F394435

General Info

Members Datasets Scaffolds Average Seq Length
298 216 277 104

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0192906|Ga0495638_0192906_554_904
Length 116
Sequence MSTQMGSTPTESRPLAFRMQLKPGVAAEYERRHDELWPDLAEALRNAGIHDYSIFLDEETMSLFAVLRLRPDHNKDALPLQPVMKRWWDYMADLMEVHPDNKPVEWPLKPVFYFEG

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
16 2849560528 Caulobacter zeae 410 Isolate Unclassified
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
21 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
112 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
115 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
202 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
214 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
215 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 0
Isolates 7.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.52
Nodule 0
Rhizoplane 1.01
Rhizosphere 62.42
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008424 3300002987 Bacteria 2831
2 rootL2_10059714 3300003322 Bacteria 3325
3 JGI25161J50226_1018642 3300003374 Bacteria 718
4 Ga0055537_1000076 3300003773 Bacteria 70798
5 Ga0055537_1000260 3300003773 Bacteria 38657
6 Ga0055524_1019935 3300003775 Bacteria 2276
7 Ga0055536_1003677 3300003781 Bacteria 8154
8 Ga0055536_1004268 3300003781 Bacteria 7374
9 Ga0055534_1000124 3300003784 Bacteria 57565
10 Ga0055528_1000184 3300003790 Bacteria 52910
11 Ga0055530_10002644 3300003791 Bacteria 11209
12 Ga0055530_10005916 3300003791 Bacteria 5641
13 Ga0055530_10071745 3300003791 Bacteria 745
14 Ga0055531_10000743 3300003794 Bacteria 27461
15 Ga0055531_10001300 3300003794 Bacteria 18805
16 Ga0055531_10046624 3300003794 Bacteria 1189
17 Ga0055543_1004162 3300004625 Bacteria 4017
18 Ga0065165_1000003 3300005262 Bacteria 390701
19 Ga0065165_1000906 3300005262 Bacteria 38225
20 Ga0070677_10332421 3300005333 Bacteria 782
21 Ga0070675_101056790 3300005354 Bacteria 746
22 Ga0070659_100956480 3300005366 Bacteria 750
23 Ga0070667_100407442 3300005367 Bacteria 1238
24 Ga0070713_101787274 3300005436 Bacteria 597
25 Ga0070662_100541745 3300005457 Bacteria 974
26 Ga0070685_10034006 3300005466 Bacteria 2869
27 Ga0070679_100418840 3300005530 Bacteria 1285
28 Ga0070684_101419330 3300005535 Bacteria 654
29 Ga0068853_100523465 3300005539 Bacteria 1121
30 Ga0070665_100513504 3300005548 Bacteria 1210
31 Ga0070664_100568771 3300005564 Bacteria 1049
32 Ga0068857_101272580 3300005577 Bacteria 713
33 Ga0068852_101623694 3300005616 Bacteria 669
34 Ga0068864_101199651 3300005618 Bacteria 757
35 Ga0075362_10124353 3300006177 Bacteria 1223
36 Ga0075366_10053242 3300006195 Bacteria 2404
37 Ga0075366_10584817 3300006195 Bacteria 692
38 Ga0105240_12792996 3300009093 Bacteria 502
39 Ga0105241_10089606 3300009174 Bacteria 2424
40 Ga0105237_10703569 3300009545 Bacteria 1017
41 Ga0105237_11264410 3300009545 Unclassified 744
42 Ga0105238_10010174 3300009551 Bacteria 9434
43 Ga0105239_11180562 3300010375 Bacteria 882
44 Ga0157347_1006291 3300012502 Bacteria 1158
45 Ga0157373_11537023 3300013100 Unclassified 509
46 Ga0157371_10085562 3300013102 Bacteria 2233
47 Ga0157371_10557496 3300013102 Unclassified 850
48 Ga0157370_10035177 3300013104 Bacteria 4871
49 Ga0157369_10186838 3300013105 Bacteria 2179
50 Ga0157369_12399258 3300013105 Bacteria 534
51 Ga0157378_10489283 3300013297 Bacteria 1227
52 Ga0157372_10505562 3300013307 Bacteria 1409
53 Ga0157372_11275366 3300013307 Bacteria 848
54 Ga0157375_10225527 3300013308 Bacteria 2033
55 Ga0157380_10538129 3300014326 Bacteria 1143
56 Ga0182008_10371916 3300014497 Bacteria 762
57 Ga0157379_10540196 3300014968 Bacteria 1084
58 Ga0157376_11524088 3300014969 Bacteria 702
59 Ga0163161_11202656 3300017792 Bacteria 655
60 Ga0209436_111549 3300025208 Bacteria 1545
61 Ga0209436_111557 3300025208 Bacteria 1544
62 Ga0209565_1000018 3300025263 Bacteria 460940
63 Ga0209673_1000006 3300025273 Bacteria 650600
64 Ga0209130_1000036 3300025284 Bacteria 284111
65 Ga0209130_1013336 3300025284 Bacteria 2108
66 Ga0209675_1000005 3300025291 Bacteria 849192
67 Ga0209675_1002720 3300025291 Bacteria 8856
68 Ga0209676_1001012 3300025292 Bacteria 32874
69 Ga0209564_1000144 3300025295 Bacteria 175328
70 Ga0209564_1002536 3300025295 Bacteria 14094
71 Ga0209564_1019060 3300025295 Bacteria 2582
72 Ga0209758_1000835 3300025297 Bacteria 42973
73 Ga0209050_1000633 3300025298 Bacteria 54643
74 Ga0209050_1021138 3300025298 Bacteria 2386
75 Ga0209256_1001475 3300025299 Bacteria 24067
76 Ga0209256_1003732 3300025299 Bacteria 10307
77 Ga0209256_1003816 3300025299 Bacteria 10095
78 Ga0209256_1045830 3300025299 Bacteria 1085
79 Ga0207426_1003756 3300025302 Bacteria 7920
80 Ga0209257_1000223 3300025304 Bacteria 134337
81 Ga0209257_1000506 3300025304 Bacteria 68402
82 Ga0207705_10765892 3300025909 Bacteria 750
83 Ga0207654_10046613 3300025911 Bacteria 2472
84 Ga0207707_10133163 3300025912 Bacteria 2174
85 Ga0207695_10430623 3300025913 Unclassified 1203
86 Ga0207671_10155875 3300025914 Bacteria 1766
87 Ga0207662_10185492 3300025918 Bacteria 1340
88 Ga0207657_10537164 3300025919 Bacteria 915
89 Ga0207694_10717942 3300025924 Bacteria 843
90 Ga0207659_10736873 3300025926 Bacteria 845
91 Ga0207669_11244769 3300025937 Bacteria 631
92 Ga0207661_10435721 3300025944 Bacteria 1192
93 Ga0207679_11206802 3300025945 Bacteria 694
94 Ga0207678_10700615 3300026067 Bacteria 891
95 Ga0207641_10542132 3300026088 Bacteria 1134
96 Ga0207674_11764468 3300026116 Bacteria 586
97 Ga0268266_10887590 3300028379 Bacteria 862
98 Ga0307515_10016038 3300028794 Bacteria 13751
99 Ga0307515_10022050 3300028794 Bacteria 11249
100 Ga0307515_10059507 3300028794 Bacteria 5472
101 Ga0265332_10095990 3300031238 Bacteria 1252
102 Ga0265316_10160023 3300031344 Bacteria 1684
103 Ga0265316_10507320 3300031344 Bacteria 861
104 Ga0307509_10458974 3300031507 Unclassified 966
105 Ga0307408_100004065 3300031548 Bacteria 9975
106 Ga0307413_10216910 3300031824 Bacteria 1394
107 Ga0307407_10096441 3300031903 Bacteria 1825
108 Ga0307412_11311793 3300031911 Bacteria 652
109 Ga0307409_100432674 3300031995 Bacteria 1265
110 Ga0307409_101831464 3300031995 Bacteria 636
111 Ga0307409_102081888 3300031995 Unclassified 597
112 Ga0307416_100129112 3300032002 Bacteria 2271
113 Ga0307414_10007852 3300032004 Bacteria 6017
114 Ga0307411_10000141 3300032005 Bacteria 22602
115 Ga0307411_10059091 3300032005 Bacteria 2540
116 Ga0307411_10170656 3300032005 Bacteria 1640
117 Ga0395899_0000012 3300037312 Bacteria 517561
118 Ga0395905_0000071 3300037471 Bacteria 174580
119 Ga0451804_0630534 3300041463 Bacteria 526
120 Ga0451835_0719800 3300041492 Bacteria 572
121 Ga0439432_128931 3300042006 Bacteria 747
122 Ga0450897_039684 3300042128 Bacteria 552
123 Ga0450898_067136 3300042134 Bacteria 713
124 Ga0439446_0025215 3300042156 Bacteria 1699
125 Ga0439434_0319194 3300042435 Bacteria 539
126 Ga0439459_0021138 3300042438 Bacteria 1247
127 Ga0466969_0003753 3300044656 Bacteria 8071
128 Ga0466969_0004754 3300044656 Bacteria 7226
129 Ga0466969_0490992 3300044656 Bacteria 560
130 Ga0466972_0278302 3300044658 Bacteria 782
131 Ga0466965_0215110 3300044683 Bacteria 1023
132 Ga0466966_0000303 3300044684 Bacteria 32389
133 Ga0466966_0052061 3300044684 Unclassified 2602
134 Ga0466961_0000482 3300044693 Bacteria 25345
135 Ga0466964_0018915 3300044706 Bacteria 2645
136 Ga0466971_0001240 3300044719 Bacteria 10615
137 Ga0466968_0035120 3300044735 Bacteria 2096
138 Ga0466970_0000842 3300044765 Bacteria 14765
139 Ga0466970_0378724 3300044765 Unclassified 805
140 Ga0466957_0035011 3300044842 Bacteria 3013
141 Ga0466957_0102538 3300044842 Bacteria 1805
142 Ga0466959_0005862 3300045049 Bacteria 8458
143 Ga0466959_0015139 3300045049 Bacteria 5617
144 Ga0466959_0414058 3300045049 Unclassified 915
145 Ga0466958_0105649 3300045836 Bacteria 1755
146 Ga0495590_0001877 3300046457 Bacteria 8887
147 Ga0495638_0000903 3300046460 Bacteria 30346
148 Ga0495638_0010069 3300046460 Bacteria 6590
149 Ga0495638_0012696 3300046460 Bacteria 5761
150 Ga0495638_0065535 3300046460 Bacteria 2235
151 Ga0495638_0066528 3300046460 Bacteria 2215
152 Ga0495638_0192906 3300046460 Bacteria 1155
153 Ga0495605_0216763 3300046474 Bacteria 828
154 Ga0495584_0000002 3300046491 Bacteria 512179
155 Ga0495585_0036368 3300046492 Bacteria 2778
156 Ga0495596_0089209 3300046500 Bacteria 1196
157 Ga0495607_0046161 3300046501 Bacteria 2560
158 Ga0495583_0000008 3300046506 Bacteria 411092
159 Ga0495606_0017850 3300046507 Bacteria 5344
160 Ga0495606_0048640 3300046507 Bacteria 2787
161 Ga0495606_0060830 3300046507 Bacteria 2417
162 Ga0495606_0095735 3300046507 Bacteria 1817
163 Ga0495610_0017631 3300046512 Bacteria 4064
164 Ga0495610_0093120 3300046512 Bacteria 1362
165 Ga0495610_0152715 3300046512 Bacteria 983
166 Ga0495616_0001054 3300046513 Bacteria 19705
167 Ga0495616_0001840 3300046513 Bacteria 14361
168 Ga0495631_0016244 3300046518 Bacteria 3554
169 Ga0495632_0014086 3300046519 Bacteria 4537
170 Ga0495632_0026064 3300046519 Bacteria 3082
171 Ga0495632_0034959 3300046519 Bacteria 2568
172 Ga0495637_0002140 3300046520 Bacteria 11072
173 Ga0495637_0025735 3300046520 Bacteria 2649
174 Ga0495643_0052865 3300046522 Bacteria 2180
175 Ga0495643_0055723 3300046522 Bacteria 2112
176 Ga0495644_0025011 3300046523 Bacteria 2269
177 Ga0495648_0000176 3300046524 Bacteria 73832
178 Ga0495648_0306600 3300046524 Bacteria 741
179 Ga0495666_0280042 3300046526 Bacteria 756
180 Ga0495642_0172619 3300046528 Bacteria 939
181 Ga0495654_0114649 3300046530 Bacteria 1226
182 Ga0495587_0067524 3300046536 Bacteria 2084
183 Ga0495609_0022398 3300046538 Bacteria 2910
184 Ga0495597_0025563 3300046542 Bacteria 2717
185 Ga0495597_0061600 3300046542 Bacteria 1634
186 Ga0495597_0175499 3300046542 Bacteria 868
187 Ga0495597_0248909 3300046542 Bacteria 699
188 Ga0495645_0693160 3300046543 Bacteria 619
189 Ga0495633_0495819 3300046558 Bacteria 551
190 Ga0495633_0496256 3300046558 Bacteria 550
191 Ga0495668_0001203 3300046616 Bacteria 26299
192 Ga0495668_0007240 3300046616 Bacteria 7119
193 Ga0495668_0091304 3300046616 Bacteria 1668
194 Ga0495625_0000143 3300046660 Bacteria 110121
195 Ga0495625_0001739 3300046660 Bacteria 25182
196 Ga0495625_0007256 3300046660 Bacteria 9694
197 Ga0495625_0156657 3300046660 Bacteria 1528
198 Ga0495625_0159778 3300046660 Bacteria 1510
199 Ga0495625_0274319 3300046660 Bacteria 1087
200 Ga0495625_0302561 3300046660 Bacteria 1023
201 Ga0495659_0306091 3300046664 Bacteria 672
202 Ga0495659_0367339 3300046664 Bacteria 617
203 Ga0495659_0530518 3300046664 Bacteria 518
204 Ga0495661_0022755 3300046665 Bacteria 4074
205 Ga0495670_0212811 3300046691 Bacteria 1025
206 Ga0495671_0252121 3300046692 Bacteria 852
207 Ga0495671_0361071 3300046692 Bacteria 696
208 Ga0495589_0141187 3300046794 Bacteria 1153
209 Ga0495660_0013064 3300046810 Bacteria 4813
210 Ga0495683_0108721 3300047323 Bacteria 1325
211 Ga0495675_0536188 3300047444 Bacteria 669
212 Ga0495677_0006907 3300047445 Bacteria 4266
213 Ga0495685_118811 3300047447 Bacteria 868
214 Ga0495673_0000416 3300047469 Bacteria 49348
215 Ga0495673_0030394 3300047469 Bacteria 2536
216 Ga0495681_0015104 3300047470 Bacteria 4383
217 Ga0495686_0001382 3300047472 Bacteria 26955
218 Ga0495686_0320763 3300047472 Bacteria 849
219 Ga0495626_0053287 3300048091 Bacteria 1862
220 Ga0496102_0826390 3300048905 Bacteria 849
221 Ga0496115_0858889 3300048918 Bacteria 702
222 Ga0496117_0001963 3300048920 Bacteria 27350
223 Ga0496118_0002437 3300048921 Bacteria 25046
224 Ga0496118_0636958 3300048921 Bacteria 504
225 Ga0496124_0012047 3300048927 Bacteria 8591
226 Ga0496125_0102968 3300048928 Bacteria 2096
227 Ga0496126_0118279 3300048929 Bacteria 2301
228 Ga0496126_0126632 3300048929 Bacteria 2210
229 Ga0496126_0281926 3300048929 Bacteria 1376
230 Ga0495678_003164 3300049459 Bacteria 10386
231 Ga0501033_0008295 3300049570 Bacteria 8047
232 Ga0501034_0003706 3300049571 Bacteria 17261
233 Ga0501037_0048607 3300049573 Bacteria 3107
234 Ga0501038_0923760 3300049574 Bacteria 643
235 Ga0501238_013337 3300049671 Bacteria 1118
236 Ga0501262_035541 3300049759 Bacteria 730
237 Ga0501044_0000796 3300049823 Bacteria 38157
238 nmdc:mga03683_398908_c1 3300050489 Bacteria 656
239 nmdc:mga0k408_468378_c1 3300050493 Bacteria 748
240 nmdc:mga07m45_878183_c1 3300050496 Bacteria 513
241 Ga0500578_0000389 3300053086 Bacteria 53879
242 Ga0500578_0281793 3300053086 Bacteria 991
243 Ga0500643_095326 3300053087 Bacteria 809
244 Ga0500644_0000010 3300053088 Bacteria 127225
245 Ga0500646_0349082 3300053090 Bacteria 539
246 Ga0500583_0352434 3300053092 Unclassified 713
247 Ga0500651_0354571 3300053093 Bacteria 832
248 Ga0500641_0037405 3300053096 Bacteria 1946
249 Ga0500650_0299482 3300053098 Bacteria 712
250 Ga0500556_0001405 3300053104 Bacteria 10468
251 Ga0500556_0085096 3300053104 Bacteria 1201
252 Ga0500562_006506 3300053108 Bacteria 2943
253 Ga0500572_266937 3300053111 Bacteria 555
254 Ga0500594_0000288 3300053118 Bacteria 11527
255 Ga0500597_084092 3300053120 Bacteria 1381
256 Ga0500608_000006 3300053122 Bacteria 102722
257 Ga0500608_203736 3300053122 Bacteria 815
258 Ga0500618_000071 3300053125 Bacteria 85596
259 Ga0500618_039362 3300053125 Bacteria 1089
260 Ga0500642_0229961 3300053130 Bacteria 857
261 Ga0500655_002640 3300053133 Bacteria 3247
262 Ga0500658_0045005 3300053134 Bacteria 1783
263 Ga0500559_0000031 3300053136 Bacteria 114782
264 Ga0500559_0002516 3300053136 Bacteria 9415
265 Ga0500564_000049 3300053138 Bacteria 30793
266 Ga0500564_322173 3300053138 Bacteria 585
267 Ga0500588_0027339 3300053146 Bacteria 1606
268 Ga0500588_0048160 3300053146 Bacteria 1317
269 Ga0500622_0003337 3300053156 Bacteria 10824
270 Ga0500622_0006512 3300053156 Bacteria 6753
271 Ga0500622_0011027 3300053156 Bacteria 4932
272 Ga0500622_0035340 3300053156 Bacteria 2615
273 Ga0500645_001497 3300053730 Bacteria 11708
274 Ga0500609_000799 3300053731 Bacteria 4723
275 Ga0500656_064297 3300053732 Bacteria 555
276 Ga0500599_059278 3300053736 Bacteria 620
277 Ga0466962_0031079 3300061719 Bacteria 2556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_11764468 Ga0207674_117644681 83
2 3300006177 Ga0075362_10124353 Ga0075362_101243532 86
3 3300048928 Ga0496125_0102968 Ga0496125_0102968_569_904 86
4 3300048929 Ga0496126_0126632 Ga0496126_0126632_1201_1536 86
5 3300048929 Ga0496126_0281926 Ga0496126_0281926_576_911 86
6 3300050489 nmdc:mga03683_398908_c1 nmdc:mga03683_398908_c1_189_524 86
7 3300053122 Ga0500608_000006 Ga0500608_000006_10957_11292 86
8 3300053156 Ga0500622_0006512 Ga0500622_0006512_5964_6299 86
9 3300003781 Ga0055536_1003677 Ga0055536_10036775 87
10 3300003781 Ga0055536_1004268 Ga0055536_10042685 87
11 3300003791 Ga0055530_10002644 Ga0055530_100026446 87
12 3300003791 Ga0055530_10005916 Ga0055530_100059167 87
13 3300003794 Ga0055531_10000743 Ga0055531_1000074322 87
14 3300003794 Ga0055531_10046624 Ga0055531_100466242 87
15 3300025292 Ga0209676_1001012 Ga0209676_10010124 87
16 3300025298 Ga0209050_1000633 Ga0209050_10006334 87
17 3300025304 Ga0209257_1000223 Ga0209257_100022330 87
18 3300042438 Ga0439459_0021138 Ga0439459_0021138_19_351 87
19 3300044683 Ga0466965_0215110 Ga0466965_0215110_435_770 87
20 3300046460 Ga0495638_0000903 Ga0495638_0000903_2991_3326 87
21 3300048927 Ga0496124_0012047 Ga0496124_0012047_4526_4861 87
22 3300003794 Ga0055531_10001300 Ga0055531_100013003 88
23 3300012502 Ga0157347_1006291 Ga0157347_10062912 88
24 3300014326 Ga0157380_10538129 Ga0157380_105381292 88
25 3300014497 Ga0182008_10371916 Ga0182008_103719162 88
26 3300025304 Ga0209257_1000506 Ga0209257_10005067 88
27 3300041492 Ga0451835_0719800 Ga0451835_0719800_92_424 88
28 3300046460 Ga0495638_0010069 Ga0495638_0010069_5938_6270 88
29 3300046507 Ga0495606_0060830 Ga0495606_0060830_559_891 88
30 3300046512 Ga0495610_0093120 Ga0495610_0093120_250_579 88
31 3300046513 Ga0495616_0001054 Ga0495616_0001054_17852_18184 88
32 3300046519 Ga0495632_0026064 Ga0495632_0026064_1767_2102 88
33 3300046524 Ga0495648_0306600 Ga0495648_0306600_47_379 88
34 3300046542 Ga0495597_0248909 Ga0495597_0248909_170_499 88
35 3300046616 Ga0495668_0091304 Ga0495668_0091304_714_1046 88
36 3300046660 Ga0495625_0156657 Ga0495625_0156657_831_1163 88
37 3300046810 Ga0495660_0013064 Ga0495660_0013064_1231_1563 88
38 3300047470 Ga0495681_0015104 Ga0495681_0015104_3638_3970 88
39 3300048921 Ga0496118_0636958 Ga0496118_0636958_137_469 88
40 3300048929 Ga0496126_0118279 Ga0496126_0118279_1520_1852 88
41 3300053086 Ga0500578_0281793 Ga0500578_0281793_331_663 88
42 3300053104 Ga0500556_0001405 Ga0500556_0001405_7108_7437 88
43 3300053730 Ga0500645_001497 Ga0500645_001497_8401_8730 88
44 3300053731 Ga0500609_000799 Ga0500609_000799_3173_3505 88
45 3300025297 Ga0209758_1000835 Ga0209758_100083533 89
46 3300046660 Ga0495625_0007256 Ga0495625_0007256_6411_6743 89
47 3300047469 Ga0495673_0030394 Ga0495673_0030394_1035_1367 89
48 3300049671 Ga0501238_013337 Ga0501238_013337_456_788 89
49 3300053736 Ga0500599_059278 Ga0500599_059278_150_485 89
50 3300025295 Ga0209564_1019060 Ga0209564_10190602 91
51 3300025299 Ga0209256_1045830 Ga0209256_10458302 91
52 3300005616 Ga0068852_101623694 Ga0068852_1016236941 97
53 3300025913 Ga0207695_10430623 Ga0207695_104306233 97
54 3300046457 Ga0495590_0001877 Ga0495590_0001877_8562_8858 97
55 3300046460 Ga0495638_0012696 Ga0495638_0012696_4292_4585 97
56 3300046460 Ga0495638_0066528 Ga0495638_0066528_496_789 97
57 3300046506 Ga0495583_0000008 Ga0495583_0000008_38703_38996 97
58 3300046513 Ga0495616_0001840 Ga0495616_0001840_3722_4015 97
59 3300046542 Ga0495597_0025563 Ga0495597_0025563_828_1121 97
60 3300046660 Ga0495625_0001739 Ga0495625_0001739_14582_14875 97
61 3300048905 Ga0496102_0826390 Ga0496102_0826390_460_756 97
62 3300049574 Ga0501038_0923760 Ga0501038_0923760_11_319 97
63 3300050496 nmdc:mga07m45_878183_c1 nmdc:mga07m45_878183_c1_74_367 97
64 3300053090 Ga0500646_0349082 Ga0500646_0349082_80_373 97
65 3300053092 Ga0500583_0352434 Ga0500583_0352434_387_680 97
66 3300053093 Ga0500651_0354571 Ga0500651_0354571_501_794 97
67 3300053104 Ga0500556_0085096 Ga0500556_0085096_556_849 97
68 3300053125 Ga0500618_039362 Ga0500618_039362_368_661 97
69 3300053130 Ga0500642_0229961 Ga0500642_0229961_124_417 97
70 3300053134 Ga0500658_0045005 Ga0500658_0045005_978_1271 97
71 3300053146 Ga0500588_0027339 Ga0500588_0027339_977_1270 97
72 3300053146 Ga0500588_0048160 Ga0500588_0048160_78_371 97
73 3300053732 Ga0500656_064297 Ga0500656_064297_186_479 97
74 3300005367 Ga0070667_100407442 Ga0070667_1004074422 102
75 3300005436 Ga0070713_101787274 Ga0070713_1017872742 102
76 3300005466 Ga0070685_10034006 Ga0070685_100340062 102
77 3300005530 Ga0070679_100418840 Ga0070679_1004188402 102
78 3300005535 Ga0070684_101419330 Ga0070684_1014193301 102
79 3300005539 Ga0068853_100523465 Ga0068853_1005234652 102
80 3300005564 Ga0070664_100568771 Ga0070664_1005687712 102
81 3300005577 Ga0068857_101272580 Ga0068857_1012725801 102
82 3300005618 Ga0068864_101199651 Ga0068864_1011996512 102
83 3300009093 Ga0105240_12792996 Ga0105240_127929962 102
84 3300009174 Ga0105241_10089606 Ga0105241_100896062 102
85 3300009545 Ga0105237_10703569 Ga0105237_107035691 102
86 3300009545 Ga0105237_11264410 Ga0105237_112644101 102
87 3300009551 Ga0105238_10010174 Ga0105238_100101744 102
88 3300010375 Ga0105239_11180562 Ga0105239_111805621 102
89 3300013100 Ga0157373_11537023 Ga0157373_115370231 102
90 3300013105 Ga0157369_10186838 Ga0157369_101868381 102
91 3300013307 Ga0157372_10505562 Ga0157372_105055622 102
92 3300025911 Ga0207654_10046613 Ga0207654_100466132 102
93 3300025912 Ga0207707_10133163 Ga0207707_101331632 102
94 3300025914 Ga0207671_10155875 Ga0207671_101558751 102
95 3300025918 Ga0207662_10185492 Ga0207662_101854922 102
96 3300025924 Ga0207694_10717942 Ga0207694_107179422 102
97 3300025937 Ga0207669_11244769 Ga0207669_112447692 102
98 3300025944 Ga0207661_10435721 Ga0207661_104357212 102
99 3300026088 Ga0207641_10542132 Ga0207641_105421321 102
100 3300031238 Ga0265332_10095990 Ga0265332_100959901 102
101 3300031344 Ga0265316_10160023 Ga0265316_101600232 102
102 3300031344 Ga0265316_10507320 Ga0265316_105073201 102
103 3300031507 Ga0307509_10458974 Ga0307509_104589742 102
104 3300031824 Ga0307413_10216910 Ga0307413_102169102 102
105 3300031903 Ga0307407_10096441 Ga0307407_100964413 102
106 3300031995 Ga0307409_100432674 Ga0307409_1004326742 102
107 3300031995 Ga0307409_102081888 Ga0307409_1020818881 102
108 3300032002 Ga0307416_100129112 Ga0307416_1001291121 102
109 3300032005 Ga0307411_10059091 Ga0307411_100590912 102
110 3300041463 Ga0451804_0630534 Ga0451804_0630534_191_502 102
111 3300044656 Ga0466969_0003753 Ga0466969_0003753_1799_2113 102
112 3300044656 Ga0466969_0004754 Ga0466969_0004754_6873_7187 102
113 3300044656 Ga0466969_0490992 Ga0466969_0490992_66_380 102
114 3300044658 Ga0466972_0278302 Ga0466972_0278302_215_529 102
115 3300044684 Ga0466966_0000303 Ga0466966_0000303_3399_3713 102
116 3300044684 Ga0466966_0052061 Ga0466966_0052061_2004_2318 102
117 3300044693 Ga0466961_0000482 Ga0466961_0000482_21501_21815 102
118 3300044706 Ga0466964_0018915 Ga0466964_0018915_969_1283 102
119 3300044719 Ga0466971_0001240 Ga0466971_0001240_7272_7586 102
120 3300044735 Ga0466968_0035120 Ga0466968_0035120_1624_1938 102
121 3300044765 Ga0466970_0000842 Ga0466970_0000842_5105_5419 102
122 3300044765 Ga0466970_0378724 Ga0466970_0378724_463_777 102
123 3300044842 Ga0466957_0035011 Ga0466957_0035011_400_714 102
124 3300044842 Ga0466957_0102538 Ga0466957_0102538_691_1005 102
125 3300045049 Ga0466959_0005862 Ga0466959_0005862_7728_8042 102
126 3300045049 Ga0466959_0015139 Ga0466959_0015139_4535_4849 102
127 3300045049 Ga0466959_0414058 Ga0466959_0414058_376_690 102
128 3300045836 Ga0466958_0105649 Ga0466958_0105649_289_603 102
129 3300048920 Ga0496117_0001963 Ga0496117_0001963_20256_20570 102
130 3300048921 Ga0496118_0002437 Ga0496118_0002437_11856_12170 102
131 3300053133 Ga0500655_002640 Ga0500655_002640_2156_2470 102
132 3300061719 Ga0466962_0031079 Ga0466962_0031079_1276_1590 102
133 iso_pu_bacteria 2582581279 2585146253 102
134 3300003791 Ga0055530_10071745 Ga0055530_100717451 103
135 3300013102 Ga0157371_10085562 Ga0157371_100855622 103
136 3300013102 Ga0157371_10557496 Ga0157371_105574962 103
137 3300013104 Ga0157370_10035177 Ga0157370_100351776 103
138 3300013105 Ga0157369_12399258 Ga0157369_123992582 103
139 iso_pu_bacteria 2582581280 2585155375 103
140 iso_pu_bacteria 2582581293 2585198939 103
141 iso_pu_bacteria 2643221545 2643748246 103
142 iso_pu_bacteria 2643221552 2643779061 103
143 iso_pu_bacteria 2643221583 2643926213 103
144 iso_pu_bacteria 2643221584 2643927628 103
145 iso_pu_bacteria 2643221691 2644508303 103
146 iso_pu_bacteria 2818991435 2819539568 103
147 iso_pu_bacteria 2818991454 2819648776 103
148 3300002987 JGI25159J45721_1008424 JGI25159J45721_10084243 104
149 3300003322 rootL2_10059714 rootL2_100597142 104
150 3300003374 JGI25161J50226_1018642 JGI25161J50226_10186421 104
151 3300003773 Ga0055537_1000076 Ga0055537_100007615 104
152 3300003773 Ga0055537_1000260 Ga0055537_10002608 104
153 3300003775 Ga0055524_1019935 Ga0055524_10199353 104
154 3300003784 Ga0055534_1000124 Ga0055534_100012423 104
155 3300003790 Ga0055528_1000184 Ga0055528_10001848 104
156 3300004625 Ga0055543_1004162 Ga0055543_10041622 104
157 3300005262 Ga0065165_1000003 Ga0065165_100000396 104
158 3300005262 Ga0065165_1000906 Ga0065165_10009068 104
159 3300005333 Ga0070677_10332421 Ga0070677_103324213 104
160 3300005354 Ga0070675_101056790 Ga0070675_1010567902 104
161 3300005366 Ga0070659_100956480 Ga0070659_1009564802 104
162 3300005457 Ga0070662_100541745 Ga0070662_1005417452 104
163 3300005548 Ga0070665_100513504 Ga0070665_1005135043 104
164 3300006195 Ga0075366_10053242 Ga0075366_100532422 104
165 3300006195 Ga0075366_10584817 Ga0075366_105848172 104
166 3300013297 Ga0157378_10489283 Ga0157378_104892832 104
167 3300013307 Ga0157372_11275366 Ga0157372_112753662 104
168 3300013308 Ga0157375_10225527 Ga0157375_102255272 104
169 3300014968 Ga0157379_10540196 Ga0157379_105401962 104
170 3300014969 Ga0157376_11524088 Ga0157376_115240882 104
171 3300017792 Ga0163161_11202656 Ga0163161_112026561 104
172 3300025208 Ga0209436_111549 Ga0209436_1115492 104
173 3300025208 Ga0209436_111557 Ga0209436_1115571 104
174 3300025263 Ga0209565_1000018 Ga0209565_1000018295 104
175 3300025273 Ga0209673_1000006 Ga0209673_1000006477 104
176 3300025284 Ga0209130_1000036 Ga0209130_1000036234 104
177 3300025284 Ga0209130_1013336 Ga0209130_10133362 104
178 3300025291 Ga0209675_1000005 Ga0209675_1000005295 104
179 3300025291 Ga0209675_1002720 Ga0209675_10027207 104
180 3300025295 Ga0209564_1000144 Ga0209564_100014433 104
181 3300025295 Ga0209564_1002536 Ga0209564_10025368 104
182 3300025298 Ga0209050_1021138 Ga0209050_10211383 104
183 3300025299 Ga0209256_1001475 Ga0209256_10014754 104
184 3300025299 Ga0209256_1003732 Ga0209256_10037324 104
185 3300025299 Ga0209256_1003816 Ga0209256_10038167 104
186 3300025302 Ga0207426_1003756 Ga0207426_10037564 104
187 3300025909 Ga0207705_10765892 Ga0207705_107658921 104
188 3300025919 Ga0207657_10537164 Ga0207657_105371642 104
189 3300025926 Ga0207659_10736873 Ga0207659_107368732 104
190 3300025945 Ga0207679_11206802 Ga0207679_112068022 104
191 3300026067 Ga0207678_10700615 Ga0207678_107006151 104
192 3300028379 Ga0268266_10887590 Ga0268266_108875902 104
193 3300028794 Ga0307515_10016038 Ga0307515_100160383 104
194 3300028794 Ga0307515_10022050 Ga0307515_100220502 104
195 3300028794 Ga0307515_10059507 Ga0307515_100595073 104
196 3300031548 Ga0307408_100004065 Ga0307408_1000040654 104
197 3300031911 Ga0307412_11311793 Ga0307412_113117932 104
198 3300031995 Ga0307409_101831464 Ga0307409_1018314642 104
199 3300032004 Ga0307414_10007852 Ga0307414_100078525 104
200 3300032005 Ga0307411_10000141 Ga0307411_1000014111 104
201 3300032005 Ga0307411_10170656 Ga0307411_101706562 104
202 3300037312 Ga0395899_0000012 Ga0395899_0000012_33049_33363 104
203 3300037471 Ga0395905_0000071 Ga0395905_0000071_169361_169681 104
204 3300042006 Ga0439432_128931 Ga0439432_128931_10_324 104
205 3300042128 Ga0450897_039684 Ga0450897_039684_64_378 104
206 3300042134 Ga0450898_067136 Ga0450898_067136_203_517 104
207 3300042156 Ga0439446_0025215 Ga0439446_0025215_1071_1406 104
208 3300042435 Ga0439434_0319194 Ga0439434_0319194_194_529 104
209 3300046460 Ga0495638_0065535 Ga0495638_0065535_1308_1643 104
210 3300046460 Ga0495638_0192906 Ga0495638_0192906_554_904 104
211 3300046474 Ga0495605_0216763 Ga0495605_0216763_133_447 104
212 3300046491 Ga0495584_0000002 Ga0495584_0000002_277649_277963 104
213 3300046492 Ga0495585_0036368 Ga0495585_0036368_523_855 104
214 3300046500 Ga0495596_0089209 Ga0495596_0089209_26_340 104
215 3300046501 Ga0495607_0046161 Ga0495607_0046161_42_356 104
216 3300046507 Ga0495606_0017850 Ga0495606_0017850_2651_2965 104
217 3300046507 Ga0495606_0048640 Ga0495606_0048640_1802_2152 104
218 3300046507 Ga0495606_0095735 Ga0495606_0095735_715_1029 104
219 3300046512 Ga0495610_0017631 Ga0495610_0017631_2451_2786 104
220 3300046512 Ga0495610_0152715 Ga0495610_0152715_503_832 104
221 3300046518 Ga0495631_0016244 Ga0495631_0016244_1866_2201 104
222 3300046519 Ga0495632_0014086 Ga0495632_0014086_785_1099 104
223 3300046519 Ga0495632_0034959 Ga0495632_0034959_147_479 104
224 3300046520 Ga0495637_0002140 Ga0495637_0002140_5611_5940 104
225 3300046520 Ga0495637_0025735 Ga0495637_0025735_1255_1590 104
226 3300046522 Ga0495643_0052865 Ga0495643_0052865_998_1330 104
227 3300046522 Ga0495643_0055723 Ga0495643_0055723_1518_1832 104
228 3300046523 Ga0495644_0025011 Ga0495644_0025011_1839_2153 104
229 3300046524 Ga0495648_0000176 Ga0495648_0000176_17092_17427 104
230 3300046526 Ga0495666_0280042 Ga0495666_0280042_15_329 104
231 3300046528 Ga0495642_0172619 Ga0495642_0172619_334_648 104
232 3300046530 Ga0495654_0114649 Ga0495654_0114649_263_598 104
233 3300046536 Ga0495587_0067524 Ga0495587_0067524_1410_1724 104
234 3300046538 Ga0495609_0022398 Ga0495609_0022398_1813_2127 104
235 3300046542 Ga0495597_0061600 Ga0495597_0061600_1230_1580 104
236 3300046542 Ga0495597_0175499 Ga0495597_0175499_108_443 104
237 3300046543 Ga0495645_0693160 Ga0495645_0693160_93_407 104
238 3300046558 Ga0495633_0495819 Ga0495633_0495819_74_388 104
239 3300046558 Ga0495633_0496256 Ga0495633_0496256_84_419 104
240 3300046616 Ga0495668_0001203 Ga0495668_0001203_6012_6326 104
241 3300046616 Ga0495668_0007240 Ga0495668_0007240_2671_3006 104
242 3300046660 Ga0495625_0000143 Ga0495625_0000143_39431_39763 104
243 3300046660 Ga0495625_0159778 Ga0495625_0159778_179_529 104
244 3300046660 Ga0495625_0274319 Ga0495625_0274319_644_958 104
245 3300046660 Ga0495625_0302561 Ga0495625_0302561_499_834 104
246 3300046664 Ga0495659_0306091 Ga0495659_0306091_343_657 104
247 3300046664 Ga0495659_0367339 Ga0495659_0367339_150_482 104
248 3300046664 Ga0495659_0530518 Ga0495659_0530518_63_377 104
249 3300046665 Ga0495661_0022755 Ga0495661_0022755_1010_1324 104
250 3300046691 Ga0495670_0212811 Ga0495670_0212811_267_581 104
251 3300046692 Ga0495671_0252121 Ga0495671_0252121_76_390 104
252 3300046692 Ga0495671_0361071 Ga0495671_0361071_344_679 104
253 3300046794 Ga0495589_0141187 Ga0495589_0141187_497_811 104
254 3300047323 Ga0495683_0108721 Ga0495683_0108721_564_896 104
255 3300047444 Ga0495675_0536188 Ga0495675_0536188_22_336 104
256 3300047445 Ga0495677_0006907 Ga0495677_0006907_304_618 104
257 3300047447 Ga0495685_118811 Ga0495685_118811_228_542 104
258 3300047469 Ga0495673_0000416 Ga0495673_0000416_2266_2601 104
259 3300047472 Ga0495686_0001382 Ga0495686_0001382_25317_25652 104
260 3300047472 Ga0495686_0320763 Ga0495686_0320763_64_378 104
261 3300048091 Ga0495626_0053287 Ga0495626_0053287_1096_1410 104
262 3300048918 Ga0496115_0858889 Ga0496115_0858889_247_561 104
263 3300049459 Ga0495678_003164 Ga0495678_003164_5009_5344 104
264 3300049570 Ga0501033_0008295 Ga0501033_0008295_6838_7182 104
265 3300049571 Ga0501034_0003706 Ga0501034_0003706_6766_7110 104
266 3300049573 Ga0501037_0048607 Ga0501037_0048607_589_933 104
267 3300049759 Ga0501262_035541 Ga0501262_035541_26_358 104
268 3300049823 Ga0501044_0000796 Ga0501044_0000796_27547_27891 104
269 3300050493 nmdc:mga0k408_468378_c1 nmdc:mga0k408_468378_c1_71_406 104
270 3300053086 Ga0500578_0000389 Ga0500578_0000389_5030_5365 104
271 3300053087 Ga0500643_095326 Ga0500643_095326_267_599 104
272 3300053088 Ga0500644_0000010 Ga0500644_0000010_71283_71618 104
273 3300053096 Ga0500641_0037405 Ga0500641_0037405_94_429 104
274 3300053098 Ga0500650_0299482 Ga0500650_0299482_68_418 104
275 3300053108 Ga0500562_006506 Ga0500562_006506_2055_2390 104
276 3300053111 Ga0500572_266937 Ga0500572_266937_92_424 104
277 3300053118 Ga0500594_0000288 Ga0500594_0000288_2324_2659 104
278 3300053120 Ga0500597_084092 Ga0500597_084092_960_1289 104
279 3300053122 Ga0500608_203736 Ga0500608_203736_225_554 104
280 3300053125 Ga0500618_000071 Ga0500618_000071_57909_58238 104
281 3300053136 Ga0500559_0000031 Ga0500559_0000031_109180_109509 104
282 3300053136 Ga0500559_0002516 Ga0500559_0002516_6276_6608 104
283 3300053138 Ga0500564_000049 Ga0500564_000049_28512_28847 104
284 3300053138 Ga0500564_322173 Ga0500564_322173_41_373 104
285 3300053156 Ga0500622_0003337 Ga0500622_0003337_9058_9393 104
286 3300053156 Ga0500622_0011027 Ga0500622_0011027_1557_1907 104
287 3300053156 Ga0500622_0035340 Ga0500622_0035340_1934_2266 104
288 iso_pu_bacteria 2585428106 2587919581 104
289 iso_pu_bacteria 2643221640 2644226486 104
290 iso_pu_bacteria 2643221642 2644235974 104
291 iso_pu_bacteria 2791355048 2792459469 104
292 iso_pu_bacteria 2843744320 2843747193 104
293 iso_pu_bacteria 2849560528 2849560731 104
294 iso_pu_bacteria 2849573788 2849574252 104
295 iso_pu_bacteria 2851153111 2851158122 104
296 iso_pu_bacteria 2857504554 2857506801 104
297 iso_pu_bacteria 2898329390 2898330969 104
298 iso_pu_bacteria 2928531327 2928534004 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

14

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9402 1 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9312 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.9251 1 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.922 2 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.9056 2 104
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9261 1 97 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9171 1 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9064 2 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8621 2 97 3.30.70.100
af_Q9HDU7_108_202_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8 1 86 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1H6VP17-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) 0.966 1 104 GO:0005737
GO:0019301
GO:0062192
AF-A0A286FEJ6-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9647 2 104 GO:0005737
GO:0016857
GO:0019301
AF-B9TP76-F1-model_v4 L-rhamnose mutarotase 0.9629 2 104 GO:0005737
GO:0016857
GO:0019301
AF-A0A2U0XV16-F1-model_v4 deleted 0.9625 1 104
AF-A0A7U3ZIJ2-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9625 2 104 GO:0005737
GO:0016857
GO:0019301

Feature Viewer

pLDDT pTM Quality
94.79 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map