F394321

General Info

Members Datasets Scaffolds Average Seq Length
298 173 596 465

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10052644|Ga0207428_100526443
Length 562
Sequence VIGNGLPVQIELSPGQMNDAPMAELLLNNLPAGADVIADKGYDADWIRELIEDQDCTPHIPPRSHRYDGITYSKAKYQKRNLIERCFNRLKQFRHIATRYDRSALNYLAMIKIASIPETMRVDYYHTGDVKSEVFSLDRVVIEPLPWPGNLSQSIDKSNYGKYFFEVRDQKTKNLLYSRGFASIYGEWETTDEAKTMTRTFQESFRFPAPTSTFEIVLKKRDAKNVFHDVWTTTIDPQNQFVDRSKPATPAPVLVIQKAGNPETKVDFLILGDGYTAAEAKKFEADAKRLTEVLFSTSPFKENRNRFNVWAIAPPAAESGISRPSTGIYRDSPLGATYDAFGSERYVLSFDNRALRKTAQFAPYEFIEILANNRTYGGGGIFNLYSTVASDNAFANYVFVHEFGHHFAGLADEYYTSSVAYAPAADRVEPWEPNATALLDVSTLKWRDLVSPFANVTPIPTPWNKEAFETYSREIQKRRAQLRKDKRPEEEMEALFREELAHEKEMFAKEKHAGQVGAFEGAMYEARGYYRPEIDCIMFSRTDKFCKVCRRAIEQVIRMYST

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.01
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 12.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10052644 3300027907 Bacteria 3250
2 JGI24748J21848_1000011 3300002074 Bacteria 157004
3 JGI24034J26672_10000023 3300002239 Bacteria 115999
4 JGI25406J46586_10009670 3300003203 Bacteria 4311
5 rootL2_10210432 3300003322 Unclassified 2084
6 Ga0065714_10002455 3300005288 Bacteria 16988
7 Ga0065712_10068020 3300005290 Bacteria 16989
8 Ga0065712_10089997 3300005290 Bacteria 2436
9 Ga0065715_10008158 3300005293 Bacteria 2921
10 Ga0065715_10089192 3300005293 Bacteria 12856
11 Ga0065715_10104019 3300005293 Bacteria 2991
12 Ga0070676_10001648 3300005328 Bacteria 11366
13 Ga0070683_100249442 3300005329 Bacteria 1688
14 Ga0070670_100001320 3300005331 Bacteria 19814
15 Ga0070670_100052038 3300005331 Unclassified 3517
16 Ga0070670_100138328 3300005331 Unclassified 2105
17 Ga0068869_100014702 3300005334 Bacteria 5235
18 Ga0070680_100007882 3300005336 Bacteria 8121
19 Ga0070682_100001867 3300005337 Bacteria 11755
20 Ga0070682_100002161 3300005337 Bacteria 10914
21 Ga0068868_100015113 3300005338 Bacteria 5703
22 Ga0068868_100071753 3300005338 Bacteria 2762
23 Ga0070689_100000888 3300005340 Bacteria 18656
24 Ga0070689_100005782 3300005340 Bacteria 8483
25 Ga0070689_100012310 3300005340 Bacteria 6158
26 Ga0070687_100040024 3300005343 Unclassified 2360
27 Ga0070668_100002891 3300005347 Bacteria 12673
28 Ga0070669_100007285 3300005353 Bacteria 7935
29 Ga0070669_100126998 3300005353 Bacteria 1952
30 Ga0070671_100096099 3300005355 Bacteria 2484
31 Ga0070673_100013926 3300005364 Bacteria 5584
32 Ga0070673_100018904 3300005364 Unclassified 4938
33 Ga0070673_100133282 3300005364 Bacteria 2088
34 Ga0070688_100002766 3300005365 Bacteria 8912
35 Ga0070667_100158003 3300005367 Bacteria 1995
36 Ga0070703_10000076 3300005406 Bacteria 49154
37 Ga0070703_10010808 3300005406 Unclassified 2575
38 Ga0070703_10021112 3300005406 Bacteria 1901
39 Ga0070701_10030243 3300005438 Bacteria 2678
40 Ga0070705_100019504 3300005440 Unclassified 3570
41 Ga0070700_100000227 3300005441 Bacteria 31044
42 Ga0070700_100014135 3300005441 Unclassified 4504
43 Ga0070700_100025437 3300005441 Bacteria 3485
44 Ga0070700_100039259 3300005441 Bacteria 2891
45 Ga0070662_100005555 3300005457 Bacteria 8058
46 Ga0070681_10004109 3300005458 Bacteria 13760
47 Ga0070681_10004943 3300005458 Bacteria 12818
48 Ga0070681_10053308 3300005458 Bacteria 4030
49 Ga0068867_100014191 3300005459 Bacteria 5643
50 Ga0070685_10002480 3300005466 Bacteria 9478
51 Ga0070706_100000250 3300005467 Bacteria 65288
52 Ga0070706_100011797 3300005467 Bacteria 8112
53 Ga0070707_100000089 3300005468 Bacteria 82091
54 Ga0070707_100071598 3300005468 Bacteria 3340
55 Ga0070698_100000060 3300005471 Bacteria 78692
56 Ga0070698_100000485 3300005471 Bacteria 42212
57 Ga0070698_100020252 3300005471 Bacteria 6973
58 Ga0070698_100076027 3300005471 Bacteria 3361
59 Ga0070698_100080683 3300005471 Bacteria 3248
60 Ga0070698_100157505 3300005471 Unclassified 2216
61 Ga0070699_100003140 3300005518 Bacteria 14618
62 Ga0070699_100096215 3300005518 Bacteria 2593
63 Ga0070699_100270317 3300005518 Bacteria 1521
64 Ga0070679_100001869 3300005530 Bacteria 18946
65 Ga0070679_100210183 3300005530 Bacteria 1910
66 Ga0070684_100150899 3300005535 Unclassified 2105
67 Ga0070697_100011990 3300005536 Bacteria 6783
68 Ga0070697_100019480 3300005536 Bacteria 5360
69 Ga0068853_100008257 3300005539 Bacteria 8357
70 Ga0068853_100014453 3300005539 Bacteria 6464
71 Ga0068853_100070304 3300005539 Bacteria 3046
72 Ga0070686_100010707 3300005544 Bacteria 5183
73 Ga0070695_100147453 3300005545 Unclassified 1638
74 Ga0070696_100007985 3300005546 Bacteria 7066
75 Ga0070696_100042636 3300005546 Bacteria 3136
76 Ga0070696_100070247 3300005546 Bacteria 2463
77 Ga0070693_100020362 3300005547 Bacteria 3497
78 Ga0070693_100045631 3300005547 Bacteria 2485
79 Ga0070704_100000859 3300005549 Bacteria 15201
80 Ga0070704_100018042 3300005549 Unclassified 4502
81 Ga0068857_100012652 3300005577 Bacteria 7351
82 Ga0068854_100023476 3300005578 Unclassified 4214
83 Ga0068856_100007891 3300005614 Bacteria 10395
84 Ga0070702_100011681 3300005615 Bacteria 4374
85 Ga0070702_100015863 3300005615 Unclassified 3855
86 Ga0070702_100051139 3300005615 Unclassified 2364
87 Ga0068852_100014300 3300005616 Bacteria 6104
88 Ga0068852_100173791 3300005616 Bacteria 2021
89 Ga0068859_100006254 3300005617 Bacteria 12081
90 Ga0068859_100009280 3300005617 Bacteria 9932
91 Ga0068859_100026492 3300005617 Bacteria 5815
92 Ga0068859_100082553 3300005617 Bacteria 3257
93 Ga0068859_100274469 3300005617 Bacteria 1778
94 Ga0068861_100001326 3300005719 Bacteria 15515
95 Ga0068861_100009342 3300005719 Bacteria 6768
96 Ga0068861_100098510 3300005719 Bacteria 2321
97 Ga0068851_10001092 3300005834 Bacteria 11773
98 Ga0068863_100027596 3300005841 Bacteria 5416
99 Ga0068858_100000253 3300005842 Bacteria 57137
100 Ga0068858_100084363 3300005842 Unclassified 2955
101 Ga0068860_100024162 3300005843 Bacteria 5876
102 Ga0068860_100055840 3300005843 Unclassified 3754
103 Ga0068862_100005387 3300005844 Bacteria 10703
104 Ga0068862_100024442 3300005844 Bacteria 5070
105 Ga0081539_10000119 3300005985 Bacteria 184136
106 Ga0081539_10006928 3300005985 Bacteria 10551
107 Ga0081539_10066550 3300005985 Bacteria 1952
108 Ga0070716_100021005 3300006173 Bacteria 3435
109 Ga0097621_100002411 3300006237 Bacteria 12807
110 Ga0068871_100002790 3300006358 Bacteria 11941
111 Ga0068871_100010037 3300006358 Bacteria 6885
112 Ga0075428_100322248 3300006844 Unclassified 1660
113 Ga0075428_100370354 3300006844 Bacteria 1536
114 Ga0075430_100047846 3300006846 Bacteria 3611
115 Ga0075433_10014144 3300006852 Bacteria 6511
116 Ga0075433_10017347 3300006852 Bacteria 5962
117 Ga0075433_10101004 3300006852 Bacteria 2554
118 Ga0075434_100100548 3300006871 Bacteria 2898
119 Ga0075434_100114252 3300006871 Bacteria 2713
120 Ga0075429_100053522 3300006880 Unclassified 3512
121 Ga0068865_100011664 3300006881 Bacteria 5506
122 Ga0075436_100000022 3300006914 Bacteria 117346
123 Ga0075436_100050090 3300006914 Bacteria 2882
124 Ga0097620_100006254 3300006931 Bacteria 12081
125 Ga0097620_100008632 3300006931 Bacteria 10296
126 Ga0097620_100009280 3300006931 Bacteria 9932
127 Ga0097620_100026492 3300006931 Bacteria 5815
128 Ga0097620_100075105 3300006931 Bacteria 3420
129 Ga0097620_100082553 3300006931 Bacteria 3257
130 Ga0097620_100201961 3300006931 Bacteria 2072
131 Ga0097620_100274452 3300006931 Bacteria 1778
132 Ga0075435_100000296 3300007076 Bacteria 30867
133 Ga0105250_10019770 3300009092 Unclassified 2724
134 Ga0105240_10091838 3300009093 Unclassified 3708
135 Ga0111539_10001485 3300009094 Bacteria 31320
136 Ga0111539_10008226 3300009094 Bacteria 13275
137 Ga0111539_10034097 3300009094 Bacteria 6176
138 Ga0105245_10005571 3300009098 Bacteria 11066
139 Ga0105247_10000003 3300009101 Bacteria 694517
140 Ga0105247_10001690 3300009101 Bacteria 15567
141 Ga0105243_10000436 3300009148 Bacteria 43715
142 Ga0105243_10002907 3300009148 Bacteria 14181
143 Ga0105243_10036314 3300009148 Bacteria 3825
144 Ga0105242_10003041 3300009176 Bacteria 13109
145 Ga0105242_10006286 3300009176 Bacteria 9153
146 Ga0105248_10001687 3300009177 Bacteria 24588
147 Ga0105248_10158902 3300009177 Bacteria 2550
148 Ga0105248_10305358 3300009177 Bacteria 1792
149 Ga0105238_10005977 3300009551 Bacteria 12070
150 Ga0105249_10002544 3300009553 Bacteria 15785
151 Ga0105249_10043331 3300009553 Bacteria 4093
152 Ga0105239_10005155 3300010375 Bacteria 15426
153 Ga0105239_10019976 3300010375 Bacteria 7393
154 Ga0105246_10002563 3300011119 Bacteria 10988
155 Ga0157373_10006135 3300013100 Bacteria 8986
156 Ga0157369_10038646 3300013105 Bacteria 5218
157 Ga0157378_10000379 3300013297 Bacteria 43998
158 Ga0157378_10003219 3300013297 Bacteria 14522
159 Ga0157378_10006127 3300013297 Bacteria 10532
160 Ga0157378_10042272 3300013297 Bacteria 4045
161 Ga0157378_10083405 3300013297 Bacteria 2892
162 Ga0157378_10161505 3300013297 Unclassified 2096
163 Ga0163162_10022678 3300013306 Bacteria 6189
164 Ga0163162_10048880 3300013306 Bacteria 4238
165 Ga0157372_10018479 3300013307 Bacteria 7494
166 Ga0157372_10025360 3300013307 Bacteria 6445
167 Ga0163163_10002855 3300014325 Bacteria 14601
168 Ga0157380_10049252 3300014326 Bacteria 3322
169 Ga0157380_10156633 3300014326 Bacteria 1975
170 Ga0182008_10006713 3300014497 Bacteria 6406
171 Ga0157377_10028409 3300014745 Unclassified 3010
172 Ga0157379_10060824 3300014968 Bacteria 3377
173 Ga0163161_10009306 3300017792 Bacteria 6796
174 Ga0213876_10000484 3300021384 Bacteria 31478
175 Ga0207672_1000182 3300025223 Bacteria 8793
176 Ga0207653_10000098 3300025885 Bacteria 63247
177 Ga0207653_10013639 3300025885 Unclassified 2545
178 Ga0207682_10000826 3300025893 Bacteria 14304
179 Ga0207710_10000001 3300025900 Bacteria 1797433
180 Ga0207688_10005996 3300025901 Bacteria 6613
181 Ga0207680_10048006 3300025903 Bacteria 2533
182 Ga0207647_10004210 3300025904 Bacteria 10669
183 Ga0207647_10014905 3300025904 Bacteria 5342
184 Ga0207645_10000559 3300025907 Bacteria 30910
185 Ga0207643_10001182 3300025908 Bacteria 15496
186 Ga0207643_10003638 3300025908 Bacteria 8306
187 Ga0207684_10000093 3300025910 Bacteria 166136
188 Ga0207684_10010087 3300025910 Bacteria 8320
189 Ga0207707_10000218 3300025912 Bacteria 61709
190 Ga0207671_10012824 3300025914 Bacteria 6715
191 Ga0207660_10002499 3300025917 Bacteria 12093
192 Ga0207662_10004599 3300025918 Bacteria 7276
193 Ga0207662_10058509 3300025918 Unclassified 2307
194 Ga0207657_10001795 3300025919 Bacteria 23148
195 Ga0207649_10000344 3300025920 Bacteria 35179
196 Ga0207652_10000066 3300025921 Bacteria 110924
197 Ga0207646_10000703 3300025922 Bacteria 43382
198 Ga0207646_10017418 3300025922 Bacteria 6724
199 Ga0207681_10003366 3300025923 Bacteria 10011
200 Ga0207681_10013155 3300025923 Bacteria 5115
201 Ga0207681_10077462 3300025923 Bacteria 2337
202 Ga0207650_10000058 3300025925 Bacteria 153056
203 Ga0207650_10001004 3300025925 Bacteria 21226
204 Ga0207650_10111674 3300025925 Bacteria 2117
205 Ga0207687_10010629 3300025927 Bacteria 6015
206 Ga0207644_10000284 3300025931 Bacteria 33398
207 Ga0207644_10004385 3300025931 Bacteria 9156
208 Ga0207644_10174344 3300025931 Bacteria 1681
209 Ga0207690_10017667 3300025932 Bacteria 4362
210 Ga0207690_10025475 3300025932 Unclassified 3715
211 Ga0207706_10000732 3300025933 Bacteria 34191
212 Ga0207706_10147181 3300025933 Bacteria 2072
213 Ga0207686_10002972 3300025934 Bacteria 9140
214 Ga0207686_10009307 3300025934 Bacteria 5328
215 Ga0207709_10000899 3300025935 Bacteria 22461
216 Ga0207709_10060287 3300025935 Bacteria 2365
217 Ga0207670_10000446 3300025936 Bacteria 23171
218 Ga0207665_10076584 3300025939 Unclassified 2294
219 Ga0207691_10016421 3300025940 Bacteria 7028
220 Ga0207711_10048031 3300025941 Bacteria 3651
221 Ga0207711_10054515 3300025941 Bacteria 3431
222 Ga0207689_10001703 3300025942 Bacteria 20842
223 Ga0207689_10002440 3300025942 Bacteria 17317
224 Ga0207689_10004393 3300025942 Bacteria 12815
225 Ga0207689_10022713 3300025942 Bacteria 5270
226 Ga0207661_10000328 3300025944 Bacteria 30179
227 Ga0207679_10000170 3300025945 Bacteria 53584
228 Ga0207651_10009423 3300025960 Bacteria 5346
229 Ga0207651_10011221 3300025960 Bacteria 5006
230 Ga0207651_10022266 3300025960 Bacteria 3871
231 Ga0207712_10096754 3300025961 Unclassified 2186
232 Ga0207712_10159519 3300025961 Bacteria 1751
233 Ga0207640_10094354 3300025981 Bacteria 2081
234 Ga0207658_10008582 3300025986 Bacteria 6953
235 Ga0207658_10037401 3300025986 Bacteria 3488
236 Ga0207677_10036587 3300026023 Unclassified 3201
237 Ga0207677_10039852 3300026023 Unclassified 3092
238 Ga0207677_10115146 3300026023 Bacteria 2011
239 Ga0207703_10000055 3300026035 Bacteria 143420
240 Ga0207703_10060369 3300026035 Bacteria 3100
241 Ga0207703_10160262 3300026035 Bacteria 1970
242 Ga0207639_10027631 3300026041 Unclassified 4135
243 Ga0207678_10001608 3300026067 Bacteria 20769
244 Ga0207708_10000031 3300026075 Bacteria 155478
245 Ga0207708_10046620 3300026075 Bacteria 3300
246 Ga0207708_10082456 3300026075 Bacteria 2472
247 Ga0207702_10057719 3300026078 Unclassified 3301
248 Ga0207641_10000323 3300026088 Bacteria 58693
249 Ga0207648_10000870 3300026089 Bacteria 34025
250 Ga0207676_10001412 3300026095 Bacteria 17835
251 Ga0207676_10013648 3300026095 Bacteria 5832
252 Ga0207676_10021744 3300026095 Bacteria 4708
253 Ga0207674_10000164 3300026116 Bacteria 79381
254 Ga0207675_100004377 3300026118 Bacteria 13653
255 Ga0207675_100012603 3300026118 Bacteria 7898
256 Ga0207675_100018291 3300026118 Bacteria 6533
257 Ga0207675_100122110 3300026118 Bacteria 2465
258 Ga0207683_10000493 3300026121 Bacteria 36475
259 Ga0207428_10001683 3300027907 Bacteria 22834
260 Ga0207428_10017195 3300027907 Bacteria 6212
261 Ga0207428_10064839 3300027907 Unclassified 2883
262 Ga0268266_10006414 3300028379 Bacteria 10777
263 Ga0268265_10002217 3300028380 Bacteria 14963
264 Ga0307408_100010126 3300031548 Bacteria 6217
265 Ga0307405_10090151 3300031731 Bacteria 2028
266 Ga0307406_10052079 3300031901 Bacteria 2602
267 Ga0307409_100045026 3300031995 Bacteria 3328
268 Ga0307416_100054501 3300032002 Bacteria 3215
269 Ga0307411_10007745 3300032005 Bacteria 5503
270 Ga0307415_100029586 3300032126 Bacteria 3503
271 Ga0436365_0665296 3300039437 Bacteria 181221
272 Ga0439458_0000633 3300042157 Bacteria 9115
273 Ga0439464_0041662 3300042439 Bacteria 1310
274 Ga0495672_0016615 3300047320 Bacteria 4952
275 Ga0496106_0011120 3300048909 Bacteria 6656
276 Ga0496108_0000444 3300048911 Bacteria 33175
277 Ga0496110_0017618 3300048913 Bacteria 5972
278 Ga0496111_0003868 3300048914 Bacteria 9362
279 Ga0496112_0000060 3300048915 Bacteria 74795
280 Ga0496113_0012324 3300048916 Bacteria 5743
281 Ga0501298_010375 3300049521 Bacteria 1603
282 Ga0501299_002678 3300049522 Bacteria 2490
283 Ga0501038_0005230 3300049574 Bacteria 12071
284 Ga0501048_0185866 3300049582 Bacteria 1473
285 Ga0501223_007976 3300049663 Unclassified 2160
286 Ga0501223_009180 3300049663 Bacteria 2008
287 Ga0501079_0144945 3300049741 Unclassified 1851
288 nmdc:mga05p37_297068_c1 3300050507 Bacteria 1920
289 nmdc:mga05p37_65474_c1 3300050507 Bacteria 4471
290 nmdc:mga09592_28837_c1 3300050508 Bacteria 4614
291 nmdc:mga08y16_159105_c1 3300050511 Bacteria 2347
292 nmdc:mga08y16_2895_c1 3300050511 Bacteria 17644
293 nmdc:mga08y16_76823_c1 3300050511 Bacteria 3481
294 nmdc:mga0rr50_108792_c1 3300050513 Unclassified 2190
295 nmdc:mga0rr50_645_c2 3300050513 Bacteria 16677
296 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
297 nmdc:mga08x19_39857_c1 3300050514 Bacteria 2987
298 nmdc:mga0a205_92401_c1 3300050515 Bacteria 2924
299 Ga0207428_10052644
300 JGI24748J21848_1000011
301 JGI24034J26672_10000023
302 JGI25406J46586_10009670
303 rootL2_10210432
304 Ga0065714_10002455
305 Ga0065712_10068020
306 Ga0065712_10089997
307 Ga0065715_10008158
308 Ga0065715_10089192
309 Ga0065715_10104019
310 Ga0070676_10001648
311 Ga0070683_100249442
312 Ga0070670_100001320
313 Ga0070670_100052038
314 Ga0070670_100138328
315 Ga0068869_100014702
316 Ga0070680_100007882
317 Ga0070682_100001867
318 Ga0070682_100002161
319 Ga0068868_100015113
320 Ga0068868_100071753
321 Ga0070689_100000888
322 Ga0070689_100005782
323 Ga0070689_100012310
324 Ga0070687_100040024
325 Ga0070668_100002891
326 Ga0070669_100007285
327 Ga0070669_100126998
328 Ga0070671_100096099
329 Ga0070673_100013926
330 Ga0070673_100018904
331 Ga0070673_100133282
332 Ga0070688_100002766
333 Ga0070667_100158003
334 Ga0070703_10000076
335 Ga0070703_10010808
336 Ga0070703_10021112
337 Ga0070701_10030243
338 Ga0070705_100019504
339 Ga0070700_100000227
340 Ga0070700_100014135
341 Ga0070700_100025437
342 Ga0070700_100039259
343 Ga0070662_100005555
344 Ga0070681_10004109
345 Ga0070681_10004943
346 Ga0070681_10053308
347 Ga0068867_100014191
348 Ga0070685_10002480
349 Ga0070706_100000250
350 Ga0070706_100011797
351 Ga0070707_100000089
352 Ga0070707_100071598
353 Ga0070698_100000060
354 Ga0070698_100000485
355 Ga0070698_100020252
356 Ga0070698_100076027
357 Ga0070698_100080683
358 Ga0070698_100157505
359 Ga0070699_100003140
360 Ga0070699_100096215
361 Ga0070699_100270317
362 Ga0070679_100001869
363 Ga0070679_100210183
364 Ga0070684_100150899
365 Ga0070697_100011990
366 Ga0070697_100019480
367 Ga0068853_100008257
368 Ga0068853_100014453
369 Ga0068853_100070304
370 Ga0070686_100010707
371 Ga0070695_100147453
372 Ga0070696_100007985
373 Ga0070696_100042636
374 Ga0070696_100070247
375 Ga0070693_100020362
376 Ga0070693_100045631
377 Ga0070704_100000859
378 Ga0070704_100018042
379 Ga0068857_100012652
380 Ga0068854_100023476
381 Ga0068856_100007891
382 Ga0070702_100011681
383 Ga0070702_100015863
384 Ga0070702_100051139
385 Ga0068852_100014300
386 Ga0068852_100173791
387 Ga0068859_100006254
388 Ga0068859_100009280
389 Ga0068859_100026492
390 Ga0068859_100082553
391 Ga0068859_100274469
392 Ga0068861_100001326
393 Ga0068861_100009342
394 Ga0068861_100098510
395 Ga0068851_10001092
396 Ga0068863_100027596
397 Ga0068858_100000253
398 Ga0068858_100084363
399 Ga0068860_100024162
400 Ga0068860_100055840
401 Ga0068862_100005387
402 Ga0068862_100024442
403 Ga0081539_10000119
404 Ga0081539_10006928
405 Ga0081539_10066550
406 Ga0070716_100021005
407 Ga0097621_100002411
408 Ga0068871_100002790
409 Ga0068871_100010037
410 Ga0075428_100322248
411 Ga0075428_100370354
412 Ga0075430_100047846
413 Ga0075433_10014144
414 Ga0075433_10017347
415 Ga0075433_10101004
416 Ga0075434_100100548
417 Ga0075434_100114252
418 Ga0075429_100053522
419 Ga0068865_100011664
420 Ga0075436_100000022
421 Ga0075436_100050090
422 Ga0097620_100006254
423 Ga0097620_100008632
424 Ga0097620_100009280
425 Ga0097620_100026492
426 Ga0097620_100075105
427 Ga0097620_100082553
428 Ga0097620_100201961
429 Ga0097620_100274452
430 Ga0075435_100000296
431 Ga0105250_10019770
432 Ga0105240_10091838
433 Ga0111539_10001485
434 Ga0111539_10008226
435 Ga0111539_10034097
436 Ga0105245_10005571
437 Ga0105247_10000003
438 Ga0105247_10001690
439 Ga0105243_10000436
440 Ga0105243_10002907
441 Ga0105243_10036314
442 Ga0105242_10003041
443 Ga0105242_10006286
444 Ga0105248_10001687
445 Ga0105248_10158902
446 Ga0105248_10305358
447 Ga0105238_10005977
448 Ga0105249_10002544
449 Ga0105249_10043331
450 Ga0105239_10005155
451 Ga0105239_10019976
452 Ga0105246_10002563
453 Ga0157373_10006135
454 Ga0157369_10038646
455 Ga0157378_10000379
456 Ga0157378_10003219
457 Ga0157378_10006127
458 Ga0157378_10042272
459 Ga0157378_10083405
460 Ga0157378_10161505
461 Ga0163162_10022678
462 Ga0163162_10048880
463 Ga0157372_10018479
464 Ga0157372_10025360
465 Ga0163163_10002855
466 Ga0157380_10049252
467 Ga0157380_10156633
468 Ga0182008_10006713
469 Ga0157377_10028409
470 Ga0157379_10060824
471 Ga0163161_10009306
472 Ga0213876_10000484
473 Ga0207672_1000182
474 Ga0207653_10000098
475 Ga0207653_10013639
476 Ga0207682_10000826
477 Ga0207710_10000001
478 Ga0207688_10005996
479 Ga0207680_10048006
480 Ga0207647_10004210
481 Ga0207647_10014905
482 Ga0207645_10000559
483 Ga0207643_10001182
484 Ga0207643_10003638
485 Ga0207684_10000093
486 Ga0207684_10010087
487 Ga0207707_10000218
488 Ga0207671_10012824
489 Ga0207660_10002499
490 Ga0207662_10004599
491 Ga0207662_10058509
492 Ga0207657_10001795
493 Ga0207649_10000344
494 Ga0207652_10000066
495 Ga0207646_10000703
496 Ga0207646_10017418
497 Ga0207681_10003366
498 Ga0207681_10013155
499 Ga0207681_10077462
500 Ga0207650_10000058
501 Ga0207650_10001004
502 Ga0207650_10111674
503 Ga0207687_10010629
504 Ga0207644_10000284
505 Ga0207644_10004385
506 Ga0207644_10174344
507 Ga0207690_10017667
508 Ga0207690_10025475
509 Ga0207706_10000732
510 Ga0207706_10147181
511 Ga0207686_10002972
512 Ga0207686_10009307
513 Ga0207709_10000899
514 Ga0207709_10060287
515 Ga0207670_10000446
516 Ga0207665_10076584
517 Ga0207691_10016421
518 Ga0207711_10048031
519 Ga0207711_10054515
520 Ga0207689_10001703
521 Ga0207689_10002440
522 Ga0207689_10004393
523 Ga0207689_10022713
524 Ga0207661_10000328
525 Ga0207679_10000170
526 Ga0207651_10009423
527 Ga0207651_10011221
528 Ga0207651_10022266
529 Ga0207712_10096754
530 Ga0207712_10159519
531 Ga0207640_10094354
532 Ga0207658_10008582
533 Ga0207658_10037401
534 Ga0207677_10036587
535 Ga0207677_10039852
536 Ga0207677_10115146
537 Ga0207703_10000055
538 Ga0207703_10060369
539 Ga0207703_10160262
540 Ga0207639_10027631
541 Ga0207678_10001608
542 Ga0207708_10000031
543 Ga0207708_10046620
544 Ga0207708_10082456
545 Ga0207702_10057719
546 Ga0207641_10000323
547 Ga0207648_10000870
548 Ga0207676_10001412
549 Ga0207676_10013648
550 Ga0207676_10021744
551 Ga0207674_10000164
552 Ga0207675_100004377
553 Ga0207675_100012603
554 Ga0207675_100018291
555 Ga0207675_100122110
556 Ga0207683_10000493
557 Ga0207428_10001683
558 Ga0207428_10017195
559 Ga0207428_10064839
560 Ga0268266_10006414
561 Ga0268265_10002217
562 Ga0307408_100010126
563 Ga0307405_10090151
564 Ga0307406_10052079
565 Ga0307409_100045026
566 Ga0307416_100054501
567 Ga0307411_10007745
568 Ga0307415_100029586
569 Ga0436365_0665296
570 Ga0439458_0000633
571 Ga0439464_0041662
572 Ga0495672_0016615
573 Ga0496106_0011120
574 Ga0496108_0000444
575 Ga0496110_0017618
576 Ga0496111_0003868
577 Ga0496112_0000060
578 Ga0496113_0012324
579 Ga0501298_010375
580 Ga0501299_002678
581 Ga0501038_0005230
582 Ga0501048_0185866
583 Ga0501223_007976
584 Ga0501223_009180
585 Ga0501079_0144945
586 nmdc:mga05p37_297068_c1
587 nmdc:mga05p37_65474_c1
588 nmdc:mga09592_28837_c1
589 nmdc:mga08y16_159105_c1
590 nmdc:mga08y16_2895_c1
591 nmdc:mga08y16_76823_c1
592 nmdc:mga0rr50_108792_c1
593 nmdc:mga0rr50_645_c2
594 nmdc:mga08x19_12_c1
595 nmdc:mga08x19_39857_c1
596 nmdc:mga0a205_92401_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09471

Peptidase_M64

IgA Peptidase M64

254

557

0.98

PF16217

M64_N

Peptidase M64 N-terminus

113

232

0.97

PF01609

DDE_Tnp_1

Transposase DDE domain

2

116

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4df9-assembly1.cif.gz_B crystal structure of a putative peptidase (bf3526) from bacteroides fragilis nctc 9343 at 2.17 a resolution 0.827 21 461
3p1v-assembly1.cif.gz_B crystal structure of a metallo-endopeptidases (bacova_00663) from bacteroides ovatus at 1.93 a resolution 0.8226 22 461
4df9-assembly2.cif.gz_C crystal structure of a putative peptidase (bf3526) from bacteroides fragilis nctc 9343 at 2.17 a resolution 0.8154 21 461
4df9-assembly2.cif.gz_D crystal structure of a putative peptidase (bf3526) from bacteroides fragilis nctc 9343 at 2.17 a resolution 0.8131 21 461
3p1v-assembly1.cif.gz_A crystal structure of a metallo-endopeptidases (bacova_00663) from bacteroides ovatus at 1.93 a resolution 0.8102 22 461
ID Description Score Start End Superfamily
4df9E01 Mainly Beta;Sandwich;Immunoglobulin-like;Peptidase M64, N-terminal domain 0.8655 21 150 2.60.40.3250
4df9E01 Mainly Beta;Sandwich;Immunoglobulin-like;Peptidase M64, N-terminal domain 0.8124 21 150 2.60.40.3250
af_Q5VQZ6_63_456_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.7829 114 139 2.120.10.10
3p1vB02 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7617 156 461 3.40.390.10
af_Q6DI92_12_320_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7529 116 145 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A838PEK4-F1-model_v4 Peptidase M64 0.9903 20 144
AF-A0A3D1VFR5-F1-model_v4 Gingipain domain-containing protein 0.9902 156 218 GO:0008237
AF-K1U331-F1-model_v4 DUF6273 domain-containing protein 0.9847 156 218 GO:0008237
AF-A0A7C4UHC5-F1-model_v4 Peptidase M64 0.9812 21 130
AF-A0A4Y8ICD7-F1-model_v4 Peptidase M64 0.9711 22 126

Map