256 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_60973_61437 | 154 |
| 257 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_13195_13659 | 154 |
| 258 | 3300048905 | Ga0496102_0605411 | Ga0496102_0605411_244_708 | 154 |
| 259 | 3300048905 | Ga0496102_1759222 | Ga0496102_1759222_23_490 | 154 |
| 260 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_236865_237329 | 154 |
| 261 | 3300048907 | Ga0496104_0072271 | Ga0496104_0072271_1654_2121 | 154 |
| 262 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_236865_237329 | 154 |
| 263 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_95096_95560 | 154 |
| 264 | 3300048909 | Ga0496106_0000134 | Ga0496106_0000134_5625_6089 | 154 |
| 265 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_187040_187504 | 154 |
| 266 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_102480_102944 | 154 |
| 267 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_451864_452331 | 154 |
| 268 | 3300048911 | Ga0496108_0051894 | Ga0496108_0051894_2611_3078 | 154 |
| 269 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_82761_83228 | 154 |
| 270 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_27974_28441 | 154 |
| 271 | 3300048913 | Ga0496110_0000052 | Ga0496110_0000052_39530_39997 | 154 |
| 272 | 3300048913 | Ga0496110_0020706 | Ga0496110_0020706_567_1034 | 154 |
| 273 | 3300048913 | Ga0496110_0093951 | Ga0496110_0093951_1761_2231 | 154 |
| 274 | 3300048914 | Ga0496111_0000209 | Ga0496111_0000209_15551_16018 | 154 |
| 275 | 3300048914 | Ga0496111_0074371 | Ga0496111_0074371_1879_2346 | 154 |
| 276 | 3300048915 | Ga0496112_0001298 | Ga0496112_0001298_4867_5334 | 154 |
| 277 | 3300048916 | Ga0496113_0000065 | Ga0496113_0000065_42119_42586 | 154 |
| 278 | 3300048917 | Ga0496114_0143902 | Ga0496114_0143902_1032_1499 | 154 |
| 279 | 3300048922 | Ga0496119_0024814 | Ga0496119_0024814_2291_2755 | 154 |
| 280 | 3300048923 | Ga0496120_0211872 | Ga0496120_0211872_195_659 | 154 |
| 281 | 3300048927 | Ga0496124_0757707 | Ga0496124_0757707_59_526 | 154 |
| 282 | 3300049578 | Ga0501042_0089912 | Ga0501042_0089912_1078_1542 | 154 |
| 283 | 3300049581 | Ga0501047_0743913 | Ga0501047_0743913_296_763 | 154 |
| 284 | 3300049586 | Ga0501070_0133810 | Ga0501070_0133810_1428_1895 | 154 |
| 285 | 3300050507 | nmdc:mga05p37_533763_c1 | nmdc:mga05p37_533763_c1_718_1182 | 154 |
| 286 | 3300050510 | nmdc:mga06r32_50233_c1 | nmdc:mga06r32_50233_c1_1854_2321 | 154 |
| 287 | 3300050514 | nmdc:mga08x19_558559_c1 | nmdc:mga08x19_558559_c1_136_603 | 154 |
| 288 | 3300050514 | nmdc:mga08x19_744256_c1 | nmdc:mga08x19_744256_c1_112_579 | 154 |
| 289 | 3300053077 | Ga0495601_0000029 | Ga0495601_0000029_101526_101990 | 154 |
| 290 | 3300053077 | Ga0495601_0668285 | Ga0495601_0668285_169_633 | 154 |
| 291 | 3300053078 | Ga0495612_0004941 | Ga0495612_0004941_3548_4015 | 154 |
| 292 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_117648_118112 | 154 |
| 293 | 3300053083 | Ga0495655_0190993 | Ga0495655_0190993_168_635 | 154 |
| 294 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_112880_113344 | 154 |
| 295 | 3300053084 | Ga0495595_0006885 | Ga0495595_0006885_1343_1807 | 154 |
| 296 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_59220_59684 | 154 |
| 297 | 3300053085 | Ga0495619_0000088 | Ga0495619_0000088_67280_67747 | 154 |
| 298 | 3300053129 | Ga0500628_000072 | Ga0500628_000072_17513_17977 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r50-assembly2.cif.gz_K | crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. | 0.9012 | 7 | 151 |
| 2p9m-assembly1.cif.gz_A | crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 | 0.864 | 3 | 152 |
| 6uof-assembly1.cif.gz_A | 1.2 angstrom resolution crystal structure of cbs domains of transcriptional regulator from streptococcus pneumoniae | 0.8633 | 1 | 148 |
| 7r50-assembly2.cif.gz_J | crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. | 0.8631 | 7 | 151 |
| 2p9m-assembly1.cif.gz_B | crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 | 0.8628 | 2 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kpbA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8919 | 2 | 150 | 3.10.580.10 |
| af_Q2FXM2_188_307_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8828 | 2 | 151 | 3.10.580.10 |
| 3kpbA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.878 | 2 | 150 | 3.10.580.10 |
| 4at0A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8772 | 37 | 50 | 3.50.50.60 |
| af_P17115_194_318_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8731 | 1 | 148 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M3DAB5-F1-model_v4 | CBS domain-containing protein | 0.9415 | 2 | 151 |
|
| AF-A0A3R7WD35-F1-model_v4 | CBS domain-containing protein | 0.9006 | 3 | 153 |
GO:0009086
|
| AF-A0A075WDL2-F1-model_v4 | CBS domain-containing protein | 0.8965 | 1 | 152 |
|
| AF-A0A534VBP1-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.8938 | 1 | 153 |
GO:0000155
|
| AF-A0A532TTC0-F1-model_v4 | CBS domain-containing protein | 0.8906 | 2 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar