F394435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 216 | 277 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0192906|Ga0495638_0192906_554_904 |
| Length | 116 |
| Sequence | MSTQMGSTPTESRPLAFRMQLKPGVAAEYERRHDELWPDLAEALRNAGIHDYSIFLDEETMSLFAVLRLRPDHNKDALPLQPVMKRWWDYMADLMEVHPDNKPVEWPLKPVFYFEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 5 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 6 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 7 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 8 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 9 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 10 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 11 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 12 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 13 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 14 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 15 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 16 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 17 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 18 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 19 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 20 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 21 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 22 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 113 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 114 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 115 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 116 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 117 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 118 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 175 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 185 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 191 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 192 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 194 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 198 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 199 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 200 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 201 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 204 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 206 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 207 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 209 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 211 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 214 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 215 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.95 |
| Metatranscriptomes | 0 |
| Isolates | 7.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.52 |
| Nodule | 0 |
| Rhizoplane | 1.01 |
| Rhizosphere | 62.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1008424 | 3300002987 | Bacteria | 2831 |
| 2 | rootL2_10059714 | 3300003322 | Bacteria | 3325 |
| 3 | JGI25161J50226_1018642 | 3300003374 | Bacteria | 718 |
| 4 | Ga0055537_1000076 | 3300003773 | Bacteria | 70798 |
| 5 | Ga0055537_1000260 | 3300003773 | Bacteria | 38657 |
| 6 | Ga0055524_1019935 | 3300003775 | Bacteria | 2276 |
| 7 | Ga0055536_1003677 | 3300003781 | Bacteria | 8154 |
| 8 | Ga0055536_1004268 | 3300003781 | Bacteria | 7374 |
| 9 | Ga0055534_1000124 | 3300003784 | Bacteria | 57565 |
| 10 | Ga0055528_1000184 | 3300003790 | Bacteria | 52910 |
| 11 | Ga0055530_10002644 | 3300003791 | Bacteria | 11209 |
| 12 | Ga0055530_10005916 | 3300003791 | Bacteria | 5641 |
| 13 | Ga0055530_10071745 | 3300003791 | Bacteria | 745 |
| 14 | Ga0055531_10000743 | 3300003794 | Bacteria | 27461 |
| 15 | Ga0055531_10001300 | 3300003794 | Bacteria | 18805 |
| 16 | Ga0055531_10046624 | 3300003794 | Bacteria | 1189 |
| 17 | Ga0055543_1004162 | 3300004625 | Bacteria | 4017 |
| 18 | Ga0065165_1000003 | 3300005262 | Bacteria | 390701 |
| 19 | Ga0065165_1000906 | 3300005262 | Bacteria | 38225 |
| 20 | Ga0070677_10332421 | 3300005333 | Bacteria | 782 |
| 21 | Ga0070675_101056790 | 3300005354 | Bacteria | 746 |
| 22 | Ga0070659_100956480 | 3300005366 | Bacteria | 750 |
| 23 | Ga0070667_100407442 | 3300005367 | Bacteria | 1238 |
| 24 | Ga0070713_101787274 | 3300005436 | Bacteria | 597 |
| 25 | Ga0070662_100541745 | 3300005457 | Bacteria | 974 |
| 26 | Ga0070685_10034006 | 3300005466 | Bacteria | 2869 |
| 27 | Ga0070679_100418840 | 3300005530 | Bacteria | 1285 |
| 28 | Ga0070684_101419330 | 3300005535 | Bacteria | 654 |
| 29 | Ga0068853_100523465 | 3300005539 | Bacteria | 1121 |
| 30 | Ga0070665_100513504 | 3300005548 | Bacteria | 1210 |
| 31 | Ga0070664_100568771 | 3300005564 | Bacteria | 1049 |
| 32 | Ga0068857_101272580 | 3300005577 | Bacteria | 713 |
| 33 | Ga0068852_101623694 | 3300005616 | Bacteria | 669 |
| 34 | Ga0068864_101199651 | 3300005618 | Bacteria | 757 |
| 35 | Ga0075362_10124353 | 3300006177 | Bacteria | 1223 |
| 36 | Ga0075366_10053242 | 3300006195 | Bacteria | 2404 |
| 37 | Ga0075366_10584817 | 3300006195 | Bacteria | 692 |
| 38 | Ga0105240_12792996 | 3300009093 | Bacteria | 502 |
| 39 | Ga0105241_10089606 | 3300009174 | Bacteria | 2424 |
| 40 | Ga0105237_10703569 | 3300009545 | Bacteria | 1017 |
| 41 | Ga0105237_11264410 | 3300009545 | Unclassified | 744 |
| 42 | Ga0105238_10010174 | 3300009551 | Bacteria | 9434 |
| 43 | Ga0105239_11180562 | 3300010375 | Bacteria | 882 |
| 44 | Ga0157347_1006291 | 3300012502 | Bacteria | 1158 |
| 45 | Ga0157373_11537023 | 3300013100 | Unclassified | 509 |
| 46 | Ga0157371_10085562 | 3300013102 | Bacteria | 2233 |
| 47 | Ga0157371_10557496 | 3300013102 | Unclassified | 850 |
| 48 | Ga0157370_10035177 | 3300013104 | Bacteria | 4871 |
| 49 | Ga0157369_10186838 | 3300013105 | Bacteria | 2179 |
| 50 | Ga0157369_12399258 | 3300013105 | Bacteria | 534 |
| 51 | Ga0157378_10489283 | 3300013297 | Bacteria | 1227 |
| 52 | Ga0157372_10505562 | 3300013307 | Bacteria | 1409 |
| 53 | Ga0157372_11275366 | 3300013307 | Bacteria | 848 |
| 54 | Ga0157375_10225527 | 3300013308 | Bacteria | 2033 |
| 55 | Ga0157380_10538129 | 3300014326 | Bacteria | 1143 |
| 56 | Ga0182008_10371916 | 3300014497 | Bacteria | 762 |
| 57 | Ga0157379_10540196 | 3300014968 | Bacteria | 1084 |
| 58 | Ga0157376_11524088 | 3300014969 | Bacteria | 702 |
| 59 | Ga0163161_11202656 | 3300017792 | Bacteria | 655 |
| 60 | Ga0209436_111549 | 3300025208 | Bacteria | 1545 |
| 61 | Ga0209436_111557 | 3300025208 | Bacteria | 1544 |
| 62 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 63 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 64 | Ga0209130_1000036 | 3300025284 | Bacteria | 284111 |
| 65 | Ga0209130_1013336 | 3300025284 | Bacteria | 2108 |
| 66 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 67 | Ga0209675_1002720 | 3300025291 | Bacteria | 8856 |
| 68 | Ga0209676_1001012 | 3300025292 | Bacteria | 32874 |
| 69 | Ga0209564_1000144 | 3300025295 | Bacteria | 175328 |
| 70 | Ga0209564_1002536 | 3300025295 | Bacteria | 14094 |
| 71 | Ga0209564_1019060 | 3300025295 | Bacteria | 2582 |
| 72 | Ga0209758_1000835 | 3300025297 | Bacteria | 42973 |
| 73 | Ga0209050_1000633 | 3300025298 | Bacteria | 54643 |
| 74 | Ga0209050_1021138 | 3300025298 | Bacteria | 2386 |
| 75 | Ga0209256_1001475 | 3300025299 | Bacteria | 24067 |
| 76 | Ga0209256_1003732 | 3300025299 | Bacteria | 10307 |
| 77 | Ga0209256_1003816 | 3300025299 | Bacteria | 10095 |
| 78 | Ga0209256_1045830 | 3300025299 | Bacteria | 1085 |
| 79 | Ga0207426_1003756 | 3300025302 | Bacteria | 7920 |
| 80 | Ga0209257_1000223 | 3300025304 | Bacteria | 134337 |
| 81 | Ga0209257_1000506 | 3300025304 | Bacteria | 68402 |
| 82 | Ga0207705_10765892 | 3300025909 | Bacteria | 750 |
| 83 | Ga0207654_10046613 | 3300025911 | Bacteria | 2472 |
| 84 | Ga0207707_10133163 | 3300025912 | Bacteria | 2174 |
| 85 | Ga0207695_10430623 | 3300025913 | Unclassified | 1203 |
| 86 | Ga0207671_10155875 | 3300025914 | Bacteria | 1766 |
| 87 | Ga0207662_10185492 | 3300025918 | Bacteria | 1340 |
| 88 | Ga0207657_10537164 | 3300025919 | Bacteria | 915 |
| 89 | Ga0207694_10717942 | 3300025924 | Bacteria | 843 |
| 90 | Ga0207659_10736873 | 3300025926 | Bacteria | 845 |
| 91 | Ga0207669_11244769 | 3300025937 | Bacteria | 631 |
| 92 | Ga0207661_10435721 | 3300025944 | Bacteria | 1192 |
| 93 | Ga0207679_11206802 | 3300025945 | Bacteria | 694 |
| 94 | Ga0207678_10700615 | 3300026067 | Bacteria | 891 |
| 95 | Ga0207641_10542132 | 3300026088 | Bacteria | 1134 |
| 96 | Ga0207674_11764468 | 3300026116 | Bacteria | 586 |
| 97 | Ga0268266_10887590 | 3300028379 | Bacteria | 862 |
| 98 | Ga0307515_10016038 | 3300028794 | Bacteria | 13751 |
| 99 | Ga0307515_10022050 | 3300028794 | Bacteria | 11249 |
| 100 | Ga0307515_10059507 | 3300028794 | Bacteria | 5472 |
| 101 | Ga0265332_10095990 | 3300031238 | Bacteria | 1252 |
| 102 | Ga0265316_10160023 | 3300031344 | Bacteria | 1684 |
| 103 | Ga0265316_10507320 | 3300031344 | Bacteria | 861 |
| 104 | Ga0307509_10458974 | 3300031507 | Unclassified | 966 |
| 105 | Ga0307408_100004065 | 3300031548 | Bacteria | 9975 |
| 106 | Ga0307413_10216910 | 3300031824 | Bacteria | 1394 |
| 107 | Ga0307407_10096441 | 3300031903 | Bacteria | 1825 |
| 108 | Ga0307412_11311793 | 3300031911 | Bacteria | 652 |
| 109 | Ga0307409_100432674 | 3300031995 | Bacteria | 1265 |
| 110 | Ga0307409_101831464 | 3300031995 | Bacteria | 636 |
| 111 | Ga0307409_102081888 | 3300031995 | Unclassified | 597 |
| 112 | Ga0307416_100129112 | 3300032002 | Bacteria | 2271 |
| 113 | Ga0307414_10007852 | 3300032004 | Bacteria | 6017 |
| 114 | Ga0307411_10000141 | 3300032005 | Bacteria | 22602 |
| 115 | Ga0307411_10059091 | 3300032005 | Bacteria | 2540 |
| 116 | Ga0307411_10170656 | 3300032005 | Bacteria | 1640 |
| 117 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 118 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 119 | Ga0451804_0630534 | 3300041463 | Bacteria | 526 |
| 120 | Ga0451835_0719800 | 3300041492 | Bacteria | 572 |
| 121 | Ga0439432_128931 | 3300042006 | Bacteria | 747 |
| 122 | Ga0450897_039684 | 3300042128 | Bacteria | 552 |
| 123 | Ga0450898_067136 | 3300042134 | Bacteria | 713 |
| 124 | Ga0439446_0025215 | 3300042156 | Bacteria | 1699 |
| 125 | Ga0439434_0319194 | 3300042435 | Bacteria | 539 |
| 126 | Ga0439459_0021138 | 3300042438 | Bacteria | 1247 |
| 127 | Ga0466969_0003753 | 3300044656 | Bacteria | 8071 |
| 128 | Ga0466969_0004754 | 3300044656 | Bacteria | 7226 |
| 129 | Ga0466969_0490992 | 3300044656 | Bacteria | 560 |
| 130 | Ga0466972_0278302 | 3300044658 | Bacteria | 782 |
| 131 | Ga0466965_0215110 | 3300044683 | Bacteria | 1023 |
| 132 | Ga0466966_0000303 | 3300044684 | Bacteria | 32389 |
| 133 | Ga0466966_0052061 | 3300044684 | Unclassified | 2602 |
| 134 | Ga0466961_0000482 | 3300044693 | Bacteria | 25345 |
| 135 | Ga0466964_0018915 | 3300044706 | Bacteria | 2645 |
| 136 | Ga0466971_0001240 | 3300044719 | Bacteria | 10615 |
| 137 | Ga0466968_0035120 | 3300044735 | Bacteria | 2096 |
| 138 | Ga0466970_0000842 | 3300044765 | Bacteria | 14765 |
| 139 | Ga0466970_0378724 | 3300044765 | Unclassified | 805 |
| 140 | Ga0466957_0035011 | 3300044842 | Bacteria | 3013 |
| 141 | Ga0466957_0102538 | 3300044842 | Bacteria | 1805 |
| 142 | Ga0466959_0005862 | 3300045049 | Bacteria | 8458 |
| 143 | Ga0466959_0015139 | 3300045049 | Bacteria | 5617 |
| 144 | Ga0466959_0414058 | 3300045049 | Unclassified | 915 |
| 145 | Ga0466958_0105649 | 3300045836 | Bacteria | 1755 |
| 146 | Ga0495590_0001877 | 3300046457 | Bacteria | 8887 |
| 147 | Ga0495638_0000903 | 3300046460 | Bacteria | 30346 |
| 148 | Ga0495638_0010069 | 3300046460 | Bacteria | 6590 |
| 149 | Ga0495638_0012696 | 3300046460 | Bacteria | 5761 |
| 150 | Ga0495638_0065535 | 3300046460 | Bacteria | 2235 |
| 151 | Ga0495638_0066528 | 3300046460 | Bacteria | 2215 |
| 152 | Ga0495638_0192906 | 3300046460 | Bacteria | 1155 |
| 153 | Ga0495605_0216763 | 3300046474 | Bacteria | 828 |
| 154 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 155 | Ga0495585_0036368 | 3300046492 | Bacteria | 2778 |
| 156 | Ga0495596_0089209 | 3300046500 | Bacteria | 1196 |
| 157 | Ga0495607_0046161 | 3300046501 | Bacteria | 2560 |
| 158 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 159 | Ga0495606_0017850 | 3300046507 | Bacteria | 5344 |
| 160 | Ga0495606_0048640 | 3300046507 | Bacteria | 2787 |
| 161 | Ga0495606_0060830 | 3300046507 | Bacteria | 2417 |
| 162 | Ga0495606_0095735 | 3300046507 | Bacteria | 1817 |
| 163 | Ga0495610_0017631 | 3300046512 | Bacteria | 4064 |
| 164 | Ga0495610_0093120 | 3300046512 | Bacteria | 1362 |
| 165 | Ga0495610_0152715 | 3300046512 | Bacteria | 983 |
| 166 | Ga0495616_0001054 | 3300046513 | Bacteria | 19705 |
| 167 | Ga0495616_0001840 | 3300046513 | Bacteria | 14361 |
| 168 | Ga0495631_0016244 | 3300046518 | Bacteria | 3554 |
| 169 | Ga0495632_0014086 | 3300046519 | Bacteria | 4537 |
| 170 | Ga0495632_0026064 | 3300046519 | Bacteria | 3082 |
| 171 | Ga0495632_0034959 | 3300046519 | Bacteria | 2568 |
| 172 | Ga0495637_0002140 | 3300046520 | Bacteria | 11072 |
| 173 | Ga0495637_0025735 | 3300046520 | Bacteria | 2649 |
| 174 | Ga0495643_0052865 | 3300046522 | Bacteria | 2180 |
| 175 | Ga0495643_0055723 | 3300046522 | Bacteria | 2112 |
| 176 | Ga0495644_0025011 | 3300046523 | Bacteria | 2269 |
| 177 | Ga0495648_0000176 | 3300046524 | Bacteria | 73832 |
| 178 | Ga0495648_0306600 | 3300046524 | Bacteria | 741 |
| 179 | Ga0495666_0280042 | 3300046526 | Bacteria | 756 |
| 180 | Ga0495642_0172619 | 3300046528 | Bacteria | 939 |
| 181 | Ga0495654_0114649 | 3300046530 | Bacteria | 1226 |
| 182 | Ga0495587_0067524 | 3300046536 | Bacteria | 2084 |
| 183 | Ga0495609_0022398 | 3300046538 | Bacteria | 2910 |
| 184 | Ga0495597_0025563 | 3300046542 | Bacteria | 2717 |
| 185 | Ga0495597_0061600 | 3300046542 | Bacteria | 1634 |
| 186 | Ga0495597_0175499 | 3300046542 | Bacteria | 868 |
| 187 | Ga0495597_0248909 | 3300046542 | Bacteria | 699 |
| 188 | Ga0495645_0693160 | 3300046543 | Bacteria | 619 |
| 189 | Ga0495633_0495819 | 3300046558 | Bacteria | 551 |
| 190 | Ga0495633_0496256 | 3300046558 | Bacteria | 550 |
| 191 | Ga0495668_0001203 | 3300046616 | Bacteria | 26299 |
| 192 | Ga0495668_0007240 | 3300046616 | Bacteria | 7119 |
| 193 | Ga0495668_0091304 | 3300046616 | Bacteria | 1668 |
| 194 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 195 | Ga0495625_0001739 | 3300046660 | Bacteria | 25182 |
| 196 | Ga0495625_0007256 | 3300046660 | Bacteria | 9694 |
| 197 | Ga0495625_0156657 | 3300046660 | Bacteria | 1528 |
| 198 | Ga0495625_0159778 | 3300046660 | Bacteria | 1510 |
| 199 | Ga0495625_0274319 | 3300046660 | Bacteria | 1087 |
| 200 | Ga0495625_0302561 | 3300046660 | Bacteria | 1023 |
| 201 | Ga0495659_0306091 | 3300046664 | Bacteria | 672 |
| 202 | Ga0495659_0367339 | 3300046664 | Bacteria | 617 |
| 203 | Ga0495659_0530518 | 3300046664 | Bacteria | 518 |
| 204 | Ga0495661_0022755 | 3300046665 | Bacteria | 4074 |
| 205 | Ga0495670_0212811 | 3300046691 | Bacteria | 1025 |
| 206 | Ga0495671_0252121 | 3300046692 | Bacteria | 852 |
| 207 | Ga0495671_0361071 | 3300046692 | Bacteria | 696 |
| 208 | Ga0495589_0141187 | 3300046794 | Bacteria | 1153 |
| 209 | Ga0495660_0013064 | 3300046810 | Bacteria | 4813 |
| 210 | Ga0495683_0108721 | 3300047323 | Bacteria | 1325 |
| 211 | Ga0495675_0536188 | 3300047444 | Bacteria | 669 |
| 212 | Ga0495677_0006907 | 3300047445 | Bacteria | 4266 |
| 213 | Ga0495685_118811 | 3300047447 | Bacteria | 868 |
| 214 | Ga0495673_0000416 | 3300047469 | Bacteria | 49348 |
| 215 | Ga0495673_0030394 | 3300047469 | Bacteria | 2536 |
| 216 | Ga0495681_0015104 | 3300047470 | Bacteria | 4383 |
| 217 | Ga0495686_0001382 | 3300047472 | Bacteria | 26955 |
| 218 | Ga0495686_0320763 | 3300047472 | Bacteria | 849 |
| 219 | Ga0495626_0053287 | 3300048091 | Bacteria | 1862 |
| 220 | Ga0496102_0826390 | 3300048905 | Bacteria | 849 |
| 221 | Ga0496115_0858889 | 3300048918 | Bacteria | 702 |
| 222 | Ga0496117_0001963 | 3300048920 | Bacteria | 27350 |
| 223 | Ga0496118_0002437 | 3300048921 | Bacteria | 25046 |
| 224 | Ga0496118_0636958 | 3300048921 | Bacteria | 504 |
| 225 | Ga0496124_0012047 | 3300048927 | Bacteria | 8591 |
| 226 | Ga0496125_0102968 | 3300048928 | Bacteria | 2096 |
| 227 | Ga0496126_0118279 | 3300048929 | Bacteria | 2301 |
| 228 | Ga0496126_0126632 | 3300048929 | Bacteria | 2210 |
| 229 | Ga0496126_0281926 | 3300048929 | Bacteria | 1376 |
| 230 | Ga0495678_003164 | 3300049459 | Bacteria | 10386 |
| 231 | Ga0501033_0008295 | 3300049570 | Bacteria | 8047 |
| 232 | Ga0501034_0003706 | 3300049571 | Bacteria | 17261 |
| 233 | Ga0501037_0048607 | 3300049573 | Bacteria | 3107 |
| 234 | Ga0501038_0923760 | 3300049574 | Bacteria | 643 |
| 235 | Ga0501238_013337 | 3300049671 | Bacteria | 1118 |
| 236 | Ga0501262_035541 | 3300049759 | Bacteria | 730 |
| 237 | Ga0501044_0000796 | 3300049823 | Bacteria | 38157 |
| 238 | nmdc:mga03683_398908_c1 | 3300050489 | Bacteria | 656 |
| 239 | nmdc:mga0k408_468378_c1 | 3300050493 | Bacteria | 748 |
| 240 | nmdc:mga07m45_878183_c1 | 3300050496 | Bacteria | 513 |
| 241 | Ga0500578_0000389 | 3300053086 | Bacteria | 53879 |
| 242 | Ga0500578_0281793 | 3300053086 | Bacteria | 991 |
| 243 | Ga0500643_095326 | 3300053087 | Bacteria | 809 |
| 244 | Ga0500644_0000010 | 3300053088 | Bacteria | 127225 |
| 245 | Ga0500646_0349082 | 3300053090 | Bacteria | 539 |
| 246 | Ga0500583_0352434 | 3300053092 | Unclassified | 713 |
| 247 | Ga0500651_0354571 | 3300053093 | Bacteria | 832 |
| 248 | Ga0500641_0037405 | 3300053096 | Bacteria | 1946 |
| 249 | Ga0500650_0299482 | 3300053098 | Bacteria | 712 |
| 250 | Ga0500556_0001405 | 3300053104 | Bacteria | 10468 |
| 251 | Ga0500556_0085096 | 3300053104 | Bacteria | 1201 |
| 252 | Ga0500562_006506 | 3300053108 | Bacteria | 2943 |
| 253 | Ga0500572_266937 | 3300053111 | Bacteria | 555 |
| 254 | Ga0500594_0000288 | 3300053118 | Bacteria | 11527 |
| 255 | Ga0500597_084092 | 3300053120 | Bacteria | 1381 |
| 256 | Ga0500608_000006 | 3300053122 | Bacteria | 102722 |
| 257 | Ga0500608_203736 | 3300053122 | Bacteria | 815 |
| 258 | Ga0500618_000071 | 3300053125 | Bacteria | 85596 |
| 259 | Ga0500618_039362 | 3300053125 | Bacteria | 1089 |
| 260 | Ga0500642_0229961 | 3300053130 | Bacteria | 857 |
| 261 | Ga0500655_002640 | 3300053133 | Bacteria | 3247 |
| 262 | Ga0500658_0045005 | 3300053134 | Bacteria | 1783 |
| 263 | Ga0500559_0000031 | 3300053136 | Bacteria | 114782 |
| 264 | Ga0500559_0002516 | 3300053136 | Bacteria | 9415 |
| 265 | Ga0500564_000049 | 3300053138 | Bacteria | 30793 |
| 266 | Ga0500564_322173 | 3300053138 | Bacteria | 585 |
| 267 | Ga0500588_0027339 | 3300053146 | Bacteria | 1606 |
| 268 | Ga0500588_0048160 | 3300053146 | Bacteria | 1317 |
| 269 | Ga0500622_0003337 | 3300053156 | Bacteria | 10824 |
| 270 | Ga0500622_0006512 | 3300053156 | Bacteria | 6753 |
| 271 | Ga0500622_0011027 | 3300053156 | Bacteria | 4932 |
| 272 | Ga0500622_0035340 | 3300053156 | Bacteria | 2615 |
| 273 | Ga0500645_001497 | 3300053730 | Bacteria | 11708 |
| 274 | Ga0500609_000799 | 3300053731 | Bacteria | 4723 |
| 275 | Ga0500656_064297 | 3300053732 | Bacteria | 555 |
| 276 | Ga0500599_059278 | 3300053736 | Bacteria | 620 |
| 277 | Ga0466962_0031079 | 3300061719 | Bacteria | 2556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_11764468 | Ga0207674_117644681 | 83 |
| 2 | 3300006177 | Ga0075362_10124353 | Ga0075362_101243532 | 86 |
| 3 | 3300048928 | Ga0496125_0102968 | Ga0496125_0102968_569_904 | 86 |
| 4 | 3300048929 | Ga0496126_0126632 | Ga0496126_0126632_1201_1536 | 86 |
| 5 | 3300048929 | Ga0496126_0281926 | Ga0496126_0281926_576_911 | 86 |
| 6 | 3300050489 | nmdc:mga03683_398908_c1 | nmdc:mga03683_398908_c1_189_524 | 86 |
| 7 | 3300053122 | Ga0500608_000006 | Ga0500608_000006_10957_11292 | 86 |
| 8 | 3300053156 | Ga0500622_0006512 | Ga0500622_0006512_5964_6299 | 86 |
| 9 | 3300003781 | Ga0055536_1003677 | Ga0055536_10036775 | 87 |
| 10 | 3300003781 | Ga0055536_1004268 | Ga0055536_10042685 | 87 |
| 11 | 3300003791 | Ga0055530_10002644 | Ga0055530_100026446 | 87 |
| 12 | 3300003791 | Ga0055530_10005916 | Ga0055530_100059167 | 87 |
| 13 | 3300003794 | Ga0055531_10000743 | Ga0055531_1000074322 | 87 |
| 14 | 3300003794 | Ga0055531_10046624 | Ga0055531_100466242 | 87 |
| 15 | 3300025292 | Ga0209676_1001012 | Ga0209676_10010124 | 87 |
| 16 | 3300025298 | Ga0209050_1000633 | Ga0209050_10006334 | 87 |
| 17 | 3300025304 | Ga0209257_1000223 | Ga0209257_100022330 | 87 |
| 18 | 3300042438 | Ga0439459_0021138 | Ga0439459_0021138_19_351 | 87 |
| 19 | 3300044683 | Ga0466965_0215110 | Ga0466965_0215110_435_770 | 87 |
| 20 | 3300046460 | Ga0495638_0000903 | Ga0495638_0000903_2991_3326 | 87 |
| 21 | 3300048927 | Ga0496124_0012047 | Ga0496124_0012047_4526_4861 | 87 |
| 22 | 3300003794 | Ga0055531_10001300 | Ga0055531_100013003 | 88 |
| 23 | 3300012502 | Ga0157347_1006291 | Ga0157347_10062912 | 88 |
| 24 | 3300014326 | Ga0157380_10538129 | Ga0157380_105381292 | 88 |
| 25 | 3300014497 | Ga0182008_10371916 | Ga0182008_103719162 | 88 |
| 26 | 3300025304 | Ga0209257_1000506 | Ga0209257_10005067 | 88 |
| 27 | 3300041492 | Ga0451835_0719800 | Ga0451835_0719800_92_424 | 88 |
| 28 | 3300046460 | Ga0495638_0010069 | Ga0495638_0010069_5938_6270 | 88 |
| 29 | 3300046507 | Ga0495606_0060830 | Ga0495606_0060830_559_891 | 88 |
| 30 | 3300046512 | Ga0495610_0093120 | Ga0495610_0093120_250_579 | 88 |
| 31 | 3300046513 | Ga0495616_0001054 | Ga0495616_0001054_17852_18184 | 88 |
| 32 | 3300046519 | Ga0495632_0026064 | Ga0495632_0026064_1767_2102 | 88 |
| 33 | 3300046524 | Ga0495648_0306600 | Ga0495648_0306600_47_379 | 88 |
| 34 | 3300046542 | Ga0495597_0248909 | Ga0495597_0248909_170_499 | 88 |
| 35 | 3300046616 | Ga0495668_0091304 | Ga0495668_0091304_714_1046 | 88 |
| 36 | 3300046660 | Ga0495625_0156657 | Ga0495625_0156657_831_1163 | 88 |
| 37 | 3300046810 | Ga0495660_0013064 | Ga0495660_0013064_1231_1563 | 88 |
| 38 | 3300047470 | Ga0495681_0015104 | Ga0495681_0015104_3638_3970 | 88 |
| 39 | 3300048921 | Ga0496118_0636958 | Ga0496118_0636958_137_469 | 88 |
| 40 | 3300048929 | Ga0496126_0118279 | Ga0496126_0118279_1520_1852 | 88 |
| 41 | 3300053086 | Ga0500578_0281793 | Ga0500578_0281793_331_663 | 88 |
| 42 | 3300053104 | Ga0500556_0001405 | Ga0500556_0001405_7108_7437 | 88 |
| 43 | 3300053730 | Ga0500645_001497 | Ga0500645_001497_8401_8730 | 88 |
| 44 | 3300053731 | Ga0500609_000799 | Ga0500609_000799_3173_3505 | 88 |
| 45 | 3300025297 | Ga0209758_1000835 | Ga0209758_100083533 | 89 |
| 46 | 3300046660 | Ga0495625_0007256 | Ga0495625_0007256_6411_6743 | 89 |
| 47 | 3300047469 | Ga0495673_0030394 | Ga0495673_0030394_1035_1367 | 89 |
| 48 | 3300049671 | Ga0501238_013337 | Ga0501238_013337_456_788 | 89 |
| 49 | 3300053736 | Ga0500599_059278 | Ga0500599_059278_150_485 | 89 |
| 50 | 3300025295 | Ga0209564_1019060 | Ga0209564_10190602 | 91 |
| 51 | 3300025299 | Ga0209256_1045830 | Ga0209256_10458302 | 91 |
| 52 | 3300005616 | Ga0068852_101623694 | Ga0068852_1016236941 | 97 |
| 53 | 3300025913 | Ga0207695_10430623 | Ga0207695_104306233 | 97 |
| 54 | 3300046457 | Ga0495590_0001877 | Ga0495590_0001877_8562_8858 | 97 |
| 55 | 3300046460 | Ga0495638_0012696 | Ga0495638_0012696_4292_4585 | 97 |
| 56 | 3300046460 | Ga0495638_0066528 | Ga0495638_0066528_496_789 | 97 |
| 57 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_38703_38996 | 97 |
| 58 | 3300046513 | Ga0495616_0001840 | Ga0495616_0001840_3722_4015 | 97 |
| 59 | 3300046542 | Ga0495597_0025563 | Ga0495597_0025563_828_1121 | 97 |
| 60 | 3300046660 | Ga0495625_0001739 | Ga0495625_0001739_14582_14875 | 97 |
| 61 | 3300048905 | Ga0496102_0826390 | Ga0496102_0826390_460_756 | 97 |
| 62 | 3300049574 | Ga0501038_0923760 | Ga0501038_0923760_11_319 | 97 |
| 63 | 3300050496 | nmdc:mga07m45_878183_c1 | nmdc:mga07m45_878183_c1_74_367 | 97 |
| 64 | 3300053090 | Ga0500646_0349082 | Ga0500646_0349082_80_373 | 97 |
| 65 | 3300053092 | Ga0500583_0352434 | Ga0500583_0352434_387_680 | 97 |
| 66 | 3300053093 | Ga0500651_0354571 | Ga0500651_0354571_501_794 | 97 |
| 67 | 3300053104 | Ga0500556_0085096 | Ga0500556_0085096_556_849 | 97 |
| 68 | 3300053125 | Ga0500618_039362 | Ga0500618_039362_368_661 | 97 |
| 69 | 3300053130 | Ga0500642_0229961 | Ga0500642_0229961_124_417 | 97 |
| 70 | 3300053134 | Ga0500658_0045005 | Ga0500658_0045005_978_1271 | 97 |
| 71 | 3300053146 | Ga0500588_0027339 | Ga0500588_0027339_977_1270 | 97 |
| 72 | 3300053146 | Ga0500588_0048160 | Ga0500588_0048160_78_371 | 97 |
| 73 | 3300053732 | Ga0500656_064297 | Ga0500656_064297_186_479 | 97 |
| 74 | 3300005367 | Ga0070667_100407442 | Ga0070667_1004074422 | 102 |
| 75 | 3300005436 | Ga0070713_101787274 | Ga0070713_1017872742 | 102 |
| 76 | 3300005466 | Ga0070685_10034006 | Ga0070685_100340062 | 102 |
| 77 | 3300005530 | Ga0070679_100418840 | Ga0070679_1004188402 | 102 |
| 78 | 3300005535 | Ga0070684_101419330 | Ga0070684_1014193301 | 102 |
| 79 | 3300005539 | Ga0068853_100523465 | Ga0068853_1005234652 | 102 |
| 80 | 3300005564 | Ga0070664_100568771 | Ga0070664_1005687712 | 102 |
| 81 | 3300005577 | Ga0068857_101272580 | Ga0068857_1012725801 | 102 |
| 82 | 3300005618 | Ga0068864_101199651 | Ga0068864_1011996512 | 102 |
| 83 | 3300009093 | Ga0105240_12792996 | Ga0105240_127929962 | 102 |
| 84 | 3300009174 | Ga0105241_10089606 | Ga0105241_100896062 | 102 |
| 85 | 3300009545 | Ga0105237_10703569 | Ga0105237_107035691 | 102 |
| 86 | 3300009545 | Ga0105237_11264410 | Ga0105237_112644101 | 102 |
| 87 | 3300009551 | Ga0105238_10010174 | Ga0105238_100101744 | 102 |
| 88 | 3300010375 | Ga0105239_11180562 | Ga0105239_111805621 | 102 |
| 89 | 3300013100 | Ga0157373_11537023 | Ga0157373_115370231 | 102 |
| 90 | 3300013105 | Ga0157369_10186838 | Ga0157369_101868381 | 102 |
| 91 | 3300013307 | Ga0157372_10505562 | Ga0157372_105055622 | 102 |
| 92 | 3300025911 | Ga0207654_10046613 | Ga0207654_100466132 | 102 |
| 93 | 3300025912 | Ga0207707_10133163 | Ga0207707_101331632 | 102 |
| 94 | 3300025914 | Ga0207671_10155875 | Ga0207671_101558751 | 102 |
| 95 | 3300025918 | Ga0207662_10185492 | Ga0207662_101854922 | 102 |
| 96 | 3300025924 | Ga0207694_10717942 | Ga0207694_107179422 | 102 |
| 97 | 3300025937 | Ga0207669_11244769 | Ga0207669_112447692 | 102 |
| 98 | 3300025944 | Ga0207661_10435721 | Ga0207661_104357212 | 102 |
| 99 | 3300026088 | Ga0207641_10542132 | Ga0207641_105421321 | 102 |
| 100 | 3300031238 | Ga0265332_10095990 | Ga0265332_100959901 | 102 |
| 101 | 3300031344 | Ga0265316_10160023 | Ga0265316_101600232 | 102 |
| 102 | 3300031344 | Ga0265316_10507320 | Ga0265316_105073201 | 102 |
| 103 | 3300031507 | Ga0307509_10458974 | Ga0307509_104589742 | 102 |
| 104 | 3300031824 | Ga0307413_10216910 | Ga0307413_102169102 | 102 |
| 105 | 3300031903 | Ga0307407_10096441 | Ga0307407_100964413 | 102 |
| 106 | 3300031995 | Ga0307409_100432674 | Ga0307409_1004326742 | 102 |
| 107 | 3300031995 | Ga0307409_102081888 | Ga0307409_1020818881 | 102 |
| 108 | 3300032002 | Ga0307416_100129112 | Ga0307416_1001291121 | 102 |
| 109 | 3300032005 | Ga0307411_10059091 | Ga0307411_100590912 | 102 |
| 110 | 3300041463 | Ga0451804_0630534 | Ga0451804_0630534_191_502 | 102 |
| 111 | 3300044656 | Ga0466969_0003753 | Ga0466969_0003753_1799_2113 | 102 |
| 112 | 3300044656 | Ga0466969_0004754 | Ga0466969_0004754_6873_7187 | 102 |
| 113 | 3300044656 | Ga0466969_0490992 | Ga0466969_0490992_66_380 | 102 |
| 114 | 3300044658 | Ga0466972_0278302 | Ga0466972_0278302_215_529 | 102 |
| 115 | 3300044684 | Ga0466966_0000303 | Ga0466966_0000303_3399_3713 | 102 |
| 116 | 3300044684 | Ga0466966_0052061 | Ga0466966_0052061_2004_2318 | 102 |
| 117 | 3300044693 | Ga0466961_0000482 | Ga0466961_0000482_21501_21815 | 102 |
| 118 | 3300044706 | Ga0466964_0018915 | Ga0466964_0018915_969_1283 | 102 |
| 119 | 3300044719 | Ga0466971_0001240 | Ga0466971_0001240_7272_7586 | 102 |
| 120 | 3300044735 | Ga0466968_0035120 | Ga0466968_0035120_1624_1938 | 102 |
| 121 | 3300044765 | Ga0466970_0000842 | Ga0466970_0000842_5105_5419 | 102 |
| 122 | 3300044765 | Ga0466970_0378724 | Ga0466970_0378724_463_777 | 102 |
| 123 | 3300044842 | Ga0466957_0035011 | Ga0466957_0035011_400_714 | 102 |
| 124 | 3300044842 | Ga0466957_0102538 | Ga0466957_0102538_691_1005 | 102 |
| 125 | 3300045049 | Ga0466959_0005862 | Ga0466959_0005862_7728_8042 | 102 |
| 126 | 3300045049 | Ga0466959_0015139 | Ga0466959_0015139_4535_4849 | 102 |
| 127 | 3300045049 | Ga0466959_0414058 | Ga0466959_0414058_376_690 | 102 |
| 128 | 3300045836 | Ga0466958_0105649 | Ga0466958_0105649_289_603 | 102 |
| 129 | 3300048920 | Ga0496117_0001963 | Ga0496117_0001963_20256_20570 | 102 |
| 130 | 3300048921 | Ga0496118_0002437 | Ga0496118_0002437_11856_12170 | 102 |
| 131 | 3300053133 | Ga0500655_002640 | Ga0500655_002640_2156_2470 | 102 |
| 132 | 3300061719 | Ga0466962_0031079 | Ga0466962_0031079_1276_1590 | 102 |
| 133 | iso_pu_bacteria | 2582581279 | 2585146253 | 102 |
| 134 | 3300003791 | Ga0055530_10071745 | Ga0055530_100717451 | 103 |
| 135 | 3300013102 | Ga0157371_10085562 | Ga0157371_100855622 | 103 |
| 136 | 3300013102 | Ga0157371_10557496 | Ga0157371_105574962 | 103 |
| 137 | 3300013104 | Ga0157370_10035177 | Ga0157370_100351776 | 103 |
| 138 | 3300013105 | Ga0157369_12399258 | Ga0157369_123992582 | 103 |
| 139 | iso_pu_bacteria | 2582581280 | 2585155375 | 103 |
| 140 | iso_pu_bacteria | 2582581293 | 2585198939 | 103 |
| 141 | iso_pu_bacteria | 2643221545 | 2643748246 | 103 |
| 142 | iso_pu_bacteria | 2643221552 | 2643779061 | 103 |
| 143 | iso_pu_bacteria | 2643221583 | 2643926213 | 103 |
| 144 | iso_pu_bacteria | 2643221584 | 2643927628 | 103 |
| 145 | iso_pu_bacteria | 2643221691 | 2644508303 | 103 |
| 146 | iso_pu_bacteria | 2818991435 | 2819539568 | 103 |
| 147 | iso_pu_bacteria | 2818991454 | 2819648776 | 103 |
| 148 | 3300002987 | JGI25159J45721_1008424 | JGI25159J45721_10084243 | 104 |
| 149 | 3300003322 | rootL2_10059714 | rootL2_100597142 | 104 |
| 150 | 3300003374 | JGI25161J50226_1018642 | JGI25161J50226_10186421 | 104 |
| 151 | 3300003773 | Ga0055537_1000076 | Ga0055537_100007615 | 104 |
| 152 | 3300003773 | Ga0055537_1000260 | Ga0055537_10002608 | 104 |
| 153 | 3300003775 | Ga0055524_1019935 | Ga0055524_10199353 | 104 |
| 154 | 3300003784 | Ga0055534_1000124 | Ga0055534_100012423 | 104 |
| 155 | 3300003790 | Ga0055528_1000184 | Ga0055528_10001848 | 104 |
| 156 | 3300004625 | Ga0055543_1004162 | Ga0055543_10041622 | 104 |
| 157 | 3300005262 | Ga0065165_1000003 | Ga0065165_100000396 | 104 |
| 158 | 3300005262 | Ga0065165_1000906 | Ga0065165_10009068 | 104 |
| 159 | 3300005333 | Ga0070677_10332421 | Ga0070677_103324213 | 104 |
| 160 | 3300005354 | Ga0070675_101056790 | Ga0070675_1010567902 | 104 |
| 161 | 3300005366 | Ga0070659_100956480 | Ga0070659_1009564802 | 104 |
| 162 | 3300005457 | Ga0070662_100541745 | Ga0070662_1005417452 | 104 |
| 163 | 3300005548 | Ga0070665_100513504 | Ga0070665_1005135043 | 104 |
| 164 | 3300006195 | Ga0075366_10053242 | Ga0075366_100532422 | 104 |
| 165 | 3300006195 | Ga0075366_10584817 | Ga0075366_105848172 | 104 |
| 166 | 3300013297 | Ga0157378_10489283 | Ga0157378_104892832 | 104 |
| 167 | 3300013307 | Ga0157372_11275366 | Ga0157372_112753662 | 104 |
| 168 | 3300013308 | Ga0157375_10225527 | Ga0157375_102255272 | 104 |
| 169 | 3300014968 | Ga0157379_10540196 | Ga0157379_105401962 | 104 |
| 170 | 3300014969 | Ga0157376_11524088 | Ga0157376_115240882 | 104 |
| 171 | 3300017792 | Ga0163161_11202656 | Ga0163161_112026561 | 104 |
| 172 | 3300025208 | Ga0209436_111549 | Ga0209436_1115492 | 104 |
| 173 | 3300025208 | Ga0209436_111557 | Ga0209436_1115571 | 104 |
| 174 | 3300025263 | Ga0209565_1000018 | Ga0209565_1000018295 | 104 |
| 175 | 3300025273 | Ga0209673_1000006 | Ga0209673_1000006477 | 104 |
| 176 | 3300025284 | Ga0209130_1000036 | Ga0209130_1000036234 | 104 |
| 177 | 3300025284 | Ga0209130_1013336 | Ga0209130_10133362 | 104 |
| 178 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005295 | 104 |
| 179 | 3300025291 | Ga0209675_1002720 | Ga0209675_10027207 | 104 |
| 180 | 3300025295 | Ga0209564_1000144 | Ga0209564_100014433 | 104 |
| 181 | 3300025295 | Ga0209564_1002536 | Ga0209564_10025368 | 104 |
| 182 | 3300025298 | Ga0209050_1021138 | Ga0209050_10211383 | 104 |
| 183 | 3300025299 | Ga0209256_1001475 | Ga0209256_10014754 | 104 |
| 184 | 3300025299 | Ga0209256_1003732 | Ga0209256_10037324 | 104 |
| 185 | 3300025299 | Ga0209256_1003816 | Ga0209256_10038167 | 104 |
| 186 | 3300025302 | Ga0207426_1003756 | Ga0207426_10037564 | 104 |
| 187 | 3300025909 | Ga0207705_10765892 | Ga0207705_107658921 | 104 |
| 188 | 3300025919 | Ga0207657_10537164 | Ga0207657_105371642 | 104 |
| 189 | 3300025926 | Ga0207659_10736873 | Ga0207659_107368732 | 104 |
| 190 | 3300025945 | Ga0207679_11206802 | Ga0207679_112068022 | 104 |
| 191 | 3300026067 | Ga0207678_10700615 | Ga0207678_107006151 | 104 |
| 192 | 3300028379 | Ga0268266_10887590 | Ga0268266_108875902 | 104 |
| 193 | 3300028794 | Ga0307515_10016038 | Ga0307515_100160383 | 104 |
| 194 | 3300028794 | Ga0307515_10022050 | Ga0307515_100220502 | 104 |
| 195 | 3300028794 | Ga0307515_10059507 | Ga0307515_100595073 | 104 |
| 196 | 3300031548 | Ga0307408_100004065 | Ga0307408_1000040654 | 104 |
| 197 | 3300031911 | Ga0307412_11311793 | Ga0307412_113117932 | 104 |
| 198 | 3300031995 | Ga0307409_101831464 | Ga0307409_1018314642 | 104 |
| 199 | 3300032004 | Ga0307414_10007852 | Ga0307414_100078525 | 104 |
| 200 | 3300032005 | Ga0307411_10000141 | Ga0307411_1000014111 | 104 |
| 201 | 3300032005 | Ga0307411_10170656 | Ga0307411_101706562 | 104 |
| 202 | 3300037312 | Ga0395899_0000012 | Ga0395899_0000012_33049_33363 | 104 |
| 203 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_169361_169681 | 104 |
| 204 | 3300042006 | Ga0439432_128931 | Ga0439432_128931_10_324 | 104 |
| 205 | 3300042128 | Ga0450897_039684 | Ga0450897_039684_64_378 | 104 |
| 206 | 3300042134 | Ga0450898_067136 | Ga0450898_067136_203_517 | 104 |
| 207 | 3300042156 | Ga0439446_0025215 | Ga0439446_0025215_1071_1406 | 104 |
| 208 | 3300042435 | Ga0439434_0319194 | Ga0439434_0319194_194_529 | 104 |
| 209 | 3300046460 | Ga0495638_0065535 | Ga0495638_0065535_1308_1643 | 104 |
| 210 | 3300046460 | Ga0495638_0192906 | Ga0495638_0192906_554_904 | 104 |
| 211 | 3300046474 | Ga0495605_0216763 | Ga0495605_0216763_133_447 | 104 |
| 212 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_277649_277963 | 104 |
| 213 | 3300046492 | Ga0495585_0036368 | Ga0495585_0036368_523_855 | 104 |
| 214 | 3300046500 | Ga0495596_0089209 | Ga0495596_0089209_26_340 | 104 |
| 215 | 3300046501 | Ga0495607_0046161 | Ga0495607_0046161_42_356 | 104 |
| 216 | 3300046507 | Ga0495606_0017850 | Ga0495606_0017850_2651_2965 | 104 |
| 217 | 3300046507 | Ga0495606_0048640 | Ga0495606_0048640_1802_2152 | 104 |
| 218 | 3300046507 | Ga0495606_0095735 | Ga0495606_0095735_715_1029 | 104 |
| 219 | 3300046512 | Ga0495610_0017631 | Ga0495610_0017631_2451_2786 | 104 |
| 220 | 3300046512 | Ga0495610_0152715 | Ga0495610_0152715_503_832 | 104 |
| 221 | 3300046518 | Ga0495631_0016244 | Ga0495631_0016244_1866_2201 | 104 |
| 222 | 3300046519 | Ga0495632_0014086 | Ga0495632_0014086_785_1099 | 104 |
| 223 | 3300046519 | Ga0495632_0034959 | Ga0495632_0034959_147_479 | 104 |
| 224 | 3300046520 | Ga0495637_0002140 | Ga0495637_0002140_5611_5940 | 104 |
| 225 | 3300046520 | Ga0495637_0025735 | Ga0495637_0025735_1255_1590 | 104 |
| 226 | 3300046522 | Ga0495643_0052865 | Ga0495643_0052865_998_1330 | 104 |
| 227 | 3300046522 | Ga0495643_0055723 | Ga0495643_0055723_1518_1832 | 104 |
| 228 | 3300046523 | Ga0495644_0025011 | Ga0495644_0025011_1839_2153 | 104 |
| 229 | 3300046524 | Ga0495648_0000176 | Ga0495648_0000176_17092_17427 | 104 |
| 230 | 3300046526 | Ga0495666_0280042 | Ga0495666_0280042_15_329 | 104 |
| 231 | 3300046528 | Ga0495642_0172619 | Ga0495642_0172619_334_648 | 104 |
| 232 | 3300046530 | Ga0495654_0114649 | Ga0495654_0114649_263_598 | 104 |
| 233 | 3300046536 | Ga0495587_0067524 | Ga0495587_0067524_1410_1724 | 104 |
| 234 | 3300046538 | Ga0495609_0022398 | Ga0495609_0022398_1813_2127 | 104 |
| 235 | 3300046542 | Ga0495597_0061600 | Ga0495597_0061600_1230_1580 | 104 |
| 236 | 3300046542 | Ga0495597_0175499 | Ga0495597_0175499_108_443 | 104 |
| 237 | 3300046543 | Ga0495645_0693160 | Ga0495645_0693160_93_407 | 104 |
| 238 | 3300046558 | Ga0495633_0495819 | Ga0495633_0495819_74_388 | 104 |
| 239 | 3300046558 | Ga0495633_0496256 | Ga0495633_0496256_84_419 | 104 |
| 240 | 3300046616 | Ga0495668_0001203 | Ga0495668_0001203_6012_6326 | 104 |
| 241 | 3300046616 | Ga0495668_0007240 | Ga0495668_0007240_2671_3006 | 104 |
| 242 | 3300046660 | Ga0495625_0000143 | Ga0495625_0000143_39431_39763 | 104 |
| 243 | 3300046660 | Ga0495625_0159778 | Ga0495625_0159778_179_529 | 104 |
| 244 | 3300046660 | Ga0495625_0274319 | Ga0495625_0274319_644_958 | 104 |
| 245 | 3300046660 | Ga0495625_0302561 | Ga0495625_0302561_499_834 | 104 |
| 246 | 3300046664 | Ga0495659_0306091 | Ga0495659_0306091_343_657 | 104 |
| 247 | 3300046664 | Ga0495659_0367339 | Ga0495659_0367339_150_482 | 104 |
| 248 | 3300046664 | Ga0495659_0530518 | Ga0495659_0530518_63_377 | 104 |
| 249 | 3300046665 | Ga0495661_0022755 | Ga0495661_0022755_1010_1324 | 104 |
| 250 | 3300046691 | Ga0495670_0212811 | Ga0495670_0212811_267_581 | 104 |
| 251 | 3300046692 | Ga0495671_0252121 | Ga0495671_0252121_76_390 | 104 |
| 252 | 3300046692 | Ga0495671_0361071 | Ga0495671_0361071_344_679 | 104 |
| 253 | 3300046794 | Ga0495589_0141187 | Ga0495589_0141187_497_811 | 104 |
| 254 | 3300047323 | Ga0495683_0108721 | Ga0495683_0108721_564_896 | 104 |
| 255 | 3300047444 | Ga0495675_0536188 | Ga0495675_0536188_22_336 | 104 |
| 256 | 3300047445 | Ga0495677_0006907 | Ga0495677_0006907_304_618 | 104 |
| 257 | 3300047447 | Ga0495685_118811 | Ga0495685_118811_228_542 | 104 |
| 258 | 3300047469 | Ga0495673_0000416 | Ga0495673_0000416_2266_2601 | 104 |
| 259 | 3300047472 | Ga0495686_0001382 | Ga0495686_0001382_25317_25652 | 104 |
| 260 | 3300047472 | Ga0495686_0320763 | Ga0495686_0320763_64_378 | 104 |
| 261 | 3300048091 | Ga0495626_0053287 | Ga0495626_0053287_1096_1410 | 104 |
| 262 | 3300048918 | Ga0496115_0858889 | Ga0496115_0858889_247_561 | 104 |
| 263 | 3300049459 | Ga0495678_003164 | Ga0495678_003164_5009_5344 | 104 |
| 264 | 3300049570 | Ga0501033_0008295 | Ga0501033_0008295_6838_7182 | 104 |
| 265 | 3300049571 | Ga0501034_0003706 | Ga0501034_0003706_6766_7110 | 104 |
| 266 | 3300049573 | Ga0501037_0048607 | Ga0501037_0048607_589_933 | 104 |
| 267 | 3300049759 | Ga0501262_035541 | Ga0501262_035541_26_358 | 104 |
| 268 | 3300049823 | Ga0501044_0000796 | Ga0501044_0000796_27547_27891 | 104 |
| 269 | 3300050493 | nmdc:mga0k408_468378_c1 | nmdc:mga0k408_468378_c1_71_406 | 104 |
| 270 | 3300053086 | Ga0500578_0000389 | Ga0500578_0000389_5030_5365 | 104 |
| 271 | 3300053087 | Ga0500643_095326 | Ga0500643_095326_267_599 | 104 |
| 272 | 3300053088 | Ga0500644_0000010 | Ga0500644_0000010_71283_71618 | 104 |
| 273 | 3300053096 | Ga0500641_0037405 | Ga0500641_0037405_94_429 | 104 |
| 274 | 3300053098 | Ga0500650_0299482 | Ga0500650_0299482_68_418 | 104 |
| 275 | 3300053108 | Ga0500562_006506 | Ga0500562_006506_2055_2390 | 104 |
| 276 | 3300053111 | Ga0500572_266937 | Ga0500572_266937_92_424 | 104 |
| 277 | 3300053118 | Ga0500594_0000288 | Ga0500594_0000288_2324_2659 | 104 |
| 278 | 3300053120 | Ga0500597_084092 | Ga0500597_084092_960_1289 | 104 |
| 279 | 3300053122 | Ga0500608_203736 | Ga0500608_203736_225_554 | 104 |
| 280 | 3300053125 | Ga0500618_000071 | Ga0500618_000071_57909_58238 | 104 |
| 281 | 3300053136 | Ga0500559_0000031 | Ga0500559_0000031_109180_109509 | 104 |
| 282 | 3300053136 | Ga0500559_0002516 | Ga0500559_0002516_6276_6608 | 104 |
| 283 | 3300053138 | Ga0500564_000049 | Ga0500564_000049_28512_28847 | 104 |
| 284 | 3300053138 | Ga0500564_322173 | Ga0500564_322173_41_373 | 104 |
| 285 | 3300053156 | Ga0500622_0003337 | Ga0500622_0003337_9058_9393 | 104 |
| 286 | 3300053156 | Ga0500622_0011027 | Ga0500622_0011027_1557_1907 | 104 |
| 287 | 3300053156 | Ga0500622_0035340 | Ga0500622_0035340_1934_2266 | 104 |
| 288 | iso_pu_bacteria | 2585428106 | 2587919581 | 104 |
| 289 | iso_pu_bacteria | 2643221640 | 2644226486 | 104 |
| 290 | iso_pu_bacteria | 2643221642 | 2644235974 | 104 |
| 291 | iso_pu_bacteria | 2791355048 | 2792459469 | 104 |
| 292 | iso_pu_bacteria | 2843744320 | 2843747193 | 104 |
| 293 | iso_pu_bacteria | 2849560528 | 2849560731 | 104 |
| 294 | iso_pu_bacteria | 2849573788 | 2849574252 | 104 |
| 295 | iso_pu_bacteria | 2851153111 | 2851158122 | 104 |
| 296 | iso_pu_bacteria | 2857504554 | 2857506801 | 104 |
| 297 | iso_pu_bacteria | 2898329390 | 2898330969 | 104 |
| 298 | iso_pu_bacteria | 2928531327 | 2928534004 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hhn-assembly1.cif.gz_A-2 | crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila | 0.9402 | 1 | 104 |
| 6hhn-assembly1.cif.gz_A-2 | crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila | 0.9312 | 1 | 104 |
| 1x8d-assembly2.cif.gz_D | crystal structure of e. coli yiil protein containing l-rhamnose | 0.9251 | 1 | 104 |
| 2qlw-assembly1.cif.gz_A | crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum | 0.922 | 2 | 104 |
| 2qlw-assembly1.cif.gz_A | crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum | 0.9056 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9261 | 1 | 97 | 3.30.70.100 |
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9171 | 1 | 97 | 3.30.70.100 |
| 2qlxB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9064 | 2 | 97 | 3.30.70.100 |
| 2qlxB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8621 | 2 | 97 | 3.30.70.100 |
| af_Q9HDU7_108_202_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8 | 1 | 86 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6VP17-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) | 0.966 | 1 | 104 |
GO:0005737
GO:0019301 GO:0062192 |
| AF-A0A286FEJ6-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) | 0.9647 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |
| AF-B9TP76-F1-model_v4 | L-rhamnose mutarotase | 0.9629 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |
| AF-A0A2U0XV16-F1-model_v4 | deleted | 0.9625 | 1 | 104 |
|
| AF-A0A7U3ZIJ2-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) | 0.9625 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar