F394027

General Info

Members Datasets Scaffolds Average Seq Length
298 207 596 271

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1003377|Ga0006562J51391_10033773
Length 305
Sequence VPTAIEIPSVVAQGAAVRPEEKSYKTVSRDQVEHMTKSSTSSTSSKWTGMVPVDDSALAVTDTGGPGIPVLYLNGQFATQGYWRRVIAELGTGWRHITYDERARGKSKRSADYSFEAAVRDIDAVLAARGVDRALVVGWSYGAVVGAHWAGRNPERALGAVLVDGAFPYDWLDEAMEQRIRKLFRRMSWFLPLLRPTGLAPRMTAEQQANSNIELGRLSRERELGPVLDSITVPVRYVVASGTSFGSRGDEQERIRTSLDAVTAHNLNIRISAKVAGNHGALLKKDFPAIAEAVREVAALDRGGR

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
20 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
21 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
22 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
28 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
43 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
44 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
152 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
153 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
161 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2643221549 Agromyces sp. Root1464 Isolate Unclassified
164 2643221597 Microbacterium sp. Root180 Isolate Unclassified
165 2643221616 Leifsonia sp. Root227 Isolate Unclassified
166 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
167 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
168 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
169 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
170 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
171 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
172 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
173 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
174 2808606372 Agromyces sp. 23-23 Isolate Unclassified
175 2808606394 Promicromonospora sp. C35 Isolate Unclassified
176 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
177 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
178 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
179 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
180 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
181 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
182 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
183 2858882152 Micromonospora noduli MED15 Isolate Nodule
184 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
185 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
186 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
187 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
188 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
189 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
190 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
191 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
192 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
193 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
194 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
195 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
196 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
197 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
198 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
199 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
200 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
201 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
202 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
203 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
204 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
205 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
206 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
207 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 0.34
Isolates 17.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 1.68
Rhizoplane 2.01
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1003377 3300003578 Bacteria 2683
2 JGI25165J46597_1000014 3300003214 Bacteria 390383
3 JGI25165J46597_1000125 3300003214 Bacteria 131155
4 Ga0070668_100006566 3300005347 Bacteria 8617
5 Ga0070709_10032129 3300005434 Bacteria 3163
6 Ga0070711_100284953 3300005439 Bacteria 1308
7 Ga0068856_100418197 3300005614 Bacteria 1360
8 Ga0081540_1009350 3300005983 Bacteria 6760
9 Ga0070717_10021690 3300006028 Bacteria 5065
10 Ga0075368_10018831 3300006042 Bacteria 2600
11 Ga0070712_100207133 3300006175 Bacteria 1544
12 Ga0075367_10101840 3300006178 Bacteria 1756
13 Ga0075428_100167662 3300006844 Bacteria 2382
14 Ga0075430_100350746 3300006846 Bacteria 1219
15 Ga0075431_100017134 3300006847 Bacteria 7365
16 Ga0075429_100416140 3300006880 Bacteria 1177
17 Ga0163163_10643967 3300014325 Bacteria 1123
18 Ga0182008_10012219 3300014497 Bacteria 4537
19 Ga0157376_10561719 3300014969 Bacteria 1131
20 Ga0207427_100039 3300025231 Bacteria 291576
21 Ga0209437_100441 3300025233 Bacteria 34752
22 Ga0209233_1000014 3300025261 Bacteria 996641
23 Ga0207699_10016019 3300025906 Bacteria 3910
24 Ga0207705_10505622 3300025909 Bacteria 939
25 Ga0207652_10148534 3300025921 Bacteria 2098
26 Ga0207665_10005348 3300025939 Bacteria 8576
27 Ga0207668_10032368 3300025972 Bacteria 3454
28 Ga0209813_10023338 3300027866 Bacteria 1758
29 Ga0307517_10006495 3300028786 Bacteria 17299
30 Ga0307515_10000218 3300028794 Bacteria 141810
31 Ga0307515_10060990 3300028794 Bacteria 5363
32 Ga0307515_10148417 3300028794 Bacteria 2467
33 Ga0307511_10002260 3300030521 Bacteria 20135
34 Ga0307511_10174329 3300030521 Bacteria 1174
35 Ga0307512_10028966 3300030522 Bacteria 4844
36 Ga0307512_10088755 3300030522 Bacteria 2167
37 Ga0316176_1134284 3300030732 Bacteria 2311
38 Ga0307513_10000005 3300031456 Bacteria 553227
39 Ga0307513_10049403 3300031456 Bacteria 4557
40 Ga0307513_10257289 3300031456 Bacteria 1538
41 Ga0307509_10005998 3300031507 Bacteria 16593
42 Ga0307509_10009838 3300031507 Bacteria 11836
43 Ga0307509_10325312 3300031507 Bacteria 1272
44 Ga0307508_10003454 3300031616 Bacteria 15993
45 Ga0307508_10026588 3300031616 Bacteria 5245
46 Ga0307508_10044786 3300031616 Bacteria 3956
47 Ga0307516_10016236 3300031730 Bacteria 7795
48 Ga0307518_10001373 3300031838 Bacteria 18095
49 Ga0307518_10022402 3300031838 Bacteria 4545
50 Ga0307409_100568368 3300031995 Bacteria 1116
51 Ga0307415_100054143 3300032126 Bacteria 2738
52 Ga0307507_10001421 3300033179 Bacteria 53691
53 Ga0307507_10160049 3300033179 Bacteria 1666
54 Ga0307510_10052167 3300033180 Bacteria 4316
55 Ga0373938_0022741 3300034957 Bacteria 1283
56 Ga0373940_0045337 3300035088 Bacteria 1220
57 Ga0373942_0002171 3300035207 Bacteria 4834
58 Ga0439465_0043020 3300041413 Bacteria 1465
59 Ga0451793_1165888 3300041452 Bacteria 1372
60 Ga0451853_2750619 3300041512 Bacteria 896
61 Ga0466969_0004300 3300044656 Bacteria 7576
62 Ga0466972_0025235 3300044658 Bacteria 2947
63 Ga0466972_0047506 3300044658 Bacteria 2076
64 Ga0466972_0114340 3300044658 Bacteria 1275
65 Ga0466966_0000483 3300044684 Bacteria 25573
66 Ga0466970_0104243 3300044765 Bacteria 1546
67 Ga0466960_0011966 3300044901 Bacteria 3649
68 Ga0466960_0038609 3300044901 Bacteria 2247
69 Ga0466960_0115607 3300044901 Bacteria 1399
70 Ga0466959_0031017 3300045049 Bacteria 3957
71 Ga0466967_0307122 3300045976 Bacteria 1527
72 Ga0495627_024706 3300046453 Bacteria 1957
73 Ga0495627_030193 3300046453 Bacteria 1719
74 Ga0495592_0001461 3300046454 Bacteria 16419
75 Ga0495603_0022600 3300046455 Bacteria 3806
76 Ga0495629_0005992 3300046459 Bacteria 9043
77 Ga0495629_0095713 3300046459 Bacteria 2071
78 Ga0495629_0149713 3300046459 Bacteria 1622
79 Ga0495629_0230691 3300046459 Bacteria 1276
80 Ga0495629_0497895 3300046459 Bacteria 822
81 Ga0495651_0002214 3300046462 Bacteria 15006
82 Ga0495605_0020956 3300046474 Bacteria 3469
83 Ga0495664_0056553 3300046477 Bacteria 2334
84 Ga0495585_0039450 3300046492 Bacteria 2654
85 Ga0495594_0000785 3300046499 Bacteria 16363
86 Ga0495594_0003603 3300046499 Bacteria 7963
87 Ga0495594_0014762 3300046499 Bacteria 4100
88 Ga0495594_0015897 3300046499 Bacteria 3958
89 Ga0495594_0287182 3300046499 Bacteria 937
90 Ga0495607_0182284 3300046501 Bacteria 1052
91 Ga0495583_0042411 3300046506 Bacteria 2125
92 Ga0495606_0055857 3300046507 Bacteria 2551
93 Ga0495608_0037770 3300046511 Bacteria 3247
94 Ga0495618_0003267 3300046514 Bacteria 10152
95 Ga0495620_0013173 3300046515 Bacteria 4242
96 Ga0495620_0085345 3300046515 Bacteria 1272
97 Ga0495628_0001676 3300046516 Bacteria 20224
98 Ga0495628_0140613 3300046516 Bacteria 1842
99 Ga0495632_0049186 3300046519 Bacteria 2085
100 Ga0495632_0074960 3300046519 Bacteria 1620
101 Ga0495643_0004347 3300046522 Bacteria 9941
102 Ga0495643_0020449 3300046522 Bacteria 3815
103 Ga0495648_0140708 3300046524 Bacteria 1270
104 Ga0495666_0030694 3300046526 Bacteria 2635
105 Ga0495652_0004392 3300046529 Bacteria 13484
106 Ga0495640_0035510 3300046533 Bacteria 3528
107 Ga0495609_0170875 3300046538 Bacteria 918
108 Ga0495597_0089474 3300046542 Bacteria 1308
109 Ga0495622_0015141 3300046557 Bacteria 3585
110 Ga0495622_0135799 3300046557 Bacteria 1118
111 Ga0495667_0071261 3300046559 Bacteria 2267
112 Ga0495668_0026490 3300046616 Bacteria 3289
113 Ga0495634_0058220 3300046642 Bacteria 2576
114 Ga0495611_0036394 3300046648 Bacteria 2184
115 Ga0495611_0072726 3300046648 Bacteria 1573
116 Ga0495611_0120142 3300046648 Bacteria 1225
117 Ga0495625_0229637 3300046660 Bacteria 1212
118 Ga0495625_0248433 3300046660 Bacteria 1155
119 Ga0495635_0006461 3300046663 Bacteria 8174
120 Ga0495588_0056736 3300046674 Bacteria 2022
121 Ga0495588_0081246 3300046674 Bacteria 1692
122 Ga0495657_0012313 3300046675 Bacteria 6356
123 Ga0495623_0009280 3300046679 Bacteria 6387
124 Ga0495623_0048387 3300046679 Bacteria 2697
125 Ga0495613_0011623 3300046689 Bacteria 6543
126 Ga0495613_0013388 3300046689 Bacteria 6093
127 Ga0495613_0068812 3300046689 Bacteria 2581
128 Ga0495613_0081009 3300046689 Bacteria 2359
129 Ga0495624_0036782 3300046690 Bacteria 3154
130 Ga0495624_0053953 3300046690 Bacteria 2536
131 Ga0495624_0084470 3300046690 Bacteria 1962
132 Ga0495649_0072363 3300046694 Bacteria 1848
133 Ga0495589_0063396 3300046794 Bacteria 1813
134 Ga0495589_0092790 3300046794 Bacteria 1465
135 Ga0495600_0039905 3300046809 Bacteria 3057
136 Ga0495600_0068225 3300046809 Bacteria 2324
137 Ga0495600_0068803 3300046809 Bacteria 2314
138 Ga0495660_0041103 3300046810 Bacteria 2561
139 Ga0495660_0109608 3300046810 Bacteria 1410
140 Ga0495581_0063392 3300047315 Bacteria 2136
141 Ga0495581_0169823 3300047315 Bacteria 1275
142 Ga0495604_0002832 3300047317 Bacteria 13914
143 Ga0495604_0121288 3300047317 Bacteria 1892
144 Ga0495604_0170099 3300047317 Bacteria 1533
145 Ga0495636_0027869 3300047318 Bacteria 2301
146 Ga0495636_0071377 3300047318 Bacteria 1483
147 Ga0495636_0190985 3300047318 Bacteria 932
148 Ga0495676_0001692 3300047321 Bacteria 19269
149 Ga0495676_0005435 3300047321 Bacteria 11685
150 Ga0495676_0184319 3300047321 Bacteria 1460
151 Ga0495680_0002437 3300047322 Bacteria 19036
152 Ga0495683_0051594 3300047323 Bacteria 2055
153 Ga0495683_0057921 3300047323 Bacteria 1925
154 Ga0495687_008187 3300047443 Bacteria 6024
155 Ga0495687_017867 3300047443 Bacteria 3521
156 Ga0495687_020151 3300047443 Bacteria 3256
157 Ga0495675_0066600 3300047444 Bacteria 2277
158 Ga0495675_0071221 3300047444 Bacteria 2194
159 Ga0495675_0151831 3300047444 Bacteria 1431
160 Ga0495677_0134421 3300047445 Bacteria 948
161 Ga0495685_001647 3300047447 Bacteria 6883
162 Ga0495685_077717 3300047447 Bacteria 1107
163 Ga0495685_125733 3300047447 Bacteria 840
164 Ga0495681_0003559 3300047470 Bacteria 10843
165 Ga0495593_0026773 3300047673 Bacteria 3180
166 Ga0495593_0084538 3300047673 Bacteria 1638
167 Ga0495614_0025374 3300048089 Bacteria 2556
168 Ga0495614_0035640 3300048089 Bacteria 2137
169 Ga0495614_0119305 3300048089 Bacteria 1162
170 Ga0496102_0085830 3300048905 Bacteria 2907
171 Ga0496102_0238018 3300048905 Bacteria 1717
172 Ga0496104_0010462 3300048907 Bacteria 8286
173 Ga0496105_0012082 3300048908 Bacteria 6837
174 Ga0496108_0220199 3300048911 Bacteria 1649
175 Ga0496117_0019671 3300048920 Bacteria 5534
176 Ga0496118_0003411 3300048921 Bacteria 20085
177 Ga0496126_0085816 3300048929 Bacteria 2775
178 Ga0495678_031507 3300049459 Bacteria 2210
179 Ga0501031_0000672 3300049568 Bacteria 20373
180 Ga0501031_0125241 3300049568 Bacteria 1679
181 Ga0501032_0000408 3300049569 Bacteria 35429
182 Ga0501032_0213344 3300049569 Bacteria 1258
183 Ga0501033_0106847 3300049570 Bacteria 2039
184 Ga0501034_0004186 3300049571 Bacteria 16102
185 Ga0501034_0020115 3300049571 Bacteria 6814
186 Ga0501034_0022710 3300049571 Bacteria 6390
187 Ga0501036_0002573 3300049572 Bacteria 14275
188 Ga0501037_0276268 3300049573 Bacteria 1171
189 Ga0501038_0000345 3300049574 Bacteria 39843
190 Ga0501038_0003104 3300049574 Bacteria 15496
191 Ga0501039_0004937 3300049575 Bacteria 10112
192 Ga0501039_0037441 3300049575 Bacteria 3744
193 Ga0501039_0123114 3300049575 Bacteria 2033
194 Ga0501042_0004116 3300049578 Bacteria 9239
195 Ga0501043_0005363 3300049579 Bacteria 10357
196 Ga0501043_0006078 3300049579 Bacteria 9699
197 Ga0501043_0132168 3300049579 Bacteria 1956
198 Ga0501043_0298141 3300049579 Bacteria 1232
199 Ga0501046_0000914 3300049580 Bacteria 28893
200 Ga0501047_0004060 3300049581 Bacteria 13762
201 Ga0501047_0010391 3300049581 Bacteria 8808
202 Ga0501047_0015741 3300049581 Bacteria 7208
203 Ga0501047_0135263 3300049581 Bacteria 2345
204 Ga0501048_0000126 3300049582 Bacteria 44703
205 Ga0501048_0006351 3300049582 Bacteria 8989
206 Ga0501067_0006442 3300049583 Bacteria 6504
207 Ga0501068_0089462 3300049584 Bacteria 1898
208 Ga0501069_0000824 3300049585 Bacteria 14643
209 Ga0501070_0013407 3300049586 Bacteria 6912
210 Ga0501071_0237490 3300049587 Bacteria 1374
211 Ga0501072_0217386 3300049588 Bacteria 1523
212 Ga0501073_0012597 3300049589 Bacteria 6170
213 Ga0501073_0018096 3300049589 Bacteria 5096
214 Ga0501074_0001349 3300049590 Bacteria 16261
215 Ga0501074_0031520 3300049590 Bacteria 3840
216 Ga0501080_0000390 3300049742 Bacteria 33829
217 Ga0501080_0095660 3300049742 Bacteria 2758
218 Ga0501080_0271223 3300049742 Bacteria 1544
219 Ga0501083_0000026 3300049744 Bacteria 119076
220 Ga0501083_0011673 3300049744 Bacteria 6159
221 Ga0501035_0120313 3300049822 Bacteria 2296
222 Ga0501035_0232638 3300049822 Bacteria 1570
223 Ga0501044_0006038 3300049823 Bacteria 13369
224 Ga0501044_0254311 3300049823 Bacteria 1696
225 Ga0501044_0336716 3300049823 Bacteria 1430
226 nmdc:mga06z11_27720_c2 3300050494 Bacteria 1845
227 nmdc:mga04h51_9560_c1 3300050495 Bacteria 2635
228 nmdc:mga0qj67_475867_c1 3300050509 Bacteria 1005
229 nmdc:mga06r32_53187_c1 3300050510 Bacteria 3879
230 Ga0500578_0011410 3300053086 Bacteria 5744
231 Ga0500644_0141497 3300053088 Bacteria 956
232 Ga0500583_0040310 3300053092 Bacteria 2115
233 Ga0500651_0046510 3300053093 Bacteria 2730
234 Ga0500641_0018709 3300053096 Bacteria 2610
235 Ga0500641_0023134 3300053096 Bacteria 2387
236 Ga0500650_0036836 3300053098 Bacteria 2246
237 Ga0500654_041837 3300053099 Bacteria 2591
238 Ga0500560_053331 3300053107 Bacteria 1303
239 Ga0500569_008409 3300053109 Bacteria 2359
240 Ga0500652_001758 3300053131 Bacteria 6570
241 Ga0500652_012508 3300053131 Bacteria 2980
242 Ga0500652_024402 3300053131 Bacteria 2308
243 Ga0500561_0000716 3300053137 Bacteria 5270
244 Ga0500568_0093714 3300053139 Bacteria 1131
245 Ga0500573_0029059 3300053140 Bacteria 3186
246 Ga0500634_0049302 3300053161 Bacteria 2270
247 Ga0501084_0051914 3300054114 Bacteria 3431
248 2554257690 2554235005 Bacteria 6457341
249 2586064678 2585427649 Bacteria 9053857
250 2616698032 2616644814 Bacteria 11555299
251 2643768944 2643221549 Bacteria 4042819
252 2643995328 2643221597 Bacteria 3347721
253 2644094582 2643221616 Bacteria 4066575
254 2644524644 2643221694 Bacteria 4392972
255 2644668730 2643221722 Bacteria 4247614
256 2676478829 2675903058 Bacteria 6822861
257 2738697701 2738541272 Bacteria 6848551
258 2739323799 2738543027 Bacteria 6409078
259 2739328252 2738543027 Bacteria 6409078
260 2739608633 2739367654 Bacteria 6049412
261 2760304973 2758568522 Bacteria 5953541
262 2760622220 2758568621 Bacteria 5967089
263 2808903623 2808606372 Bacteria 4649509
264 2809030377 2808606394 Bacteria 6248540
265 2816426808 2816332119 Bacteria 8120218
266 2827634261 2827628540 Bacteria 6858585
267 2839986399 2839986021 Bacteria 3685650
268 2855676553 2855670206 Bacteria 7120389
269 2855683397 2855676851 Bacteria 7063653
270 2857294987 2857288857 Bacteria 7189066
271 2858852151 2858848962 Bacteria 6963058
272 2858888333 2858882152 Bacteria 7230291
273 2858893248 2858888857 Bacteria 7060307
274 2858899091 2858895516 Bacteria 7378898
275 2861526835 2861520306 Bacteria 8348283
276 2869063835 2869061728 Bacteria 7112407
277 2869074568 2869068681 Bacteria 7205615
278 2880493981 2880489317 Bacteria 7096270
279 2880498359 2880495981 Bacteria 7340502
280 2887487025 2887478801 Bacteria 8972725
281 2915768522 2915768154 Bacteria 8424322
282 2929226944 2929226422 Bacteria 7248583
283 2946064362 2946064051 Bacteria 8957905
284 2947229357 2947224130 Bacteria 9938529
285 2995466059 2995463766 Bacteria 8577691
286 2996221942 2996221748 Bacteria 6799777
287 8001787826 8001781756 Bacteria 9586736
288 8001788353 8001781756 Bacteria 9586736
289 8003835788 8003830390 Bacteria 6541657
290 8003871620 8003870546 Bacteria 7396674
291 8025532207 8025530807 Bacteria 8495698
292 8054710068 8054704163 Bacteria 7247792
293 8054728283 8054727385 Bacteria 7558670
294 8054735326 8054734606 Bacteria 6947278
295 8056061602 8056060235 Bacteria 7259403
296 8056064953 8056060235 Bacteria 7259403
297 8056208842 8056207758 Bacteria 8639239
298 8056584994 8056579771 Bacteria 5840325
299 Ga0006562J51391_1003377
300 JGI25165J46597_1000014
301 JGI25165J46597_1000125
302 Ga0070668_100006566
303 Ga0070709_10032129
304 Ga0070711_100284953
305 Ga0068856_100418197
306 Ga0081540_1009350
307 Ga0070717_10021690
308 Ga0075368_10018831
309 Ga0070712_100207133
310 Ga0075367_10101840
311 Ga0075428_100167662
312 Ga0075430_100350746
313 Ga0075431_100017134
314 Ga0075429_100416140
315 Ga0163163_10643967
316 Ga0182008_10012219
317 Ga0157376_10561719
318 Ga0207427_100039
319 Ga0209437_100441
320 Ga0209233_1000014
321 Ga0207699_10016019
322 Ga0207705_10505622
323 Ga0207652_10148534
324 Ga0207665_10005348
325 Ga0207668_10032368
326 Ga0209813_10023338
327 Ga0307517_10006495
328 Ga0307515_10000218
329 Ga0307515_10060990
330 Ga0307515_10148417
331 Ga0307511_10002260
332 Ga0307511_10174329
333 Ga0307512_10028966
334 Ga0307512_10088755
335 Ga0316176_1134284
336 Ga0307513_10000005
337 Ga0307513_10049403
338 Ga0307513_10257289
339 Ga0307509_10005998
340 Ga0307509_10009838
341 Ga0307509_10325312
342 Ga0307508_10003454
343 Ga0307508_10026588
344 Ga0307508_10044786
345 Ga0307516_10016236
346 Ga0307518_10001373
347 Ga0307518_10022402
348 Ga0307409_100568368
349 Ga0307415_100054143
350 Ga0307507_10001421
351 Ga0307507_10160049
352 Ga0307510_10052167
353 Ga0373938_0022741
354 Ga0373940_0045337
355 Ga0373942_0002171
356 Ga0439465_0043020
357 Ga0451793_1165888
358 Ga0451853_2750619
359 Ga0466969_0004300
360 Ga0466972_0025235
361 Ga0466972_0047506
362 Ga0466972_0114340
363 Ga0466966_0000483
364 Ga0466970_0104243
365 Ga0466960_0011966
366 Ga0466960_0038609
367 Ga0466960_0115607
368 Ga0466959_0031017
369 Ga0466967_0307122
370 Ga0495627_024706
371 Ga0495627_030193
372 Ga0495592_0001461
373 Ga0495603_0022600
374 Ga0495629_0005992
375 Ga0495629_0095713
376 Ga0495629_0149713
377 Ga0495629_0230691
378 Ga0495629_0497895
379 Ga0495651_0002214
380 Ga0495605_0020956
381 Ga0495664_0056553
382 Ga0495585_0039450
383 Ga0495594_0000785
384 Ga0495594_0003603
385 Ga0495594_0014762
386 Ga0495594_0015897
387 Ga0495594_0287182
388 Ga0495607_0182284
389 Ga0495583_0042411
390 Ga0495606_0055857
391 Ga0495608_0037770
392 Ga0495618_0003267
393 Ga0495620_0013173
394 Ga0495620_0085345
395 Ga0495628_0001676
396 Ga0495628_0140613
397 Ga0495632_0049186
398 Ga0495632_0074960
399 Ga0495643_0004347
400 Ga0495643_0020449
401 Ga0495648_0140708
402 Ga0495666_0030694
403 Ga0495652_0004392
404 Ga0495640_0035510
405 Ga0495609_0170875
406 Ga0495597_0089474
407 Ga0495622_0015141
408 Ga0495622_0135799
409 Ga0495667_0071261
410 Ga0495668_0026490
411 Ga0495634_0058220
412 Ga0495611_0036394
413 Ga0495611_0072726
414 Ga0495611_0120142
415 Ga0495625_0229637
416 Ga0495625_0248433
417 Ga0495635_0006461
418 Ga0495588_0056736
419 Ga0495588_0081246
420 Ga0495657_0012313
421 Ga0495623_0009280
422 Ga0495623_0048387
423 Ga0495613_0011623
424 Ga0495613_0013388
425 Ga0495613_0068812
426 Ga0495613_0081009
427 Ga0495624_0036782
428 Ga0495624_0053953
429 Ga0495624_0084470
430 Ga0495649_0072363
431 Ga0495589_0063396
432 Ga0495589_0092790
433 Ga0495600_0039905
434 Ga0495600_0068225
435 Ga0495600_0068803
436 Ga0495660_0041103
437 Ga0495660_0109608
438 Ga0495581_0063392
439 Ga0495581_0169823
440 Ga0495604_0002832
441 Ga0495604_0121288
442 Ga0495604_0170099
443 Ga0495636_0027869
444 Ga0495636_0071377
445 Ga0495636_0190985
446 Ga0495676_0001692
447 Ga0495676_0005435
448 Ga0495676_0184319
449 Ga0495680_0002437
450 Ga0495683_0051594
451 Ga0495683_0057921
452 Ga0495687_008187
453 Ga0495687_017867
454 Ga0495687_020151
455 Ga0495675_0066600
456 Ga0495675_0071221
457 Ga0495675_0151831
458 Ga0495677_0134421
459 Ga0495685_001647
460 Ga0495685_077717
461 Ga0495685_125733
462 Ga0495681_0003559
463 Ga0495593_0026773
464 Ga0495593_0084538
465 Ga0495614_0025374
466 Ga0495614_0035640
467 Ga0495614_0119305
468 Ga0496102_0085830
469 Ga0496102_0238018
470 Ga0496104_0010462
471 Ga0496105_0012082
472 Ga0496108_0220199
473 Ga0496117_0019671
474 Ga0496118_0003411
475 Ga0496126_0085816
476 Ga0495678_031507
477 Ga0501031_0000672
478 Ga0501031_0125241
479 Ga0501032_0000408
480 Ga0501032_0213344
481 Ga0501033_0106847
482 Ga0501034_0004186
483 Ga0501034_0020115
484 Ga0501034_0022710
485 Ga0501036_0002573
486 Ga0501037_0276268
487 Ga0501038_0000345
488 Ga0501038_0003104
489 Ga0501039_0004937
490 Ga0501039_0037441
491 Ga0501039_0123114
492 Ga0501042_0004116
493 Ga0501043_0005363
494 Ga0501043_0006078
495 Ga0501043_0132168
496 Ga0501043_0298141
497 Ga0501046_0000914
498 Ga0501047_0004060
499 Ga0501047_0010391
500 Ga0501047_0015741
501 Ga0501047_0135263
502 Ga0501048_0000126
503 Ga0501048_0006351
504 Ga0501067_0006442
505 Ga0501068_0089462
506 Ga0501069_0000824
507 Ga0501070_0013407
508 Ga0501071_0237490
509 Ga0501072_0217386
510 Ga0501073_0012597
511 Ga0501073_0018096
512 Ga0501074_0001349
513 Ga0501074_0031520
514 Ga0501080_0000390
515 Ga0501080_0095660
516 Ga0501080_0271223
517 Ga0501083_0000026
518 Ga0501083_0011673
519 Ga0501035_0120313
520 Ga0501035_0232638
521 Ga0501044_0006038
522 Ga0501044_0254311
523 Ga0501044_0336716
524 nmdc:mga06z11_27720_c2
525 nmdc:mga04h51_9560_c1
526 nmdc:mga0qj67_475867_c1
527 nmdc:mga06r32_53187_c1
528 Ga0500578_0011410
529 Ga0500644_0141497
530 Ga0500583_0040310
531 Ga0500651_0046510
532 Ga0500641_0018709
533 Ga0500641_0023134
534 Ga0500650_0036836
535 Ga0500654_041837
536 Ga0500560_053331
537 Ga0500569_008409
538 Ga0500652_001758
539 Ga0500652_012508
540 Ga0500652_024402
541 Ga0500561_0000716
542 Ga0500568_0093714
543 Ga0500573_0029059
544 Ga0500634_0049302
545 Ga0501084_0051914
546 2554257690
547 2586064678
548 2616698032
549 2643768944
550 2643995328
551 2644094582
552 2644524644
553 2644668730
554 2676478829
555 2738697701
556 2739323799
557 2739328252
558 2739608633
559 2760304973
560 2760622220
561 2808903623
562 2809030377
563 2816426808
564 2827634261
565 2839986399
566 2855676553
567 2855683397
568 2857294987
569 2858852151
570 2858888333
571 2858893248
572 2858899091
573 2861526835
574 2869063835
575 2869074568
576 2880493981
577 2880498359
578 2887487025
579 2915768522
580 2929226944
581 2946064362
582 2947229357
583 2995466059
584 2996221942
585 8001787826
586 8001788353
587 8003835788
588 8003871620
589 8025532207
590 8054710068
591 8054728283
592 8054735326
593 8056061602
594 8056064953
595 8056208842
596 8056584994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

68

209

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

70

224

0.74

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

70

290

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8586 7 126
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8568 7 126
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8375 4 126
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8176 1 123
5ie5-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate a 0.7947 26 123
ID Description Score Start End Superfamily
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8238 26 135 3.40.50.1820
2wj4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8208 7 265 3.40.50.1820
2wj4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8062 7 265 3.40.50.1820
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7996 4 111 3.40.50.12270
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7933 6 136 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6I2G3C0-F1-model_v4 Alpha/beta fold hydrolase 0.903 5 266 GO:0016020
GO:0016787
AF-A0A6I2G3C0-F1-model_v4 Alpha/beta fold hydrolase 0.8931 5 266 GO:0016020
GO:0016787
AF-A0A370GYX9-F1-model_v4 Alpha/beta hydrolase family protein 0.8908 154 261
AF-A0A381UGQ8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.8752 6 131 GO:0006508
GO:0008233
GO:0016020
AF-A0A2N2YBN3-F1-model_v4 Alpha/beta hydrolase 0.8673 7 123 GO:0016020
GO:0016787

Map