F393840

General Info

Members Datasets Scaffolds Average Seq Length
297 179 594 96

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0334606|Ga0451576_0334606_509_841
Length 110
Sequence MNFADMMEMLRNPQALAAQAEALKRKTEGIEATGSSGGGMVRVTINGAMALKSIEIAPEAVDPSDIPMLQDLVLAAFNDAQYRIKESLQRELADGLGGMGLPPGLFGGQQ

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0334606 3300045051 Bacteria 1585
2 Ga0070658_11466361 3300005327 Bacteria 592
3 Ga0070683_100179484 3300005329 Bacteria 2010
4 Ga0070670_100751412 3300005331 Unclassified 879
5 Ga0070670_101575872 3300005331 Bacteria 604
6 Ga0070689_100175635 3300005340 Bacteria 1737
7 Ga0070689_101046712 3300005340 Bacteria 728
8 Ga0070689_101336487 3300005340 Unclassified 646
9 Ga0070669_101456855 3300005353 Bacteria 595
10 Ga0070671_100801547 3300005355 Bacteria 820
11 Ga0070673_101138061 3300005364 Bacteria 730
12 Ga0070688_100045914 3300005365 Bacteria 2703
13 Ga0070667_100941294 3300005367 Bacteria 805
14 Ga0070667_100990954 3300005367 Bacteria 784
15 Ga0070709_10154786 3300005434 Bacteria 1588
16 Ga0070709_10213171 3300005434 Bacteria 1374
17 Ga0070709_11475789 3300005434 Bacteria 552
18 Ga0070713_100077473 3300005436 Bacteria 2827
19 Ga0070713_101335802 3300005436 Bacteria 695
20 Ga0070711_100862000 3300005439 Bacteria 771
21 Ga0070711_101212360 3300005439 Bacteria 653
22 Ga0070705_101240953 3300005440 Bacteria 616
23 Ga0070708_100565647 3300005445 Bacteria 1072
24 Ga0070678_100674370 3300005456 Bacteria 929
25 Ga0070706_100214265 3300005467 Bacteria 1798
26 Ga0070706_101480584 3300005467 Bacteria 621
27 Ga0070707_101073309 3300005468 Bacteria 771
28 Ga0070698_100403661 3300005471 Bacteria 1300
29 Ga0070699_100037784 3300005518 Bacteria 4180
30 Ga0070684_100175223 3300005535 Bacteria 1949
31 Ga0070684_101685347 3300005535 Bacteria 598
32 Ga0070684_101724203 3300005535 Unclassified 591
33 Ga0070697_100036952 3300005536 Bacteria 3945
34 Ga0070665_102284570 3300005548 Bacteria 544
35 Ga0070664_101087008 3300005564 Bacteria 753
36 Ga0068857_102140216 3300005577 Bacteria 549
37 Ga0068864_101125532 3300005618 Unclassified 782
38 Ga0068861_100338215 3300005719 Bacteria 1316
39 Ga0068863_101802631 3300005841 Bacteria 622
40 Ga0068858_100443130 3300005842 Bacteria 1251
41 Ga0070717_11168219 3300006028 Bacteria 701
42 Ga0070715_10744091 3300006163 Bacteria 590
43 Ga0070715_11037377 3300006163 Bacteria 513
44 Ga0070716_100356059 3300006173 Bacteria 1038
45 Ga0070716_101759734 3300006173 Unclassified 512
46 Ga0070712_100536341 3300006175 Bacteria 985
47 Ga0097621_101367968 3300006237 Bacteria 670
48 Ga0068871_100406579 3300006358 Unclassified 1213
49 Ga0068871_101236675 3300006358 Bacteria 701
50 Ga0075431_100001305 3300006847 Bacteria 22799
51 Ga0075433_10440982 3300006852 Bacteria 1148
52 Ga0075434_100205822 3300006871 Bacteria 1988
53 Ga0075434_100478369 3300006871 Bacteria 1267
54 Ga0075429_100490354 3300006880 Bacteria 1077
55 Ga0075436_100993342 3300006914 Bacteria 630
56 Ga0075436_101024058 3300006914 Bacteria 620
57 Ga0097620_100836647 3300006931 Unclassified 1007
58 Ga0105240_10006740 3300009093 Bacteria 16817
59 Ga0105245_10957074 3300009098 Bacteria 899
60 Ga0114129_10258946 3300009147 Bacteria 2333
61 Ga0114129_10839916 3300009147 Bacteria 1169
62 Ga0114129_11054618 3300009147 Bacteria 1020
63 Ga0105241_12520467 3300009174 Bacteria 515
64 Ga0105242_10571318 3300009176 Bacteria 1087
65 Ga0105248_10759252 3300009177 Bacteria 1094
66 Ga0105248_11306404 3300009177 Bacteria 820
67 Ga0105248_11856692 3300009177 Bacteria 684
68 Ga0105248_12131625 3300009177 Bacteria 638
69 Ga0105248_12944185 3300009177 Bacteria 543
70 Ga0105237_10133187 3300009545 Bacteria 2480
71 Ga0105237_11119041 3300009545 Unclassified 794
72 Ga0105249_12987071 3300009553 Bacteria 543
73 Ga0105246_10734021 3300011119 Unclassified 869
74 Ga0157369_10231278 3300013105 Bacteria 1933
75 Ga0157374_12407179 3300013296 Bacteria 554
76 Ga0157374_12906212 3300013296 Unclassified 506
77 Ga0157378_12214605 3300013297 Bacteria 601
78 Ga0157378_13064076 3300013297 Bacteria 519
79 Ga0163162_10947366 3300013306 Bacteria 972
80 Ga0163162_11271135 3300013306 Bacteria 836
81 Ga0157372_13311692 3300013307 Bacteria 513
82 Ga0157375_10694157 3300013308 Bacteria 1172
83 Ga0157375_10770487 3300013308 Bacteria 1112
84 Ga0163163_10130208 3300014325 Bacteria 2556
85 Ga0157379_10095505 3300014968 Bacteria 2667
86 Ga0157379_12224874 3300014968 Unclassified 545
87 Ga0157376_10200079 3300014969 Bacteria 1837
88 Ga0157376_11038686 3300014969 Bacteria 843
89 Ga0213876_10104571 3300021384 Bacteria 1502
90 Ga0213875_10000006 3300021388 Bacteria 579005
91 Ga0213875_10415918 3300021388 Unclassified 642
92 Ga0213871_10002042 3300021441 Bacteria 3614
93 Ga0207685_10443336 3300025905 Bacteria 674
94 Ga0207699_11352431 3300025906 Bacteria 527
95 Ga0207684_10348316 3300025910 Unclassified 1275
96 Ga0207695_10009657 3300025913 Bacteria 11894
97 Ga0207695_11527541 3300025913 Bacteria 548
98 Ga0207671_10108419 3300025914 Bacteria 2110
99 Ga0207693_10100911 3300025915 Bacteria 2263
100 Ga0207663_11140665 3300025916 Bacteria 627
101 Ga0207650_10684927 3300025925 Unclassified 865
102 Ga0207700_10091179 3300025928 Bacteria 2407
103 Ga0207700_10510458 3300025928 Bacteria 1064
104 Ga0207664_10819221 3300025929 Bacteria 837
105 Ga0207665_10148828 3300025939 Bacteria 1675
106 Ga0207665_10677324 3300025939 Unclassified 810
107 Ga0207711_10946931 3300025941 Bacteria 800
108 Ga0207703_11035220 3300026035 Bacteria 788
109 Ga0207703_11280381 3300026035 Unclassified 705
110 Ga0207702_12094268 3300026078 Bacteria 555
111 Ga0207676_11895106 3300026095 Unclassified 595
112 Ga0207674_11235541 3300026116 Bacteria 717
113 Ga0207675_100468481 3300026118 Bacteria 1250
114 Ga0207683_11174776 3300026121 Bacteria 711
115 Ga0207698_12369287 3300026142 Bacteria 542
116 Ga0268266_10128392 3300028379 Bacteria 2265
117 Ga0268266_11669970 3300028379 Bacteria 612
118 Ga0268265_12672804 3300028380 Bacteria 505
119 Ga0265338_10261701 3300028800 Unclassified 1271
120 Ga0265338_10637377 3300028800 Bacteria 740
121 Ga0265330_10251014 3300031235 Unclassified 745
122 Ga0265332_10164559 3300031238 Bacteria 926
123 Ga0265328_10284458 3300031239 Unclassified 637
124 Ga0265325_10157256 3300031241 Bacteria 1071
125 Ga0265329_10227532 3300031242 Archaea 618
126 Ga0265331_10184711 3300031250 Unclassified 941
127 Ga0265316_10000612 3300031344 Bacteria 39686
128 Ga0265316_10070131 3300031344 Bacteria 2704
129 Ga0265316_10238864 3300031344 Bacteria 1336
130 Ga0265313_10364674 3300031595 Unclassified 571
131 Ga0265314_10017264 3300031711 Bacteria 5670
132 Ga0265314_10106978 3300031711 Unclassified 1785
133 Ga0265314_10679103 3300031711 Archaea 523
134 Ga0307416_100448696 3300032002 Bacteria 1342
135 Ga0307416_100878612 3300032002 Bacteria 996
136 Ga0373926_0198188 3300035083 Bacteria 772
137 Ga0373934_0167115 3300035086 Bacteria 903
138 Ga0373934_0196848 3300035086 Bacteria 829
139 Ga0373952_0053508 3300035092 Bacteria 969
140 Ga0373953_0299586 3300035117 Bacteria 702
141 Ga0373954_0052817 3300035118 Bacteria 1910
142 Ga0373946_0756580 3300035171 Bacteria 510
143 Ga0373955_0771296 3300035172 Bacteria 591
144 Ga0373935_0029956 3300035692 Bacteria 3370
145 Ga0373935_0139314 3300035692 Bacteria 1638
146 Ga0373927_0005750 3300035695 Bacteria 8517
147 Ga0373927_0389024 3300035695 Bacteria 920
148 Ga0373927_0639302 3300035695 Bacteria 703
149 Ga0373927_1143421 3300035695 Bacteria 513
150 Ga0373933_0160948 3300035724 Bacteria 1425
151 Ga0373933_0538284 3300035724 Unclassified 766
152 Ga0373933_0626584 3300035724 Bacteria 707
153 Ga0373947_0000974 3300035725 Bacteria 17486
154 Ga0373947_0193482 3300035725 Bacteria 1328
155 Ga0373947_0237943 3300035725 Bacteria 1201
156 Ga0373947_0655410 3300035725 Bacteria 716
157 Ga0373937_0011011 3300036401 Bacteria 7927
158 Ga0373937_0195368 3300036401 Bacteria 1902
159 Ga0373925_0001356 3300037068 Bacteria 21339
160 Ga0373925_0120418 3300037068 Bacteria 2037
161 Ga0395900_0346179 3300037418 Bacteria 1461
162 Ga0395898_1913134 3300037466 Bacteria 513
163 Ga0395905_0473951 3300037471 Bacteria 1151
164 Ga0436364_0478514 3300037853 Bacteria 578677
165 Ga0395901_0347937 3300038443 Bacteria 1530
166 Ga0436365_1486535 3300039437 Bacteria 910
167 Ga0436365_1617620 3300039437 Bacteria 4713
168 Ga0436360_0477583 3300039438 Bacteria 47726
169 Ga0436362_0734721 3300039453 Unclassified 1624
170 Ga0451577_1179002 3300042876 Bacteria 684
171 Ga0451577_1957088 3300042876 Bacteria 513
172 Ga0466963_0234610 3300044694 Bacteria 1286
173 Ga0466957_0533962 3300044842 Bacteria 816
174 Ga0466958_0242775 3300045836 Bacteria 1151
175 Ga0466967_1854180 3300045976 Unclassified 600
176 Ga0495592_0181863 3300046454 Bacteria 1431
177 Ga0495629_0679029 3300046459 Bacteria 685
178 Ga0495651_0068252 3300046462 Bacteria 2710
179 Ga0495651_0152627 3300046462 Bacteria 1663
180 Ga0495651_0421225 3300046462 Bacteria 868
181 Ga0495651_0435469 3300046462 Bacteria 850
182 Ga0495651_0544838 3300046462 Bacteria 738
183 Ga0495653_0323757 3300046463 Bacteria 998
184 Ga0495653_0843418 3300046463 Bacteria 549
185 Ga0495580_0181945 3300046472 Bacteria 1451
186 Ga0495580_0243191 3300046472 Unclassified 1233
187 Ga0495582_0121192 3300046473 Bacteria 1474
188 Ga0495639_0086041 3300046475 Bacteria 1470
189 Ga0495662_0042204 3300046476 Bacteria 2201
190 Ga0495662_0252325 3300046476 Bacteria 869
191 Ga0495662_0285126 3300046476 Bacteria 813
192 Ga0495664_0041144 3300046477 Bacteria 2733
193 Ga0495664_0148594 3300046477 Bacteria 1421
194 Ga0495664_0352362 3300046477 Bacteria 886
195 Ga0495594_0785597 3300046499 Unclassified 537
196 Ga0495608_0071408 3300046511 Bacteria 2265
197 Ga0495608_0596232 3300046511 Bacteria 663
198 Ga0495628_0114351 3300046516 Bacteria 2073
199 Ga0495630_0074645 3300046517 Bacteria 2554
200 Ga0495630_0580609 3300046517 Bacteria 859
201 Ga0495630_0771988 3300046517 Bacteria 734
202 Ga0495630_1023494 3300046517 Bacteria 627
203 Ga0495666_0569418 3300046526 Bacteria 505
204 Ga0495642_0238775 3300046528 Bacteria 794
205 Ga0495652_0120162 3300046529 Bacteria 2097
206 Ga0495652_0675424 3300046529 Bacteria 697
207 Ga0495652_0921894 3300046529 Bacteria 575
208 Ga0495652_1129991 3300046529 Bacteria 508
209 Ga0495665_0244193 3300046531 Bacteria 925
210 Ga0495665_0262517 3300046531 Bacteria 888
211 Ga0495665_0267670 3300046531 Bacteria 878
212 Ga0495665_0319584 3300046531 Bacteria 793
213 Ga0495665_0401578 3300046531 Bacteria 695
214 Ga0495640_0087764 3300046533 Bacteria 2057
215 Ga0495640_0210750 3300046533 Bacteria 1228
216 Ga0495586_0009579 3300046535 Bacteria 5161
217 Ga0495586_0287198 3300046535 Bacteria 942
218 Ga0495586_0531840 3300046535 Bacteria 678
219 Ga0495587_0085483 3300046536 Bacteria 1826
220 Ga0495587_0131661 3300046536 Bacteria 1429
221 Ga0495587_0468141 3300046536 Bacteria 698
222 Ga0495645_0029161 3300046543 Bacteria 4012
223 Ga0495645_0083357 3300046543 Bacteria 2291
224 Ga0495645_0349747 3300046543 Bacteria 952
225 Ga0495645_0378365 3300046543 Bacteria 906
226 Ga0495645_0631327 3300046543 Bacteria 656
227 Ga0495667_0153844 3300046559 Unclassified 1480
228 Ga0495667_0407665 3300046559 Unclassified 856
229 Ga0495667_0953561 3300046559 Bacteria 525
230 Ga0495634_0129062 3300046642 Bacteria 1613
231 Ga0495635_0053563 3300046663 Bacteria 2780
232 Ga0495635_0054495 3300046663 Bacteria 2755
233 Ga0495635_0895944 3300046663 Unclassified 568
234 Ga0495657_0161389 3300046675 Bacteria 1387
235 Ga0495657_0163869 3300046675 Bacteria 1374
236 Ga0495599_0064936 3300046678 Bacteria 2280
237 Ga0495623_0089576 3300046679 Unclassified 1891
238 Ga0495623_0123566 3300046679 Unclassified 1556
239 Ga0495623_0136464 3300046679 Bacteria 1464
240 Ga0495623_0203660 3300046679 Bacteria 1136
241 Ga0495646_0096859 3300046680 Bacteria 1696
242 Ga0495646_0531430 3300046680 Bacteria 602
243 Ga0495669_0316528 3300046684 Bacteria 753
244 Ga0495669_0354560 3300046684 Unclassified 709
245 Ga0495613_0403917 3300046689 Bacteria 931
246 Ga0495613_0661258 3300046689 Bacteria 691
247 Ga0495613_0720201 3300046689 Bacteria 656
248 Ga0495600_0071243 3300046809 Bacteria 2271
249 Ga0495600_0214207 3300046809 Bacteria 1234
250 Ga0495581_0217866 3300047315 Bacteria 1116
251 Ga0495581_0337409 3300047315 Bacteria 880
252 Ga0495604_0029258 3300047317 Bacteria 4382
253 Ga0495604_0039034 3300047317 Bacteria 3733
254 Ga0495604_0412850 3300047317 Bacteria 887
255 Ga0495604_0613776 3300047317 Bacteria 696
256 Ga0495674_0013233 3300047319 Bacteria 7757
257 Ga0495674_0100428 3300047319 Bacteria 2462
258 Ga0495674_0128723 3300047319 Bacteria 2134
259 Ga0495674_0441082 3300047319 Bacteria 1047
260 Ga0495674_1225980 3300047319 Bacteria 566
261 Ga0495680_0204283 3300047322 Unclassified 1416
262 Ga0495675_0034965 3300047444 Bacteria 3209
263 Ga0495675_0129801 3300047444 Bacteria 1567
264 Ga0495675_0227233 3300047444 Bacteria 1127
265 Ga0495675_0552895 3300047444 Bacteria 656
266 Ga0495684_0035337 3300047471 Bacteria 3833
267 Ga0495684_0111642 3300047471 Bacteria 2062
268 Ga0495684_0385423 3300047471 Bacteria 988
269 Ga0495684_0732564 3300047471 Bacteria 652
270 Ga0495684_0884997 3300047471 Bacteria 576
271 Ga0495593_0451772 3300047673 Bacteria 643
272 Ga0495602_0378704 3300048088 Bacteria 1014
273 Ga0495602_0870436 3300048088 Bacteria 601
274 Ga0496104_0287084 3300048907 Bacteria 1558
275 Ga0496109_0274455 3300048912 Bacteria 1589
276 Ga0496109_0614177 3300048912 Unclassified 1024
277 Ga0496115_1448434 3300048918 Unclassified 505
278 Ga0496126_1387285 3300048929 Bacteria 508
279 Ga0501034_0078250 3300049571 Bacteria 3312
280 Ga0501038_1164504 3300049574 Bacteria 561
281 Ga0501040_0770161 3300049576 Bacteria 696
282 Ga0501076_0511540 3300049592 Bacteria 990
283 Ga0501249_068733 3300049679 Bacteria 826
284 Ga0501079_0320349 3300049741 Bacteria 1214
285 Ga0501270_005856 3300049767 Bacteria 1448
286 Ga0501045_0542643 3300049824 Bacteria 863
287 Ga0501045_0966701 3300049824 Bacteria 625
288 nmdc:mga05p37_183651_c1 3300050507 Bacteria 2543
289 nmdc:mga05p37_801547_c1 3300050507 Bacteria 1030
290 nmdc:mga09592_428345_c1 3300050508 Bacteria 1142
291 nmdc:mga06r32_1554909_c1 3300050510 Bacteria 601
292 nmdc:mga0n895_676406_c1 3300050512 Bacteria 1029
293 nmdc:mga0n895_678933_c1 3300050512 Bacteria 1027
294 nmdc:mga0rr50_1743133_c1 3300050513 Bacteria 525
295 Ga0495601_0159761 3300053077 Bacteria 1473
296 Ga0495619_0607327 3300053085 Bacteria 748
297 Ga0501082_0001403 3300060353 Bacteria 21228
298 Ga0451576_0334606
299 Ga0070658_11466361
300 Ga0070683_100179484
301 Ga0070670_100751412
302 Ga0070670_101575872
303 Ga0070689_100175635
304 Ga0070689_101046712
305 Ga0070689_101336487
306 Ga0070669_101456855
307 Ga0070671_100801547
308 Ga0070673_101138061
309 Ga0070688_100045914
310 Ga0070667_100941294
311 Ga0070667_100990954
312 Ga0070709_10154786
313 Ga0070709_10213171
314 Ga0070709_11475789
315 Ga0070713_100077473
316 Ga0070713_101335802
317 Ga0070711_100862000
318 Ga0070711_101212360
319 Ga0070705_101240953
320 Ga0070708_100565647
321 Ga0070678_100674370
322 Ga0070706_100214265
323 Ga0070706_101480584
324 Ga0070707_101073309
325 Ga0070698_100403661
326 Ga0070699_100037784
327 Ga0070684_100175223
328 Ga0070684_101685347
329 Ga0070684_101724203
330 Ga0070697_100036952
331 Ga0070665_102284570
332 Ga0070664_101087008
333 Ga0068857_102140216
334 Ga0068864_101125532
335 Ga0068861_100338215
336 Ga0068863_101802631
337 Ga0068858_100443130
338 Ga0070717_11168219
339 Ga0070715_10744091
340 Ga0070715_11037377
341 Ga0070716_100356059
342 Ga0070716_101759734
343 Ga0070712_100536341
344 Ga0097621_101367968
345 Ga0068871_100406579
346 Ga0068871_101236675
347 Ga0075431_100001305
348 Ga0075433_10440982
349 Ga0075434_100205822
350 Ga0075434_100478369
351 Ga0075429_100490354
352 Ga0075436_100993342
353 Ga0075436_101024058
354 Ga0097620_100836647
355 Ga0105240_10006740
356 Ga0105245_10957074
357 Ga0114129_10258946
358 Ga0114129_10839916
359 Ga0114129_11054618
360 Ga0105241_12520467
361 Ga0105242_10571318
362 Ga0105248_10759252
363 Ga0105248_11306404
364 Ga0105248_11856692
365 Ga0105248_12131625
366 Ga0105248_12944185
367 Ga0105237_10133187
368 Ga0105237_11119041
369 Ga0105249_12987071
370 Ga0105246_10734021
371 Ga0157369_10231278
372 Ga0157374_12407179
373 Ga0157374_12906212
374 Ga0157378_12214605
375 Ga0157378_13064076
376 Ga0163162_10947366
377 Ga0163162_11271135
378 Ga0157372_13311692
379 Ga0157375_10694157
380 Ga0157375_10770487
381 Ga0163163_10130208
382 Ga0157379_10095505
383 Ga0157379_12224874
384 Ga0157376_10200079
385 Ga0157376_11038686
386 Ga0213876_10104571
387 Ga0213875_10000006
388 Ga0213875_10415918
389 Ga0213871_10002042
390 Ga0207685_10443336
391 Ga0207699_11352431
392 Ga0207684_10348316
393 Ga0207695_10009657
394 Ga0207695_11527541
395 Ga0207671_10108419
396 Ga0207693_10100911
397 Ga0207663_11140665
398 Ga0207650_10684927
399 Ga0207700_10091179
400 Ga0207700_10510458
401 Ga0207664_10819221
402 Ga0207665_10148828
403 Ga0207665_10677324
404 Ga0207711_10946931
405 Ga0207703_11035220
406 Ga0207703_11280381
407 Ga0207702_12094268
408 Ga0207676_11895106
409 Ga0207674_11235541
410 Ga0207675_100468481
411 Ga0207683_11174776
412 Ga0207698_12369287
413 Ga0268266_10128392
414 Ga0268266_11669970
415 Ga0268265_12672804
416 Ga0265338_10261701
417 Ga0265338_10637377
418 Ga0265330_10251014
419 Ga0265332_10164559
420 Ga0265328_10284458
421 Ga0265325_10157256
422 Ga0265329_10227532
423 Ga0265331_10184711
424 Ga0265316_10000612
425 Ga0265316_10070131
426 Ga0265316_10238864
427 Ga0265313_10364674
428 Ga0265314_10017264
429 Ga0265314_10106978
430 Ga0265314_10679103
431 Ga0307416_100448696
432 Ga0307416_100878612
433 Ga0373926_0198188
434 Ga0373934_0167115
435 Ga0373934_0196848
436 Ga0373952_0053508
437 Ga0373953_0299586
438 Ga0373954_0052817
439 Ga0373946_0756580
440 Ga0373955_0771296
441 Ga0373935_0029956
442 Ga0373935_0139314
443 Ga0373927_0005750
444 Ga0373927_0389024
445 Ga0373927_0639302
446 Ga0373927_1143421
447 Ga0373933_0160948
448 Ga0373933_0538284
449 Ga0373933_0626584
450 Ga0373947_0000974
451 Ga0373947_0193482
452 Ga0373947_0237943
453 Ga0373947_0655410
454 Ga0373937_0011011
455 Ga0373937_0195368
456 Ga0373925_0001356
457 Ga0373925_0120418
458 Ga0395900_0346179
459 Ga0395898_1913134
460 Ga0395905_0473951
461 Ga0436364_0478514
462 Ga0395901_0347937
463 Ga0436365_1486535
464 Ga0436365_1617620
465 Ga0436360_0477583
466 Ga0436362_0734721
467 Ga0451577_1179002
468 Ga0451577_1957088
469 Ga0466963_0234610
470 Ga0466957_0533962
471 Ga0466958_0242775
472 Ga0466967_1854180
473 Ga0495592_0181863
474 Ga0495629_0679029
475 Ga0495651_0068252
476 Ga0495651_0152627
477 Ga0495651_0421225
478 Ga0495651_0435469
479 Ga0495651_0544838
480 Ga0495653_0323757
481 Ga0495653_0843418
482 Ga0495580_0181945
483 Ga0495580_0243191
484 Ga0495582_0121192
485 Ga0495639_0086041
486 Ga0495662_0042204
487 Ga0495662_0252325
488 Ga0495662_0285126
489 Ga0495664_0041144
490 Ga0495664_0148594
491 Ga0495664_0352362
492 Ga0495594_0785597
493 Ga0495608_0071408
494 Ga0495608_0596232
495 Ga0495628_0114351
496 Ga0495630_0074645
497 Ga0495630_0580609
498 Ga0495630_0771988
499 Ga0495630_1023494
500 Ga0495666_0569418
501 Ga0495642_0238775
502 Ga0495652_0120162
503 Ga0495652_0675424
504 Ga0495652_0921894
505 Ga0495652_1129991
506 Ga0495665_0244193
507 Ga0495665_0262517
508 Ga0495665_0267670
509 Ga0495665_0319584
510 Ga0495665_0401578
511 Ga0495640_0087764
512 Ga0495640_0210750
513 Ga0495586_0009579
514 Ga0495586_0287198
515 Ga0495586_0531840
516 Ga0495587_0085483
517 Ga0495587_0131661
518 Ga0495587_0468141
519 Ga0495645_0029161
520 Ga0495645_0083357
521 Ga0495645_0349747
522 Ga0495645_0378365
523 Ga0495645_0631327
524 Ga0495667_0153844
525 Ga0495667_0407665
526 Ga0495667_0953561
527 Ga0495634_0129062
528 Ga0495635_0053563
529 Ga0495635_0054495
530 Ga0495635_0895944
531 Ga0495657_0161389
532 Ga0495657_0163869
533 Ga0495599_0064936
534 Ga0495623_0089576
535 Ga0495623_0123566
536 Ga0495623_0136464
537 Ga0495623_0203660
538 Ga0495646_0096859
539 Ga0495646_0531430
540 Ga0495669_0316528
541 Ga0495669_0354560
542 Ga0495613_0403917
543 Ga0495613_0661258
544 Ga0495613_0720201
545 Ga0495600_0071243
546 Ga0495600_0214207
547 Ga0495581_0217866
548 Ga0495581_0337409
549 Ga0495604_0029258
550 Ga0495604_0039034
551 Ga0495604_0412850
552 Ga0495604_0613776
553 Ga0495674_0013233
554 Ga0495674_0100428
555 Ga0495674_0128723
556 Ga0495674_0441082
557 Ga0495674_1225980
558 Ga0495680_0204283
559 Ga0495675_0034965
560 Ga0495675_0129801
561 Ga0495675_0227233
562 Ga0495675_0552895
563 Ga0495684_0035337
564 Ga0495684_0111642
565 Ga0495684_0385423
566 Ga0495684_0732564
567 Ga0495684_0884997
568 Ga0495593_0451772
569 Ga0495602_0378704
570 Ga0495602_0870436
571 Ga0496104_0287084
572 Ga0496109_0274455
573 Ga0496109_0614177
574 Ga0496115_1448434
575 Ga0496126_1387285
576 Ga0501034_0078250
577 Ga0501038_1164504
578 Ga0501040_0770161
579 Ga0501076_0511540
580 Ga0501249_068733
581 Ga0501079_0320349
582 Ga0501270_005856
583 Ga0501045_0542643
584 Ga0501045_0966701
585 nmdc:mga05p37_183651_c1
586 nmdc:mga05p37_801547_c1
587 nmdc:mga09592_428345_c1
588 nmdc:mga06r32_1554909_c1
589 nmdc:mga0n895_676406_c1
590 nmdc:mga0n895_678933_c1
591 nmdc:mga0rr50_1743133_c1
592 Ga0495601_0159761
593 Ga0495619_0607327
594 Ga0501082_0001403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

10

100

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.9331 8 83
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.9239 11 83
5yrx-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis 0.9175 12 78
1pug-assembly1.cif.gz_B structure of e. coli ybab 0.9077 11 79
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.8897 11 83
ID Description Score Start End Superfamily
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.9175 12 78 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.9077 11 79 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8574 12 78 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8405 11 79 3.30.1310.10
af_Q54RP0_292_455_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8257 22 47 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A5N8V657-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9385 6 88 GO:0003677
AF-B9TBG6-F1-model_v4 DNA polymerase I, putative 0.9312 9 84 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7I7W762-F1-model_v4 deleted 0.9252 8 89
AF-A0A7Y5FKR3-F1-model_v4 Nucleoid-associated protein HUU39_14395 0.9246 8 87 GO:0003677
GO:0005829
GO:0043590
AF-A0A662EN44-F1-model_v4 Nucleoid-associated protein DRJ24_04655 0.9235 8 88 GO:0003677
GO:0005829
GO:0043590

Map