F393525

General Info

Members Datasets Scaffolds Average Seq Length
297 114 594 71

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1012995|Ga0065165_10129953
Length 82
Sequence MKFNIYGRFQVDVRREDDAWAVYRAELGKRTLCEDVVIPPDVAADELATYLDDIFHEYAGHGDNVEPIPDQGLTDLVHRSGP

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
10 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
11 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
29 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
30 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
31 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
32 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
33 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
42 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
43 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
52 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
56 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
61 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
62 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
65 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
66 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
72 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
95 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
110 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 3.03
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1012995 3300005262 Bacteria 3342
2 rootL2_10033647 3300003322 Bacteria 5712
3 rootL2_10103356 3300003322 Bacteria 5154
4 Ga0070658_10866965 3300005327 Unclassified 785
5 Ga0070660_100203216 3300005339 Bacteria 1607
6 Ga0070659_100338826 3300005366 Bacteria 1259
7 Ga0068855_100043800 3300005563 Bacteria 5298
8 Ga0068855_101194322 3300005563 Bacteria 791
9 Ga0070664_100735909 3300005564 Bacteria 920
10 Ga0105244_10354226 3300009036 Bacteria 676
11 Ga0105240_10633644 3300009093 Bacteria 1174
12 Ga0105240_11230529 3300009093 Bacteria 792
13 Ga0105242_10019990 3300009176 Bacteria 5247
14 Ga0105237_10062333 3300009545 Bacteria 3729
15 Ga0105238_12849921 3300009551 Unclassified 520
16 Ga0105239_10278194 3300010375 Bacteria 1884
17 Ga0105246_10872022 3300011119 Bacteria 805
18 Ga0157372_10250627 3300013307 Bacteria 2055
19 Ga0157372_11711329 3300013307 Bacteria 723
20 Ga0157372_12013888 3300013307 Bacteria 664
21 Ga0207705_10006085 3300025909 Bacteria 8978
22 Ga0207705_10285283 3300025909 Bacteria 1264
23 Ga0207654_10281201 3300025911 Bacteria 1126
24 Ga0207671_10096559 3300025914 Bacteria 2233
25 Ga0207657_10180529 3300025919 Bacteria 1706
26 Ga0207686_10009730 3300025934 Bacteria 5222
27 Ga0207679_10688805 3300025945 Bacteria 927
28 Ga0207667_10005394 3300025949 Bacteria 15595
29 Ga0207667_10721062 3300025949 Bacteria 998
30 Ga0207640_10406170 3300025981 Bacteria 1110
31 Ga0207639_11600559 3300026041 Bacteria 611
32 Ga0395900_0005720 3300037418 Bacteria 12992
33 Ga0395900_0776624 3300037418 Bacteria 887
34 Ga0395900_0994067 3300037418 Bacteria 759
35 Ga0395900_1492494 3300037418 Bacteria 588
36 Ga0395898_0009855 3300037466 Bacteria 10013
37 Ga0395898_0709194 3300037466 Unclassified 948
38 Ga0395898_1147772 3300037466 Bacteria 709
39 Ga0395905_0015182 3300037471 Bacteria 7328
40 Ga0395905_1181245 3300037471 Unclassified 669
41 Ga0395901_0000076 3300038443 Bacteria 138169
42 Ga0395901_0007533 3300038443 Bacteria 10994
43 Ga0395901_0156315 3300038443 Bacteria 2395
44 Ga0395901_0541430 3300038443 Bacteria 1181
45 Ga0439448_0007361 3300042005 Bacteria 3188
46 Ga0439448_0037366 3300042005 Bacteria 1560
47 Ga0439450_001161 3300042008 Bacteria 3764
48 Ga0439450_001855 3300042008 Bacteria 3198
49 Ga0439455_0011042 3300042012 Bacteria 1998
50 Ga0439455_0068748 3300042012 Unclassified 949
51 Ga0450911_003057 3300042115 Bacteria 3055
52 Ga0450898_045342 3300042134 Bacteria 839
53 Ga0439458_0139099 3300042157 Bacteria 646
54 Ga0466969_0212101 3300044656 Bacteria 882
55 Ga0466969_0282120 3300044656 Bacteria 752
56 Ga0466965_0098055 3300044683 Bacteria 1496
57 Ga0466966_0015246 3300044684 Bacteria 5082
58 Ga0466966_0176928 3300044684 Bacteria 1295
59 Ga0466966_0284444 3300044684 Bacteria 994
60 Ga0466966_0873658 3300044684 Bacteria 542
61 Ga0466961_0105121 3300044693 Bacteria 1778
62 Ga0466970_0131336 3300044765 Bacteria 1376
63 Ga0466970_0334311 3300044765 Bacteria 858
64 Ga0466957_0511682 3300044842 Bacteria 833
65 Ga0466959_0212329 3300045049 Bacteria 1344
66 Ga0466959_0224296 3300045049 Unclassified 1302
67 Ga0466959_0623054 3300045049 Bacteria 725
68 Ga0466958_0309283 3300045836 Bacteria 1015
69 Ga0466958_0313417 3300045836 Unclassified 1008
70 Ga0466967_0369062 3300045976 Bacteria 1392
71 Ga0495617_001810 3300046452 Bacteria 9103
72 Ga0495617_007625 3300046452 Bacteria 3748
73 Ga0495617_010966 3300046452 Bacteria 3098
74 Ga0495627_083863 3300046453 Bacteria 921
75 Ga0495603_0190001 3300046455 Bacteria 1187
76 Ga0495603_0328002 3300046455 Bacteria 878
77 Ga0495590_0051421 3300046457 Bacteria 1439
78 Ga0495629_0735579 3300046459 Bacteria 653
79 Ga0495629_0735580 3300046459 Bacteria 653
80 Ga0495638_0008481 3300046460 Bacteria 7283
81 Ga0495582_0160915 3300046473 Bacteria 1276
82 Ga0495605_0000555 3300046474 Bacteria 30522
83 Ga0495605_0001250 3300046474 Bacteria 16867
84 Ga0495605_0098829 3300046474 Unclassified 1344
85 Ga0495605_0219688 3300046474 Bacteria 822
86 Ga0495605_0414108 3300046474 Bacteria 559
87 Ga0495584_0001058 3300046491 Bacteria 17100
88 Ga0495584_0003613 3300046491 Bacteria 8434
89 Ga0495584_0010379 3300046491 Bacteria 4788
90 Ga0495584_0038418 3300046491 Bacteria 2419
91 Ga0495584_0058250 3300046491 Bacteria 1943
92 Ga0495584_0303268 3300046491 Bacteria 811
93 Ga0495585_0002461 3300046492 Bacteria 13245
94 Ga0495585_0015587 3300046492 Bacteria 4415
95 Ga0495585_0036772 3300046492 Bacteria 2759
96 Ga0495585_0058624 3300046492 Bacteria 2123
97 Ga0495585_0067835 3300046492 Bacteria 1950
98 Ga0495585_0072675 3300046492 Bacteria 1873
99 Ga0495585_0184653 3300046492 Bacteria 1070
100 Ga0495594_0026187 3300046499 Bacteria 3136
101 Ga0495596_0001966 3300046500 Bacteria 11343
102 Ga0495607_0001250 3300046501 Bacteria 22779
103 Ga0495607_0001922 3300046501 Bacteria 17559
104 Ga0495607_0003704 3300046501 Bacteria 11589
105 Ga0495607_0007110 3300046501 Bacteria 7779
106 Ga0495607_0143623 3300046501 Bacteria 1229
107 Ga0495583_0000177 3300046506 Bacteria 108704
108 Ga0495583_0013120 3300046506 Bacteria 4643
109 Ga0495583_0048179 3300046506 Bacteria 1956
110 Ga0495583_0083179 3300046506 Bacteria 1388
111 Ga0495583_0434089 3300046506 Unclassified 515
112 Ga0495606_0007068 3300046507 Bacteria 10158
113 Ga0495606_0011782 3300046507 Bacteria 7086
114 Ga0495606_0182572 3300046507 Bacteria 1208
115 Ga0495610_0017774 3300046512 Bacteria 4044
116 Ga0495616_0003201 3300046513 Bacteria 10555
117 Ga0495616_0012719 3300046513 Bacteria 4766
118 Ga0495616_0127014 3300046513 Bacteria 1172
119 Ga0495616_0282474 3300046513 Bacteria 705
120 Ga0495631_0011265 3300046518 Bacteria 4402
121 Ga0495631_0025706 3300046518 Bacteria 2708
122 Ga0495631_0098691 3300046518 Bacteria 1257
123 Ga0495631_0144255 3300046518 Bacteria 1022
124 Ga0495631_0160545 3300046518 Unclassified 964
125 Ga0495631_0161299 3300046518 Bacteria 962
126 Ga0495631_0271317 3300046518 Bacteria 722
127 Ga0495637_0002319 3300046520 Bacteria 10530
128 Ga0495643_0000123 3300046522 Bacteria 124936
129 Ga0495643_0005258 3300046522 Bacteria 8797
130 Ga0495643_0006311 3300046522 Bacteria 7836
131 Ga0495643_0038932 3300046522 Bacteria 2601
132 Ga0495643_0217418 3300046522 Bacteria 908
133 Ga0495643_0324261 3300046522 Bacteria 695
134 Ga0495644_0000604 3300046523 Bacteria 15091
135 Ga0495644_0001561 3300046523 Bacteria 9337
136 Ga0495644_0030720 3300046523 Bacteria 2028
137 Ga0495644_0036875 3300046523 Unclassified 1844
138 Ga0495648_0000541 3300046524 Bacteria 40809
139 Ga0495648_0012983 3300046524 Bacteria 6183
140 Ga0495648_0013618 3300046524 Bacteria 6001
141 Ga0495648_0189664 3300046524 Bacteria 1038
142 Ga0495642_0000210 3300046528 Bacteria 34170
143 Ga0495642_0007470 3300046528 Bacteria 4186
144 Ga0495642_0025250 3300046528 Bacteria 2354
145 Ga0495642_0164601 3300046528 Bacteria 962
146 Ga0495586_0865044 3300046535 Bacteria 521
147 Ga0495609_0010584 3300046538 Bacteria 4420
148 Ga0495609_0321028 3300046538 Bacteria 628
149 Ga0495597_0000208 3300046542 Bacteria 53439
150 Ga0495597_0000292 3300046542 Bacteria 44978
151 Ga0495597_0029856 3300046542 Bacteria 2486
152 Ga0495597_0059759 3300046542 Bacteria 1663
153 Ga0495622_0007856 3300046557 Bacteria 4950
154 Ga0495622_0291833 3300046557 Bacteria 711
155 Ga0495633_0005666 3300046558 Bacteria 7561
156 Ga0495633_0022704 3300046558 Bacteria 3117
157 Ga0495633_0051651 3300046558 Unclassified 1936
158 Ga0495656_0002313 3300046615 Bacteria 6303
159 Ga0495656_0009484 3300046615 Bacteria 3500
160 Ga0495656_0015723 3300046615 Bacteria 2862
161 Ga0495656_0019331 3300046615 Bacteria 2629
162 Ga0495656_0211522 3300046615 Bacteria 966
163 Ga0495668_0000883 3300046616 Bacteria 33776
164 Ga0495668_0004910 3300046616 Bacteria 9284
165 Ga0495668_0007802 3300046616 Bacteria 6785
166 Ga0495668_0058314 3300046616 Bacteria 2131
167 Ga0495668_0072764 3300046616 Bacteria 1888
168 Ga0495611_0001029 3300046648 Bacteria 14781
169 Ga0495611_0002476 3300046648 Bacteria 8423
170 Ga0495611_0051295 3300046648 Bacteria 1859
171 Ga0495611_0102091 3300046648 Bacteria 1332
172 Ga0495611_0121059 3300046648 Bacteria 1220
173 Ga0495611_0280553 3300046648 Unclassified 769
174 Ga0495625_0020988 3300046660 Bacteria 5036
175 Ga0495625_0043403 3300046660 Bacteria 3260
176 Ga0495625_0063870 3300046660 Bacteria 2599
177 Ga0495625_0107545 3300046660 Bacteria 1909
178 Ga0495625_0145603 3300046660 Bacteria 1595
179 Ga0495659_0000861 3300046664 Bacteria 10800
180 Ga0495659_0443211 3300046664 Unclassified 564
181 Ga0495661_0002287 3300046665 Bacteria 14803
182 Ga0495661_0011667 3300046665 Bacteria 5953
183 Ga0495661_0034247 3300046665 Bacteria 3196
184 Ga0495661_0036555 3300046665 Bacteria 3074
185 Ga0495661_0046082 3300046665 Bacteria 2663
186 Ga0495661_0059721 3300046665 Bacteria 2268
187 Ga0495661_0063357 3300046665 Bacteria 2185
188 Ga0495661_0075460 3300046665 Bacteria 1959
189 Ga0495661_0196251 3300046665 Bacteria 1060
190 Ga0495661_0201248 3300046665 Bacteria 1042
191 Ga0495661_0208365 3300046665 Bacteria 1019
192 Ga0495661_0216061 3300046665 Bacteria 995
193 Ga0495661_0293118 3300046665 Bacteria 816
194 Ga0495661_0373628 3300046665 Bacteria 697
195 Ga0495588_0000118 3300046674 Bacteria 134942
196 Ga0495588_0024001 3300046674 Bacteria 3025
197 Ga0495588_0038272 3300046674 Bacteria 2439
198 Ga0495588_0050413 3300046674 Bacteria 2142
199 Ga0495669_0253430 3300046684 Unclassified 845
200 Ga0495613_0050454 3300046689 Bacteria 3068
201 Ga0495670_0002203 3300046691 Bacteria 9636
202 Ga0495670_0003977 3300046691 Bacteria 7257
203 Ga0495670_0008855 3300046691 Bacteria 4951
204 Ga0495670_0014367 3300046691 Bacteria 3892
205 Ga0495671_0001923 3300046692 Bacteria 13335
206 Ga0495671_0019287 3300046692 Bacteria 3609
207 Ga0495671_0090507 3300046692 Bacteria 1497
208 Ga0495671_0232899 3300046692 Bacteria 890
209 Ga0495671_0513338 3300046692 Bacteria 571
210 Ga0495649_0019717 3300046694 Bacteria 3786
211 Ga0495649_0037871 3300046694 Bacteria 2646
212 Ga0495649_0047732 3300046694 Bacteria 2328
213 Ga0495589_0000077 3300046794 Bacteria 90550
214 Ga0495589_0011374 3300046794 Bacteria 4621
215 Ga0495589_0011572 3300046794 Bacteria 4581
216 Ga0495589_0142422 3300046794 Bacteria 1147
217 Ga0495660_0000050 3300046810 Bacteria 140329
218 Ga0495660_0007254 3300046810 Bacteria 6526
219 Ga0495660_0032592 3300046810 Bacteria 2925
220 Ga0495660_0215943 3300046810 Bacteria 907
221 Ga0495581_0025464 3300047315 Bacteria 3430
222 Ga0495636_0000142 3300047318 Bacteria 28894
223 Ga0495636_0160625 3300047318 Bacteria 1012
224 Ga0495672_0000429 3300047320 Bacteria 50347
225 Ga0495672_0002301 3300047320 Bacteria 17722
226 Ga0495672_0003148 3300047320 Bacteria 14363
227 Ga0495672_0020677 3300047320 Bacteria 4307
228 Ga0495672_0073786 3300047320 Bacteria 1923
229 Ga0495676_0000029 3300047321 Bacteria 140281
230 Ga0495683_0002323 3300047323 Bacteria 11555
231 Ga0495683_0012177 3300047323 Bacteria 4521
232 Ga0495683_0061813 3300047323 Bacteria 1854
233 Ga0495683_0069618 3300047323 Bacteria 1729
234 Ga0495683_0357710 3300047323 Unclassified 615
235 Ga0495687_000063 3300047443 Bacteria 169101
236 Ga0495687_000065 3300047443 Bacteria 162721
237 Ga0495687_000097 3300047443 Bacteria 132755
238 Ga0495687_000438 3300047443 Bacteria 51460
239 Ga0495687_000654 3300047443 Bacteria 39715
240 Ga0495687_030099 3300047443 Bacteria 2503
241 Ga0495677_0000228 3300047445 Bacteria 25591
242 Ga0495677_0000251 3300047445 Bacteria 23487
243 Ga0495677_0001059 3300047445 Bacteria 11042
244 Ga0495677_0003707 3300047445 Bacteria 5916
245 Ga0495677_0004025 3300047445 Bacteria 5674
246 Ga0495677_0004088 3300047445 Bacteria 5635
247 Ga0495677_0006600 3300047445 Bacteria 4379
248 Ga0495677_0028692 3300047445 Bacteria 2022
249 Ga0495677_0080156 3300047445 Bacteria 1223
250 Ga0495677_0241493 3300047445 Bacteria 706
251 Ga0495677_0407735 3300047445 Unclassified 538
252 Ga0495679_030026 3300047446 Bacteria 1768
253 Ga0495685_005403 3300047447 Bacteria 4169
254 Ga0495685_025563 3300047447 Bacteria 2031
255 Ga0495673_0004569 3300047469 Bacteria 8632
256 Ga0495673_0122106 3300047469 Bacteria 1031
257 Ga0495681_0010499 3300047470 Bacteria 5603
258 Ga0495681_0017218 3300047470 Bacteria 4022
259 Ga0495681_0077468 3300047470 Bacteria 1491
260 Ga0495681_0195915 3300047470 Bacteria 822
261 Ga0495681_0395195 3300047470 Bacteria 518
262 Ga0495686_0064033 3300047472 Bacteria 2277
263 Ga0495614_0021908 3300048089 Bacteria 2758
264 Ga0495626_0000081 3300048091 Bacteria 128894
265 Ga0495626_0005415 3300048091 Bacteria 7481
266 Ga0495626_0019717 3300048091 Bacteria 3368
267 Ga0495626_0057682 3300048091 Bacteria 1776
268 Ga0495626_0340659 3300048091 Bacteria 586
269 Ga0496101_1558942 3300048904 Unclassified 514
270 Ga0496102_0005900 3300048905 Bacteria 10428
271 Ga0496102_0340423 3300048905 Unclassified 1412
272 Ga0496102_0904760 3300048905 Bacteria 804
273 Ga0496102_1398693 3300048905 Bacteria 619
274 Ga0496106_0208416 3300048909 Bacteria 1557
275 Ga0496108_1347051 3300048911 Bacteria 599
276 Ga0496109_0439270 3300048912 Bacteria 1233
277 Ga0496113_0243628 3300048916 Bacteria 1435
278 Ga0496122_0030439 3300048925 Bacteria 4521
279 Ga0496122_0270739 3300048925 Bacteria 936
280 Ga0496122_0524278 3300048925 Bacteria 570
281 Ga0496123_0001567 3300048926 Bacteria 31277
282 Ga0496124_0148874 3300048927 Bacteria 1839
283 Ga0496124_0832490 3300048927 Unclassified 568
284 Ga0495678_000313 3300049459 Bacteria 51964
285 Ga0495678_000751 3300049459 Bacteria 29470
286 Ga0495678_001020 3300049459 Bacteria 23851
287 Ga0495678_080870 3300049459 Bacteria 1167
288 Ga0495682_0000330 3300049460 Bacteria 35298
289 Ga0495682_0000696 3300049460 Bacteria 22058
290 Ga0495682_0003061 3300049460 Bacteria 7600
291 Ga0495682_0018006 3300049460 Bacteria 2661
292 Ga0495682_0101829 3300049460 Unclassified 1030
293 Ga0495682_0296491 3300049460 Unclassified 570
294 Ga0501044_0035884 3300049823 Bacteria 5190
295 Ga0587098_008427 3300059604 Bacteria 1096
296 Ga0587067_187711 3300059640 Bacteria 542
297 Ga0466962_0277852 3300061719 Bacteria 826
298 Ga0065165_1012995
299 rootL2_10033647
300 rootL2_10103356
301 Ga0070658_10866965
302 Ga0070660_100203216
303 Ga0070659_100338826
304 Ga0068855_100043800
305 Ga0068855_101194322
306 Ga0070664_100735909
307 Ga0105244_10354226
308 Ga0105240_10633644
309 Ga0105240_11230529
310 Ga0105242_10019990
311 Ga0105237_10062333
312 Ga0105238_12849921
313 Ga0105239_10278194
314 Ga0105246_10872022
315 Ga0157372_10250627
316 Ga0157372_11711329
317 Ga0157372_12013888
318 Ga0207705_10006085
319 Ga0207705_10285283
320 Ga0207654_10281201
321 Ga0207671_10096559
322 Ga0207657_10180529
323 Ga0207686_10009730
324 Ga0207679_10688805
325 Ga0207667_10005394
326 Ga0207667_10721062
327 Ga0207640_10406170
328 Ga0207639_11600559
329 Ga0395900_0005720
330 Ga0395900_0776624
331 Ga0395900_0994067
332 Ga0395900_1492494
333 Ga0395898_0009855
334 Ga0395898_0709194
335 Ga0395898_1147772
336 Ga0395905_0015182
337 Ga0395905_1181245
338 Ga0395901_0000076
339 Ga0395901_0007533
340 Ga0395901_0156315
341 Ga0395901_0541430
342 Ga0439448_0007361
343 Ga0439448_0037366
344 Ga0439450_001161
345 Ga0439450_001855
346 Ga0439455_0011042
347 Ga0439455_0068748
348 Ga0450911_003057
349 Ga0450898_045342
350 Ga0439458_0139099
351 Ga0466969_0212101
352 Ga0466969_0282120
353 Ga0466965_0098055
354 Ga0466966_0015246
355 Ga0466966_0176928
356 Ga0466966_0284444
357 Ga0466966_0873658
358 Ga0466961_0105121
359 Ga0466970_0131336
360 Ga0466970_0334311
361 Ga0466957_0511682
362 Ga0466959_0212329
363 Ga0466959_0224296
364 Ga0466959_0623054
365 Ga0466958_0309283
366 Ga0466958_0313417
367 Ga0466967_0369062
368 Ga0495617_001810
369 Ga0495617_007625
370 Ga0495617_010966
371 Ga0495627_083863
372 Ga0495603_0190001
373 Ga0495603_0328002
374 Ga0495590_0051421
375 Ga0495629_0735579
376 Ga0495629_0735580
377 Ga0495638_0008481
378 Ga0495582_0160915
379 Ga0495605_0000555
380 Ga0495605_0001250
381 Ga0495605_0098829
382 Ga0495605_0219688
383 Ga0495605_0414108
384 Ga0495584_0001058
385 Ga0495584_0003613
386 Ga0495584_0010379
387 Ga0495584_0038418
388 Ga0495584_0058250
389 Ga0495584_0303268
390 Ga0495585_0002461
391 Ga0495585_0015587
392 Ga0495585_0036772
393 Ga0495585_0058624
394 Ga0495585_0067835
395 Ga0495585_0072675
396 Ga0495585_0184653
397 Ga0495594_0026187
398 Ga0495596_0001966
399 Ga0495607_0001250
400 Ga0495607_0001922
401 Ga0495607_0003704
402 Ga0495607_0007110
403 Ga0495607_0143623
404 Ga0495583_0000177
405 Ga0495583_0013120
406 Ga0495583_0048179
407 Ga0495583_0083179
408 Ga0495583_0434089
409 Ga0495606_0007068
410 Ga0495606_0011782
411 Ga0495606_0182572
412 Ga0495610_0017774
413 Ga0495616_0003201
414 Ga0495616_0012719
415 Ga0495616_0127014
416 Ga0495616_0282474
417 Ga0495631_0011265
418 Ga0495631_0025706
419 Ga0495631_0098691
420 Ga0495631_0144255
421 Ga0495631_0160545
422 Ga0495631_0161299
423 Ga0495631_0271317
424 Ga0495637_0002319
425 Ga0495643_0000123
426 Ga0495643_0005258
427 Ga0495643_0006311
428 Ga0495643_0038932
429 Ga0495643_0217418
430 Ga0495643_0324261
431 Ga0495644_0000604
432 Ga0495644_0001561
433 Ga0495644_0030720
434 Ga0495644_0036875
435 Ga0495648_0000541
436 Ga0495648_0012983
437 Ga0495648_0013618
438 Ga0495648_0189664
439 Ga0495642_0000210
440 Ga0495642_0007470
441 Ga0495642_0025250
442 Ga0495642_0164601
443 Ga0495586_0865044
444 Ga0495609_0010584
445 Ga0495609_0321028
446 Ga0495597_0000208
447 Ga0495597_0000292
448 Ga0495597_0029856
449 Ga0495597_0059759
450 Ga0495622_0007856
451 Ga0495622_0291833
452 Ga0495633_0005666
453 Ga0495633_0022704
454 Ga0495633_0051651
455 Ga0495656_0002313
456 Ga0495656_0009484
457 Ga0495656_0015723
458 Ga0495656_0019331
459 Ga0495656_0211522
460 Ga0495668_0000883
461 Ga0495668_0004910
462 Ga0495668_0007802
463 Ga0495668_0058314
464 Ga0495668_0072764
465 Ga0495611_0001029
466 Ga0495611_0002476
467 Ga0495611_0051295
468 Ga0495611_0102091
469 Ga0495611_0121059
470 Ga0495611_0280553
471 Ga0495625_0020988
472 Ga0495625_0043403
473 Ga0495625_0063870
474 Ga0495625_0107545
475 Ga0495625_0145603
476 Ga0495659_0000861
477 Ga0495659_0443211
478 Ga0495661_0002287
479 Ga0495661_0011667
480 Ga0495661_0034247
481 Ga0495661_0036555
482 Ga0495661_0046082
483 Ga0495661_0059721
484 Ga0495661_0063357
485 Ga0495661_0075460
486 Ga0495661_0196251
487 Ga0495661_0201248
488 Ga0495661_0208365
489 Ga0495661_0216061
490 Ga0495661_0293118
491 Ga0495661_0373628
492 Ga0495588_0000118
493 Ga0495588_0024001
494 Ga0495588_0038272
495 Ga0495588_0050413
496 Ga0495669_0253430
497 Ga0495613_0050454
498 Ga0495670_0002203
499 Ga0495670_0003977
500 Ga0495670_0008855
501 Ga0495670_0014367
502 Ga0495671_0001923
503 Ga0495671_0019287
504 Ga0495671_0090507
505 Ga0495671_0232899
506 Ga0495671_0513338
507 Ga0495649_0019717
508 Ga0495649_0037871
509 Ga0495649_0047732
510 Ga0495589_0000077
511 Ga0495589_0011374
512 Ga0495589_0011572
513 Ga0495589_0142422
514 Ga0495660_0000050
515 Ga0495660_0007254
516 Ga0495660_0032592
517 Ga0495660_0215943
518 Ga0495581_0025464
519 Ga0495636_0000142
520 Ga0495636_0160625
521 Ga0495672_0000429
522 Ga0495672_0002301
523 Ga0495672_0003148
524 Ga0495672_0020677
525 Ga0495672_0073786
526 Ga0495676_0000029
527 Ga0495683_0002323
528 Ga0495683_0012177
529 Ga0495683_0061813
530 Ga0495683_0069618
531 Ga0495683_0357710
532 Ga0495687_000063
533 Ga0495687_000065
534 Ga0495687_000097
535 Ga0495687_000438
536 Ga0495687_000654
537 Ga0495687_030099
538 Ga0495677_0000228
539 Ga0495677_0000251
540 Ga0495677_0001059
541 Ga0495677_0003707
542 Ga0495677_0004025
543 Ga0495677_0004088
544 Ga0495677_0006600
545 Ga0495677_0028692
546 Ga0495677_0080156
547 Ga0495677_0241493
548 Ga0495677_0407735
549 Ga0495679_030026
550 Ga0495685_005403
551 Ga0495685_025563
552 Ga0495673_0004569
553 Ga0495673_0122106
554 Ga0495681_0010499
555 Ga0495681_0017218
556 Ga0495681_0077468
557 Ga0495681_0195915
558 Ga0495681_0395195
559 Ga0495686_0064033
560 Ga0495614_0021908
561 Ga0495626_0000081
562 Ga0495626_0005415
563 Ga0495626_0019717
564 Ga0495626_0057682
565 Ga0495626_0340659
566 Ga0496101_1558942
567 Ga0496102_0005900
568 Ga0496102_0340423
569 Ga0496102_0904760
570 Ga0496102_1398693
571 Ga0496106_0208416
572 Ga0496108_1347051
573 Ga0496109_0439270
574 Ga0496113_0243628
575 Ga0496122_0030439
576 Ga0496122_0270739
577 Ga0496122_0524278
578 Ga0496123_0001567
579 Ga0496124_0148874
580 Ga0496124_0832490
581 Ga0495678_000313
582 Ga0495678_000751
583 Ga0495678_001020
584 Ga0495678_080870
585 Ga0495682_0000330
586 Ga0495682_0000696
587 Ga0495682_0003061
588 Ga0495682_0018006
589 Ga0495682_0101829
590 Ga0495682_0296491
591 Ga0501044_0035884
592 Ga0587098_008427
593 Ga0587067_187711
594 Ga0466962_0277852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24697

1

68

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qmi-assembly1.cif.gz_E structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi 0.7209 1 32
4nv7-assembly3.cif.gz_B crystal structure of mesorhizobium loti arylamine n-acetyltransferase 1 in complex with coa 0.6901 3 32
1f2u-assembly1.cif.gz_D crystal structure of rad50 abc-atpase 0.6364 7 36
4inn-assembly1.cif.gz_A protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family 0.6247 2 24
3qks-assembly1.cif.gz_B mre11 rad50 binding domain bound to rad50 0.6203 7 36
ID Description Score Start End Superfamily
af_F1LVM9_518_617_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7688 8 32 2.30.29.30
af_F1QCT6_318_383_2.10.10.20 Mainly Beta;Ribbon;Seminal Fluid Protein;Carbohydrate-binding module superfamily 5/12 0.7639 10 33 2.10.10.20
af_Q16531_4_505_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7489 1 32 2.130.10.10
af_U3JAK2_206_305_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7219 1 33 2.30.29.30
af_Q64512_769_870_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7047 8 39 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A556AB41-F1-model_v4 Uncharacterized protein 1.001 1 69
AF-A0A4R3V056-F1-model_v4 deleted 0.9945 1 70
AF-A0A7X4HGD9-F1-model_v4 Uncharacterized protein 0.9901 1 69
AF-A0A1H4A4N7-F1-model_v4 Uncharacterized protein 0.987 2 70
AF-A0A7Z2VVZ5-F1-model_v4 Uncharacterized protein 0.9849 1 69

Map