F394442

General Info

Members Datasets Scaffolds Average Seq Length
298 203 298 150

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0011321|Ga0495662_0011321_2935_3408
Length 157
Sequence MKTAGEIMDTDAPSVSPGDDARTAIDLLAKTDLGAIPVVDEERKVVGIVSXSDLVLSEEESDLHLPHYLNIMGGIVFVGSMKGFEERLEKAFATDVSELMTADPIVAHDYESADRVAKKIADKHHNHLPVVDADGHLMGMVTRADALAALVADGEDE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 12.75
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031842 3300001979 Bacteria 1694
2 JGI25404J52841_10049051 3300003659 Bacteria 888
3 Ga0070683_100005586 3300005329 Bacteria 10503
4 Ga0070683_100012615 3300005329 Bacteria 7347
5 Ga0070683_100147213 3300005329 Bacteria 2232
6 Ga0070683_100645921 3300005329 Bacteria 1013
7 Ga0068869_100114324 3300005334 Bacteria 2057
8 Ga0070682_100000026 3300005337 Bacteria 191388
9 Ga0070682_100157754 3300005337 Bacteria 1564
10 Ga0068868_100001800 3300005338 Bacteria 14722
11 Ga0070691_10000004 3300005341 Bacteria 80156
12 Ga0070661_100000004 3300005344 Bacteria 243876
13 Ga0070661_101532546 3300005344 Bacteria 563
14 Ga0070675_100000050 3300005354 Bacteria 72016
15 Ga0070688_100000077 3300005365 Bacteria 48743
16 Ga0070688_100000161 3300005365 Bacteria 35812
17 Ga0070688_100035508 3300005365 Bacteria 3028
18 Ga0070659_100023857 3300005366 Bacteria 4685
19 Ga0070667_100013639 3300005367 Bacteria 6715
20 Ga0070667_100527408 3300005367 Bacteria 1084
21 Ga0070714_100117097 3300005435 Bacteria 2366
22 Ga0070714_101185775 3300005435 Bacteria 745
23 Ga0070713_100006777 3300005436 Bacteria 7982
24 Ga0070713_100097029 3300005436 Bacteria 2546
25 Ga0070710_10432914 3300005437 Bacteria 888
26 Ga0070701_10220442 3300005438 Bacteria 1131
27 Ga0070711_100012790 3300005439 Bacteria 5255
28 Ga0070711_100428119 3300005439 Bacteria 1080
29 Ga0070663_100003185 3300005455 Bacteria 9419
30 Ga0070678_100014248 3300005456 Bacteria 5009
31 Ga0070685_10000010 3300005466 Bacteria 146946
32 Ga0070685_10000061 3300005466 Bacteria 63408
33 Ga0070679_100006435 3300005530 Bacteria 10943
34 Ga0070684_100004420 3300005535 Bacteria 10697
35 Ga0070684_100028439 3300005535 Bacteria 4729
36 Ga0068853_100026109 3300005539 Bacteria 4904
37 Ga0070672_100000031 3300005543 Bacteria 62241
38 Ga0070693_100000422 3300005547 Bacteria 19196
39 Ga0070665_100006702 3300005548 Bacteria 11707
40 Ga0070665_100329173 3300005548 Bacteria 1532
41 Ga0068857_100118832 3300005577 Bacteria 2379
42 Ga0068854_100000082 3300005578 Bacteria 68340
43 Ga0068856_100000417 3300005614 Bacteria 46946
44 Ga0068856_100055114 3300005614 Bacteria 3924
45 Ga0070702_101039793 3300005615 Unclassified 651
46 Ga0068852_100000966 3300005616 Bacteria 18875
47 Ga0068852_100198403 3300005616 Bacteria 1898
48 Ga0068864_100000043 3300005618 Bacteria 162928
49 Ga0068866_10000296 3300005718 Bacteria 23705
50 Ga0068861_100106735 3300005719 Bacteria 2238
51 Ga0068861_100664634 3300005719 Bacteria 964
52 Ga0068851_10000141 3300005834 Bacteria 38800
53 Ga0068851_10007310 3300005834 Bacteria 5066
54 Ga0068863_100007352 3300005841 Bacteria 10782
55 Ga0068863_101234594 3300005841 Bacteria 754
56 Ga0068858_100000046 3300005842 Bacteria 127519
57 Ga0081540_1000868 3300005983 Bacteria 27372
58 Ga0070715_10000008 3300006163 Bacteria 189899
59 Ga0070716_101303468 3300006173 Unclassified 587
60 Ga0070712_100032187 3300006175 Bacteria 3539
61 Ga0068871_100412296 3300006358 Bacteria 1205
62 Ga0075431_100037539 3300006847 Bacteria 4990
63 Ga0075433_10000592 3300006852 Bacteria 24054
64 Ga0068865_100000499 3300006881 Bacteria 22000
65 Ga0068865_100826585 3300006881 Unclassified 801
66 Ga0105240_10482906 3300009093 Bacteria 1381
67 Ga0111539_11008356 3300009094 Bacteria 968
68 Ga0111539_11830668 3300009094 Bacteria 704
69 Ga0105245_10000314 3300009098 Bacteria 46175
70 Ga0105245_10021024 3300009098 Bacteria 5724
71 Ga0105247_10000131 3300009101 Bacteria 72578
72 Ga0105247_10402616 3300009101 Bacteria 976
73 Ga0114129_10893167 3300009147 Bacteria 1126
74 Ga0105243_10062405 3300009148 Bacteria 2983
75 Ga0105243_10651085 3300009148 Bacteria 1021
76 Ga0105242_10000063 3300009176 Bacteria 74721
77 Ga0105242_11156714 3300009176 Bacteria 791
78 Ga0105248_10000037 3300009177 Bacteria 180751
79 Ga0105249_10547428 3300009553 Bacteria 1207
80 Ga0105249_10925752 3300009553 Bacteria 939
81 Ga0105239_10910713 3300010375 Bacteria 1009
82 Ga0157373_10752893 3300013100 Bacteria 716
83 Ga0157371_10027844 3300013102 Bacteria 4095
84 Ga0157370_10012447 3300013104 Bacteria 8821
85 Ga0157370_10993698 3300013104 Bacteria 760
86 Ga0157369_10001730 3300013105 Bacteria 26528
87 Ga0157374_10639148 3300013296 Bacteria 1075
88 Ga0157378_10015261 3300013297 Bacteria 6727
89 Ga0157378_10019758 3300013297 Bacteria 5924
90 Ga0157378_10434655 3300013297 Bacteria 1300
91 Ga0163162_10392787 3300013306 Bacteria 1520
92 Ga0157372_10001749 3300013307 Bacteria 23545
93 Ga0157375_10000365 3300013308 Bacteria 41388
94 Ga0157375_10003564 3300013308 Bacteria 13514
95 Ga0157377_10154410 3300014745 Bacteria 1422
96 Ga0163161_10029785 3300017792 Bacteria 3880
97 Ga0206354_11074552 3300020081 Bacteria 1260
98 Ga0224712_10385444 3300022467 Unclassified 666
99 Ga0207656_10051285 3300025321 Bacteria 1784
100 Ga0207656_10057629 3300025321 Bacteria 1695
101 Ga0207692_10209351 3300025898 Bacteria 1151
102 Ga0207642_10000173 3300025899 Bacteria 18494
103 Ga0207710_10000384 3300025900 Bacteria 30192
104 Ga0207710_10295533 3300025900 Bacteria 817
105 Ga0207680_10010092 3300025903 Bacteria 4712
106 Ga0207685_10000012 3300025905 Bacteria 189900
107 Ga0207695_10318638 3300025913 Bacteria 1444
108 Ga0207693_10001350 3300025915 Bacteria 21696
109 Ga0207663_10277571 3300025916 Bacteria 1243
110 Ga0207649_10000003 3300025920 Bacteria 388908
111 Ga0207652_10004947 3300025921 Bacteria 10790
112 Ga0207650_10020601 3300025925 Bacteria 4652
113 Ga0207659_10000055 3300025926 Bacteria 74252
114 Ga0207687_10000040 3300025927 Bacteria 113598
115 Ga0207687_10011779 3300025927 Bacteria 5721
116 Ga0207700_10000003 3300025928 Bacteria 500797
117 Ga0207700_10179080 3300025928 Bacteria 1774
118 Ga0207664_11107331 3300025929 Bacteria 708
119 Ga0207690_10021716 3300025932 Bacteria 3984
120 Ga0207686_10000230 3300025934 Bacteria 42566
121 Ga0207686_10000517 3300025934 Bacteria 24947
122 Ga0207686_10112680 3300025934 Bacteria 1838
123 Ga0207686_10334321 3300025934 Bacteria 1136
124 Ga0207709_10031823 3300025935 Bacteria 3084
125 Ga0207709_10726987 3300025935 Bacteria 796
126 Ga0207704_10000018 3300025938 Bacteria 153994
127 Ga0207704_10940183 3300025938 Unclassified 729
128 Ga0207665_10255774 3300025939 Bacteria 1296
129 Ga0207691_10000178 3300025940 Bacteria 60110
130 Ga0207711_10000011 3300025941 Bacteria 518817
131 Ga0207689_10132822 3300025942 Bacteria 2049
132 Ga0207661_10000858 3300025944 Bacteria 19953
133 Ga0207661_10001136 3300025944 Bacteria 17743
134 Ga0207661_10136746 3300025944 Bacteria 2105
135 Ga0207661_10158670 3300025944 Bacteria 1961
136 Ga0207679_10045829 3300025945 Bacteria 3165
137 Ga0207712_10940711 3300025961 Bacteria 765
138 Ga0207640_10000054 3300025981 Bacteria 95136
139 Ga0207658_10009339 3300025986 Bacteria 6653
140 Ga0207677_10001225 3300026023 Bacteria 13820
141 Ga0207703_10000042 3300026035 Bacteria 161459
142 Ga0207639_10110851 3300026041 Bacteria 2236
143 Ga0207678_10005910 3300026067 Bacteria 10904
144 Ga0207708_10742550 3300026075 Unclassified 842
145 Ga0207702_10000105 3300026078 Bacteria 97835
146 Ga0207702_10022827 3300026078 Bacteria 5190
147 Ga0207641_10005248 3300026088 Bacteria 11075
148 Ga0207676_10000042 3300026095 Bacteria 163475
149 Ga0207674_10084683 3300026116 Bacteria 3168
150 Ga0207675_100050390 3300026118 Bacteria 3885
151 Ga0207683_10011240 3300026121 Bacteria 7632
152 Ga0207698_10000015 3300026142 Bacteria 207368
153 Ga0207698_10013832 3300026142 Bacteria 5342
154 Ga0268266_10000526 3300028379 Bacteria 53404
155 Ga0268266_10372993 3300028379 Bacteria 1344
156 Ga0265319_1000010 3300028563 Bacteria 188773
157 Ga0265336_10098925 3300028666 Bacteria 869
158 Ga0265338_10000287 3300028800 Bacteria 90818
159 Ga0265324_10066439 3300029957 Bacteria 1230
160 Ga0307511_10186981 3300030521 Bacteria 1103
161 Ga0265325_10004849 3300031241 Bacteria 8410
162 Ga0265327_10100801 3300031251 Bacteria 1394
163 Ga0265313_10047571 3300031595 Bacteria 2075
164 Ga0307415_100022166 3300032126 Bacteria 3916
165 Ga0316583_10180128 3300032133 Bacteria 735
166 Ga0373956_0135683 3300035119 Bacteria 1154
167 Ga0373957_0301914 3300035120 Unclassified 679
168 Ga0373955_0161312 3300035172 Bacteria 1323
169 Ga0373937_0019902 3300036401 Bacteria 6012
170 Ga0373937_0321596 3300036401 Bacteria 1464
171 Ga0451800_1002997 3300041459 Bacteria 1289
172 Ga0451807_2420247 3300041486 Bacteria 535
173 Ga0451839_1609670 3300041496 Bacteria 683
174 Ga0451845_0039832 3300041501 Bacteria 529
175 Ga0451853_0080552 3300041512 Bacteria 768
176 Ga0451853_2817954 3300041512 Bacteria 691
177 Ga0466963_0000141 3300044694 Bacteria 28151
178 Ga0466963_0020529 3300044694 Bacteria 4154
179 Ga0466957_0309889 3300044842 Bacteria 1063
180 Ga0466958_0061914 3300045836 Bacteria 2280
181 Ga0466967_0000002 3300045976 Bacteria 219994
182 Ga0495592_0133487 3300046454 Bacteria 1734
183 Ga0495592_0139418 3300046454 Bacteria 1688
184 Ga0495629_0001042 3300046459 Bacteria 22205
185 Ga0495629_0016047 3300046459 Bacteria 5382
186 Ga0495629_0354071 3300046459 Bacteria 1001
187 Ga0495641_0013717 3300046461 Bacteria 4431
188 Ga0495651_0678368 3300046462 Bacteria 644
189 Ga0495653_0101341 3300046463 Bacteria 2086
190 Ga0495653_0120254 3300046463 Bacteria 1873
191 Ga0495662_0011321 3300046476 Bacteria 4359
192 Ga0495662_0094510 3300046476 Bacteria 1460
193 Ga0495664_0552811 3300046477 Bacteria 686
194 Ga0495594_0000009 3300046499 Bacteria 122139
195 Ga0495606_0000017 3300046507 Bacteria 284549
196 Ga0495608_0000013 3300046511 Bacteria 228481
197 Ga0495608_0097387 3300046511 Bacteria 1899
198 Ga0495618_0144960 3300046514 Bacteria 1518
199 Ga0495628_0004134 3300046516 Bacteria 12910
200 Ga0495630_0000032 3300046517 Bacteria 134425
201 Ga0495630_0415956 3300046517 Bacteria 1030
202 Ga0495637_0048223 3300046520 Bacteria 1795
203 Ga0495643_0205895 3300046522 Bacteria 942
204 Ga0495587_0001456 3300046536 Bacteria 15786
205 Ga0495621_0023944 3300046539 Bacteria 2034
206 Ga0495622_0001307 3300046557 Bacteria 12771
207 Ga0495667_0049109 3300046559 Bacteria 2785
208 Ga0495656_0000466 3300046615 Bacteria 13187
209 Ga0495634_0000002 3300046642 Bacteria 247842
210 Ga0495634_0672425 3300046642 Bacteria 597
211 Ga0495588_0000073 3300046674 Bacteria 219005
212 Ga0495657_0000003 3300046675 Bacteria 279680
213 Ga0495647_0006720 3300046681 Bacteria 3827
214 Ga0495613_0000233 3300046689 Bacteria 53074
215 Ga0495613_0024473 3300046689 Bacteria 4499
216 Ga0495613_0078210 3300046689 Bacteria 2407
217 Ga0495624_0000400 3300046690 Bacteria 34373
218 Ga0495624_0382887 3300046690 Bacteria 845
219 Ga0495600_0093525 3300046809 Bacteria 1960
220 Ga0495660_0366160 3300046810 Bacteria 638
221 Ga0495604_0006007 3300047317 Bacteria 9641
222 Ga0495604_0037979 3300047317 Bacteria 3789
223 Ga0495672_0103516 3300047320 Bacteria 1540
224 Ga0495676_0005983 3300047321 Bacteria 11177
225 Ga0495676_0072204 3300047321 Bacteria 2651
226 Ga0495676_0244426 3300047321 Bacteria 1227
227 Ga0495675_0000002 3300047444 Bacteria 216469
228 Ga0495602_0000034 3300048088 Bacteria 140722
229 Ga0495602_0004130 3300048088 Bacteria 15127
230 Ga0495602_0722498 3300048088 Bacteria 674
231 Ga0495614_0101496 3300048089 Bacteria 1258
232 Ga0496100_0000001 3300048903 Bacteria 530179
233 Ga0496100_0000024 3300048903 Bacteria 116138
234 Ga0496101_0000028 3300048904 Bacteria 198664
235 Ga0496101_0000072 3300048904 Bacteria 116138
236 Ga0496102_0000129 3300048905 Bacteria 104478
237 Ga0496102_0605411 3300048905 Bacteria 1019
238 Ga0496102_1759222 3300048905 Bacteria 537
239 Ga0496103_0000087 3300048906 Bacteria 104566
240 Ga0496104_0000010 3300048907 Bacteria 475255
241 Ga0496104_0000230 3300048907 Bacteria 49225
242 Ga0496104_0072271 3300048907 Bacteria 3280
243 Ga0496104_1297892 3300048907 Bacteria 631
244 Ga0496105_0000005 3300048908 Bacteria 475797
245 Ga0496105_0000051 3300048908 Bacteria 90365
246 Ga0496105_0031461 3300048908 Bacteria 4350
247 Ga0496106_0000040 3300048909 Bacteria 108754
248 Ga0496106_0000042 3300048909 Bacteria 106662
249 Ga0496106_0000134 3300048909 Bacteria 55531
250 Ga0496107_0000002 3300048910 Bacteria 320871
251 Ga0496107_0000025 3300048910 Bacteria 116138
252 Ga0496107_0187513 3300048910 Bacteria 1536
253 Ga0496108_0000005 3300048911 Bacteria 535059
254 Ga0496108_0000537 3300048911 Bacteria 29610
255 Ga0496108_0051894 3300048911 Bacteria 3435
256 Ga0496109_0000002 3300048912 Bacteria 443393
257 Ga0496109_0000221 3300048912 Bacteria 56054
258 Ga0496109_0003599 3300048912 Bacteria 12942
259 Ga0496109_0251895 3300048912 Bacteria 1663
260 Ga0496110_0000052 3300048913 Bacteria 58549
261 Ga0496110_0020706 3300048913 Bacteria 5555
262 Ga0496110_0093951 3300048913 Bacteria 2685
263 Ga0496111_0000209 3300048914 Bacteria 27572
264 Ga0496111_0074371 3300048914 Bacteria 2475
265 Ga0496112_0001298 3300048915 Bacteria 18986
266 Ga0496113_0000065 3300048916 Bacteria 45403
267 Ga0496114_0143902 3300048917 Bacteria 2066
268 Ga0496118_0351847 3300048921 Bacteria 785
269 Ga0496119_0024814 3300048922 Bacteria 4205
270 Ga0496120_0211872 3300048923 Bacteria 931
271 Ga0496124_0757707 3300048927 Bacteria 607
272 Ga0501042_0089912 3300049578 Bacteria 2203
273 Ga0501047_0743913 3300049581 Bacteria 797
274 Ga0501070_0133810 3300049586 Bacteria 2047
275 Ga0501070_0261650 3300049586 Bacteria 1414
276 Ga0501075_1040459 3300049591 Unclassified 622
277 Ga0501076_0148711 3300049592 Bacteria 1905
278 Ga0501077_0660512 3300049593 Bacteria 672
279 Ga0501079_0248939 3300049741 Bacteria 1389
280 nmdc:mga05p37_533763_c1 3300050507 Bacteria 1339
281 nmdc:mga06r32_50233_c1 3300050510 Bacteria 3989
282 nmdc:mga08x19_558559_c1 3300050514 Bacteria 810
283 nmdc:mga08x19_744256_c1 3300050514 Bacteria 696
284 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
285 Ga0495601_0000029 3300053077 Bacteria 111437
286 Ga0495601_0005883 3300053077 Bacteria 7151
287 Ga0495601_0668285 3300053077 Unclassified 664
288 Ga0495612_0004941 3300053078 Bacteria 5517
289 Ga0495655_0000010 3300053083 Bacteria 125615
290 Ga0495655_0190993 3300053083 Bacteria 665
291 Ga0495595_0000007 3300053084 Bacteria 228504
292 Ga0495595_0006885 3300053084 Bacteria 4640
293 Ga0495619_0000001 3300053085 Bacteria 586054
294 Ga0495619_0000026 3300053085 Bacteria 167387
295 Ga0495619_0000088 3300053085 Bacteria 69615
296 Ga0495619_0000506 3300053085 Bacteria 25971
297 Ga0495619_0000682 3300053085 Bacteria 22203
298 Ga0500628_000072 3300053129 Bacteria 26251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0001456 Ga0495587_0001456_6060_6521 127
2 3300005719 Ga0068861_100106735 Ga0068861_1001067353 129
3 3300026118 Ga0207675_100050390 Ga0207675_1000503902 129
4 3300006881 Ga0068865_100826585 Ga0068865_1008265852 130
5 3300025938 Ga0207704_10940183 Ga0207704_109401831 130
6 3300048905 Ga0496102_0000129 Ga0496102_0000129_96508_96972 130
7 3300048906 Ga0496103_0000087 Ga0496103_0000087_96506_96970 130
8 3300048908 Ga0496105_0031461 Ga0496105_0031461_814_1275 131
9 3300009176 Ga0105242_10000063 Ga0105242_1000006327 132
10 3300025927 Ga0207687_10000040 Ga0207687_1000004015 132
11 3300025934 Ga0207686_10000230 Ga0207686_1000023027 132
12 3300046459 Ga0495629_0016047 Ga0495629_0016047_3791_4255 132
13 3300005329 Ga0070683_100645921 Ga0070683_1006459212 133
14 3300005455 Ga0070663_100003185 Ga0070663_1000031855 133
15 3300005530 Ga0070679_100006435 Ga0070679_1000064355 133
16 3300025921 Ga0207652_10004947 Ga0207652_100049474 133
17 3300025944 Ga0207661_10136746 Ga0207661_101367462 133
18 3300026067 Ga0207678_10005910 Ga0207678_100059105 133
19 3300044842 Ga0466957_0309889 Ga0466957_0309889_110_574 135
20 3300005365 Ga0070688_100000161 Ga0070688_10000016125 136
21 3300005466 Ga0070685_10000061 Ga0070685_1000006154 136
22 3300009098 Ga0105245_10000314 Ga0105245_1000031415 136
23 3300046689 Ga0495613_0078210 Ga0495613_0078210_1092_1556 136
24 3300049592 Ga0501076_0148711 Ga0501076_0148711_246_710 137
25 3300005435 Ga0070714_101185775 Ga0070714_1011857752 138
26 3300005614 Ga0068856_100055114 Ga0068856_1000551142 139
27 3300005616 Ga0068852_100000966 Ga0068852_10000096622 139
28 3300009177 Ga0105248_10000037 Ga0105248_10000037178 139
29 3300013105 Ga0157369_10001730 Ga0157369_100017302 139
30 3300025934 Ga0207686_10334321 Ga0207686_103343212 139
31 3300025941 Ga0207711_10000011 Ga0207711_10000011365 139
32 3300026078 Ga0207702_10022827 Ga0207702_100228275 139
33 3300026142 Ga0207698_10000015 Ga0207698_10000015123 139
34 3300046642 Ga0495634_0672425 Ga0495634_0672425_11_430 139
35 3300005615 Ga0070702_101039793 Ga0070702_1010397931 140
36 3300041459 Ga0451800_1002997 Ga0451800_1002997_106_570 140
37 3300041486 Ga0451807_2420247 Ga0451807_2420247_27_491 140
38 3300041512 Ga0451853_0080552 Ga0451853_0080552_47_511 140
39 3300005436 Ga0070713_100097029 Ga0070713_1000970293 145
40 3300005439 Ga0070711_100428119 Ga0070711_1004281192 145
41 3300025916 Ga0207663_10277571 Ga0207663_102775712 145
42 3300025928 Ga0207700_10179080 Ga0207700_101790802 145
43 3300032126 Ga0307415_100022166 Ga0307415_1000221662 146
44 3300045976 Ga0466967_0000002 Ga0466967_0000002_9915_10355 146
45 3300046463 Ga0495653_0101341 Ga0495653_0101341_1627_2067 146
46 3300003659 JGI25404J52841_10049051 JGI25404J52841_100490512 147
47 3300005329 Ga0070683_100005586 Ga0070683_1000055868 147
48 3300005329 Ga0070683_100012615 Ga0070683_1000126154 147
49 3300005337 Ga0070682_100000026 Ga0070682_100000026193 147
50 3300005338 Ga0068868_100001800 Ga0068868_1000018008 147
51 3300005344 Ga0070661_100000004 Ga0070661_100000004255 147
52 3300005354 Ga0070675_100000050 Ga0070675_10000005058 147
53 3300005365 Ga0070688_100000077 Ga0070688_10000007751 147
54 3300005365 Ga0070688_100035508 Ga0070688_1000355082 147
55 3300005367 Ga0070667_100527408 Ga0070667_1005274082 147
56 3300005436 Ga0070713_100006777 Ga0070713_1000067772 147
57 3300005438 Ga0070701_10220442 Ga0070701_102204422 147
58 3300005439 Ga0070711_100012790 Ga0070711_1000127905 147
59 3300005456 Ga0070678_100014248 Ga0070678_1000142484 147
60 3300005466 Ga0070685_10000010 Ga0070685_10000010136 147
61 3300005535 Ga0070684_100004420 Ga0070684_1000044204 147
62 3300005535 Ga0070684_100028439 Ga0070684_1000284394 147
63 3300005543 Ga0070672_100000031 Ga0070672_10000003183 147
64 3300005548 Ga0070665_100006702 Ga0070665_1000067028 147
65 3300005548 Ga0070665_100329173 Ga0070665_1003291732 147
66 3300005577 Ga0068857_100118832 Ga0068857_1001188322 147
67 3300005578 Ga0068854_100000082 Ga0068854_10000008235 147
68 3300005616 Ga0068852_100198403 Ga0068852_1001984032 147
69 3300005834 Ga0068851_10000141 Ga0068851_1000014124 147
70 3300005834 Ga0068851_10007310 Ga0068851_100073103 147
71 3300005983 Ga0081540_1000868 Ga0081540_100086814 147
72 3300006175 Ga0070712_100032187 Ga0070712_1000321873 147
73 3300006881 Ga0068865_100000499 Ga0068865_1000004999 147
74 3300025321 Ga0207656_10051285 Ga0207656_100512852 147
75 3300025321 Ga0207656_10057629 Ga0207656_100576292 147
76 3300025900 Ga0207710_10295533 Ga0207710_102955332 147
77 3300025903 Ga0207680_10010092 Ga0207680_100100922 147
78 3300025915 Ga0207693_10001350 Ga0207693_100013507 147
79 3300025920 Ga0207649_10000003 Ga0207649_100000034 147
80 3300025926 Ga0207659_10000055 Ga0207659_1000005560 147
81 3300025927 Ga0207687_10011779 Ga0207687_100117792 147
82 3300025929 Ga0207664_11107331 Ga0207664_111073311 147
83 3300025934 Ga0207686_10000517 Ga0207686_100005176 147
84 3300025935 Ga0207709_10031823 Ga0207709_100318232 147
85 3300025938 Ga0207704_10000018 Ga0207704_10000018166 147
86 3300025940 Ga0207691_10000178 Ga0207691_100001782 147
87 3300025944 Ga0207661_10000858 Ga0207661_100008587 147
88 3300025944 Ga0207661_10001136 Ga0207661_100011364 147
89 3300025961 Ga0207712_10940711 Ga0207712_109407112 147
90 3300025981 Ga0207640_10000054 Ga0207640_1000005410 147
91 3300026023 Ga0207677_10001225 Ga0207677_1000122511 147
92 3300026116 Ga0207674_10084683 Ga0207674_100846833 147
93 3300026121 Ga0207683_10011240 Ga0207683_100112404 147
94 3300026142 Ga0207698_10013832 Ga0207698_100138322 147
95 3300028379 Ga0268266_10000526 Ga0268266_1000052656 147
96 3300028379 Ga0268266_10372993 Ga0268266_103729932 147
97 3300041501 Ga0451845_0039832 Ga0451845_0039832_20_463 147
98 3300046516 Ga0495628_0004134 Ga0495628_0004134_3939_4382 147
99 3300048921 Ga0496118_0351847 Ga0496118_0351847_10_453 147
100 3300047317 Ga0495604_0006007 Ga0495604_0006007_6484_6948 148
101 3300005618 Ga0068864_100000043 Ga0068864_100000043165 152
102 3300005718 Ga0068866_10000296 Ga0068866_1000029619 152
103 3300005842 Ga0068858_100000046 Ga0068858_10000004652 152
104 3300009148 Ga0105243_10651085 Ga0105243_106510852 152
105 3300009176 Ga0105242_11156714 Ga0105242_111567142 152
106 3300013104 Ga0157370_10012447 Ga0157370_100124472 152
107 3300013308 Ga0157375_10000365 Ga0157375_1000036512 152
108 3300025899 Ga0207642_10000173 Ga0207642_100001737 152
109 3300025934 Ga0207686_10112680 Ga0207686_101126802 152
110 3300025935 Ga0207709_10726987 Ga0207709_107269872 152
111 3300026035 Ga0207703_10000042 Ga0207703_1000004217 152
112 3300026095 Ga0207676_10000042 Ga0207676_100000426 152
113 3300046642 Ga0495634_0000002 Ga0495634_0000002_103988_104446 152
114 3300005334 Ga0068869_100114324 Ga0068869_1001143243 153
115 3300005547 Ga0070693_100000422 Ga0070693_1000004229 153
116 3300005841 Ga0068863_101234594 Ga0068863_1012345942 153
117 3300006163 Ga0070715_10000008 Ga0070715_1000000863 153
118 3300006173 Ga0070716_101303468 Ga0070716_1013034681 153
119 3300006358 Ga0068871_100412296 Ga0068871_1004122962 153
120 3300006852 Ga0075433_10000592 Ga0075433_1000059213 153
121 3300025905 Ga0207685_10000012 Ga0207685_1000001263 153
122 3300025939 Ga0207665_10255774 Ga0207665_102557742 153
123 3300025942 Ga0207689_10132822 Ga0207689_101328222 153
124 3300026075 Ga0207708_10742550 Ga0207708_107425501 153
125 3300030521 Ga0307511_10186981 Ga0307511_101869811 153
126 3300046454 Ga0495592_0133487 Ga0495592_0133487_49_510 153
127 3300046459 Ga0495629_0354071 Ga0495629_0354071_263_724 153
128 3300046462 Ga0495651_0678368 Ga0495651_0678368_72_533 153
129 3300046463 Ga0495653_0120254 Ga0495653_0120254_503_964 153
130 3300046476 Ga0495662_0094510 Ga0495662_0094510_648_1109 153
131 3300046511 Ga0495608_0097387 Ga0495608_0097387_189_650 153
132 3300046514 Ga0495618_0144960 Ga0495618_0144960_160_621 153
133 3300046517 Ga0495630_0415956 Ga0495630_0415956_408_869 153
134 3300046539 Ga0495621_0023944 Ga0495621_0023944_477_938 153
135 3300046557 Ga0495622_0001307 Ga0495622_0001307_2892_3353 153
136 3300046559 Ga0495667_0049109 Ga0495667_0049109_2104_2565 153
137 3300046615 Ga0495656_0000466 Ga0495656_0000466_5143_5604 153
138 3300046689 Ga0495613_0024473 Ga0495613_0024473_255_716 153
139 3300047321 Ga0495676_0072204 Ga0495676_0072204_1292_1753 153
140 3300048089 Ga0495614_0101496 Ga0495614_0101496_243_704 153
141 3300048907 Ga0496104_0000230 Ga0496104_0000230_32345_32806 153
142 3300048907 Ga0496104_1297892 Ga0496104_1297892_53_514 153
143 3300048908 Ga0496105_0000051 Ga0496105_0000051_43478_43939 153
144 3300048909 Ga0496106_0000042 Ga0496106_0000042_78455_78916 153
145 3300048910 Ga0496107_0187513 Ga0496107_0187513_751_1212 153
146 3300048911 Ga0496108_0000537 Ga0496108_0000537_4057_4518 153
147 3300048912 Ga0496109_0003599 Ga0496109_0003599_8447_8908 153
148 3300048912 Ga0496109_0251895 Ga0496109_0251895_416_877 153
149 3300049586 Ga0501070_0261650 Ga0501070_0261650_319_780 153
150 3300049591 Ga0501075_1040459 Ga0501075_1040459_144_605 153
151 3300049593 Ga0501077_0660512 Ga0501077_0660512_192_653 153
152 3300049741 Ga0501079_0248939 Ga0501079_0248939_575_1036 153
153 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_106874_107335 153
154 3300053077 Ga0495601_0005883 Ga0495601_0005883_5787_6248 153
155 3300053085 Ga0495619_0000001 Ga0495619_0000001_421944_422405 153
156 3300053085 Ga0495619_0000506 Ga0495619_0000506_10381_10842 153
157 3300053085 Ga0495619_0000682 Ga0495619_0000682_11414_11875 153
158 3300001979 JGI24740J21852_10031842 JGI24740J21852_100318422 154
159 3300005329 Ga0070683_100147213 Ga0070683_1001472132 154
160 3300005337 Ga0070682_100157754 Ga0070682_1001577542 154
161 3300005341 Ga0070691_10000004 Ga0070691_1000000442 154
162 3300005344 Ga0070661_101532546 Ga0070661_1015325461 154
163 3300005366 Ga0070659_100023857 Ga0070659_1000238572 154
164 3300005367 Ga0070667_100013639 Ga0070667_1000136394 154
165 3300005435 Ga0070714_100117097 Ga0070714_1001170973 154
166 3300005437 Ga0070710_10432914 Ga0070710_104329141 154
167 3300005539 Ga0068853_100026109 Ga0068853_1000261092 154
168 3300005614 Ga0068856_100000417 Ga0068856_10000041730 154
169 3300005719 Ga0068861_100664634 Ga0068861_1006646342 154
170 3300005841 Ga0068863_100007352 Ga0068863_10000735212 154
171 3300006847 Ga0075431_100037539 Ga0075431_1000375394 154
172 3300009093 Ga0105240_10482906 Ga0105240_104829062 154
173 3300009094 Ga0111539_11008356 Ga0111539_110083562 154
174 3300009094 Ga0111539_11830668 Ga0111539_118306681 154
175 3300009098 Ga0105245_10021024 Ga0105245_100210247 154
176 3300009101 Ga0105247_10000131 Ga0105247_1000013123 154
177 3300009101 Ga0105247_10402616 Ga0105247_104026162 154
178 3300009147 Ga0114129_10893167 Ga0114129_108931672 154
179 3300009148 Ga0105243_10062405 Ga0105243_100624053 154
180 3300009553 Ga0105249_10547428 Ga0105249_105474282 154
181 3300009553 Ga0105249_10925752 Ga0105249_109257522 154
182 3300010375 Ga0105239_10910713 Ga0105239_109107131 154
183 3300013100 Ga0157373_10752893 Ga0157373_107528931 154
184 3300013102 Ga0157371_10027844 Ga0157371_100278445 154
185 3300013104 Ga0157370_10993698 Ga0157370_109936981 154
186 3300013296 Ga0157374_10639148 Ga0157374_106391481 154
187 3300013297 Ga0157378_10015261 Ga0157378_100152614 154
188 3300013297 Ga0157378_10019758 Ga0157378_100197584 154
189 3300013297 Ga0157378_10434655 Ga0157378_104346552 154
190 3300013306 Ga0163162_10392787 Ga0163162_103927872 154
191 3300013307 Ga0157372_10001749 Ga0157372_1000174911 154
192 3300013308 Ga0157375_10003564 Ga0157375_1000356411 154
193 3300014745 Ga0157377_10154410 Ga0157377_101544102 154
194 3300017792 Ga0163161_10029785 Ga0163161_100297853 154
195 3300020081 Ga0206354_11074552 Ga0206354_110745522 154
196 3300022467 Ga0224712_10385444 Ga0224712_103854441 154
197 3300025898 Ga0207692_10209351 Ga0207692_102093512 154
198 3300025900 Ga0207710_10000384 Ga0207710_100003848 154
199 3300025913 Ga0207695_10318638 Ga0207695_103186382 154
200 3300025925 Ga0207650_10020601 Ga0207650_100206012 154
201 3300025928 Ga0207700_10000003 Ga0207700_10000003156 154
202 3300025932 Ga0207690_10021716 Ga0207690_100217162 154
203 3300025944 Ga0207661_10158670 Ga0207661_101586702 154
204 3300025945 Ga0207679_10045829 Ga0207679_100458292 154
205 3300025986 Ga0207658_10009339 Ga0207658_100093394 154
206 3300026041 Ga0207639_10110851 Ga0207639_101108512 154
207 3300026078 Ga0207702_10000105 Ga0207702_1000010571 154
208 3300026088 Ga0207641_10005248 Ga0207641_100052487 154
209 3300028563 Ga0265319_1000010 Ga0265319_100001069 154
210 3300028666 Ga0265336_10098925 Ga0265336_100989252 154
211 3300028800 Ga0265338_10000287 Ga0265338_1000028740 154
212 3300029957 Ga0265324_10066439 Ga0265324_100664392 154
213 3300031241 Ga0265325_10004849 Ga0265325_100048494 154
214 3300031251 Ga0265327_10100801 Ga0265327_101008012 154
215 3300031595 Ga0265313_10047571 Ga0265313_100475712 154
216 3300032133 Ga0316583_10180128 Ga0316583_101801282 154
217 3300035119 Ga0373956_0135683 Ga0373956_0135683_615_1079 154
218 3300035120 Ga0373957_0301914 Ga0373957_0301914_161_625 154
219 3300035172 Ga0373955_0161312 Ga0373955_0161312_74_538 154
220 3300036401 Ga0373937_0019902 Ga0373937_0019902_375_839 154
221 3300036401 Ga0373937_0321596 Ga0373937_0321596_917_1381 154
222 3300041496 Ga0451839_1609670 Ga0451839_1609670_99_563 154
223 3300041512 Ga0451853_2817954 Ga0451853_2817954_94_558 154
224 3300044694 Ga0466963_0000141 Ga0466963_0000141_9104_9568 154
225 3300044694 Ga0466963_0020529 Ga0466963_0020529_1395_1862 154
226 3300045836 Ga0466958_0061914 Ga0466958_0061914_1499_1963 154
227 3300046454 Ga0495592_0139418 Ga0495592_0139418_1075_1542 154
228 3300046459 Ga0495629_0001042 Ga0495629_0001042_9032_9499 154
229 3300046461 Ga0495641_0013717 Ga0495641_0013717_3783_4250 154
230 3300046476 Ga0495662_0011321 Ga0495662_0011321_2935_3408 154
231 3300046477 Ga0495664_0552811 Ga0495664_0552811_46_513 154
232 3300046499 Ga0495594_0000009 Ga0495594_0000009_15717_16181 154
233 3300046507 Ga0495606_0000017 Ga0495606_0000017_37218_37685 154
234 3300046511 Ga0495608_0000013 Ga0495608_0000013_112857_113321 154
235 3300046517 Ga0495630_0000032 Ga0495630_0000032_55400_55867 154
236 3300046520 Ga0495637_0048223 Ga0495637_0048223_1243_1710 154
237 3300046522 Ga0495643_0205895 Ga0495643_0205895_378_845 154
238 3300046674 Ga0495588_0000073 Ga0495588_0000073_194792_195259 154
239 3300046675 Ga0495657_0000003 Ga0495657_0000003_164056_164520 154
240 3300046681 Ga0495647_0006720 Ga0495647_0006720_1656_2123 154
241 3300046689 Ga0495613_0000233 Ga0495613_0000233_43303_43767 154
242 3300046690 Ga0495624_0000400 Ga0495624_0000400_23957_24424 154
243 3300046690 Ga0495624_0382887 Ga0495624_0382887_44_511 154
244 3300046809 Ga0495600_0093525 Ga0495600_0093525_1260_1724 154
245 3300046810 Ga0495660_0366160 Ga0495660_0366160_94_561 154
246 3300047317 Ga0495604_0037979 Ga0495604_0037979_2605_3069 154
247 3300047320 Ga0495672_0103516 Ga0495672_0103516_161_625 154
248 3300047321 Ga0495676_0005983 Ga0495676_0005983_381_845 154
249 3300047321 Ga0495676_0244426 Ga0495676_0244426_349_816 154
250 3300047444 Ga0495675_0000002 Ga0495675_0000002_164056_164520 154
251 3300048088 Ga0495602_0000034 Ga0495602_0000034_60524_60988 154
252 3300048088 Ga0495602_0004130 Ga0495602_0004130_9573_10037 154
253 3300048088 Ga0495602_0722498 Ga0495602_0722498_44_511 154
254 3300048903 Ga0496100_0000001 Ga0496100_0000001_60984_61448 154
255 3300048903 Ga0496100_0000024 Ga0496100_0000024_102480_102944 154
256 3300048904 Ga0496101_0000028 Ga0496101_0000028_60973_61437 154
257 3300048904 Ga0496101_0000072 Ga0496101_0000072_13195_13659 154
258 3300048905 Ga0496102_0605411 Ga0496102_0605411_244_708 154
259 3300048905 Ga0496102_1759222 Ga0496102_1759222_23_490 154
260 3300048907 Ga0496104_0000010 Ga0496104_0000010_236865_237329 154
261 3300048907 Ga0496104_0072271 Ga0496104_0072271_1654_2121 154
262 3300048908 Ga0496105_0000005 Ga0496105_0000005_236865_237329 154
263 3300048909 Ga0496106_0000040 Ga0496106_0000040_95096_95560 154
264 3300048909 Ga0496106_0000134 Ga0496106_0000134_5625_6089 154
265 3300048910 Ga0496107_0000002 Ga0496107_0000002_187040_187504 154
266 3300048910 Ga0496107_0000025 Ga0496107_0000025_102480_102944 154
267 3300048911 Ga0496108_0000005 Ga0496108_0000005_451864_452331 154
268 3300048911 Ga0496108_0051894 Ga0496108_0051894_2611_3078 154
269 3300048912 Ga0496109_0000002 Ga0496109_0000002_82761_83228 154
270 3300048912 Ga0496109_0000221 Ga0496109_0000221_27974_28441 154
271 3300048913 Ga0496110_0000052 Ga0496110_0000052_39530_39997 154
272 3300048913 Ga0496110_0020706 Ga0496110_0020706_567_1034 154
273 3300048913 Ga0496110_0093951 Ga0496110_0093951_1761_2231 154
274 3300048914 Ga0496111_0000209 Ga0496111_0000209_15551_16018 154
275 3300048914 Ga0496111_0074371 Ga0496111_0074371_1879_2346 154
276 3300048915 Ga0496112_0001298 Ga0496112_0001298_4867_5334 154
277 3300048916 Ga0496113_0000065 Ga0496113_0000065_42119_42586 154
278 3300048917 Ga0496114_0143902 Ga0496114_0143902_1032_1499 154
279 3300048922 Ga0496119_0024814 Ga0496119_0024814_2291_2755 154
280 3300048923 Ga0496120_0211872 Ga0496120_0211872_195_659 154
281 3300048927 Ga0496124_0757707 Ga0496124_0757707_59_526 154
282 3300049578 Ga0501042_0089912 Ga0501042_0089912_1078_1542 154
283 3300049581 Ga0501047_0743913 Ga0501047_0743913_296_763 154
284 3300049586 Ga0501070_0133810 Ga0501070_0133810_1428_1895 154
285 3300050507 nmdc:mga05p37_533763_c1 nmdc:mga05p37_533763_c1_718_1182 154
286 3300050510 nmdc:mga06r32_50233_c1 nmdc:mga06r32_50233_c1_1854_2321 154
287 3300050514 nmdc:mga08x19_558559_c1 nmdc:mga08x19_558559_c1_136_603 154
288 3300050514 nmdc:mga08x19_744256_c1 nmdc:mga08x19_744256_c1_112_579 154
289 3300053077 Ga0495601_0000029 Ga0495601_0000029_101526_101990 154
290 3300053077 Ga0495601_0668285 Ga0495601_0668285_169_633 154
291 3300053078 Ga0495612_0004941 Ga0495612_0004941_3548_4015 154
292 3300053083 Ga0495655_0000010 Ga0495655_0000010_117648_118112 154
293 3300053083 Ga0495655_0190993 Ga0495655_0190993_168_635 154
294 3300053084 Ga0495595_0000007 Ga0495595_0000007_112880_113344 154
295 3300053084 Ga0495595_0006885 Ga0495595_0006885_1343_1807 154
296 3300053085 Ga0495619_0000026 Ga0495619_0000026_59220_59684 154
297 3300053085 Ga0495619_0000088 Ga0495619_0000088_67280_67747 154
298 3300053129 Ga0500628_000072 Ga0500628_000072_17513_17977 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

96

152

0.97

PF00571

CBS

CBS domain

4

59

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r50-assembly2.cif.gz_K crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.9012 7 151
2p9m-assembly1.cif.gz_A crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.864 3 152
6uof-assembly1.cif.gz_A 1.2 angstrom resolution crystal structure of cbs domains of transcriptional regulator from streptococcus pneumoniae 0.8633 1 148
7r50-assembly2.cif.gz_J crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.8631 7 151
2p9m-assembly1.cif.gz_B crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.8628 2 152
ID Description Score Start End Superfamily
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8919 2 150 3.10.580.10
af_Q2FXM2_188_307_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8828 2 151 3.10.580.10
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.878 2 150 3.10.580.10
4at0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8772 37 50 3.50.50.60
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8731 1 148 3.10.580.10
ID Description Score Start End GO Terms
AF-M3DAB5-F1-model_v4 CBS domain-containing protein 0.9415 2 151
AF-A0A3R7WD35-F1-model_v4 CBS domain-containing protein 0.9006 3 153 GO:0009086
AF-A0A075WDL2-F1-model_v4 CBS domain-containing protein 0.8965 1 152
AF-A0A534VBP1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8938 1 153 GO:0000155
AF-A0A532TTC0-F1-model_v4 CBS domain-containing protein 0.8906 2 153

Feature Viewer

pLDDT pTM Quality
83.93 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map