F393305

General Info

Members Datasets Scaffolds Average Seq Length
296 157 296 149

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0939461|Ga0395905_0939461_269_718
Length 149
Sequence MRLFLVHHGEAVGPEVDARRPLSDAGRAAVERLADRAAARGVKPAVVWHSGKLRAKQTAEAFWRACNPLAELAATRDLQPDDPADWMRDRLRGESRDVLIAGHFPHLPRLLSLLVGRDDFPTHGVVALRSDDEGETWQEAWRLGIQNYG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.43
Rhizosphere 92.23
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100129344 3300005330 Bacteria 1704
2 Ga0070689_100785226 3300005340 Unclassified 837
3 Ga0070668_100122329 3300005347 Bacteria 2081
4 Ga0070674_100562903 3300005356 Bacteria 958
5 Ga0070688_100071470 3300005365 Bacteria 2222
6 Ga0070709_10758124 3300005434 Unclassified 759
7 Ga0070701_10080138 3300005438 Bacteria 1765
8 Ga0070711_101536397 3300005439 Unclassified 581
9 Ga0070694_100027053 3300005444 Bacteria 3722
10 Ga0070708_100050146 3300005445 Bacteria 3695
11 Ga0070708_100156923 3300005445 Bacteria 2119
12 Ga0070678_100388669 3300005456 Bacteria 1209
13 Ga0070681_10230723 3300005458 Bacteria 1766
14 Ga0068867_100048955 3300005459 Bacteria 3111
15 Ga0068867_100084482 3300005459 Unclassified 2398
16 Ga0070685_10867277 3300005466 Unclassified 670
17 Ga0070707_100084050 3300005468 Unclassified 3076
18 Ga0070707_100629086 3300005468 Unclassified 1036
19 Ga0070707_100784951 3300005468 Unclassified 916
20 Ga0070698_100243480 3300005471 Bacteria 1731
21 Ga0070698_100574592 3300005471 Bacteria 1067
22 Ga0070699_100005320 3300005518 Bacteria 11294
23 Ga0070699_100987875 3300005518 Bacteria 772
24 Ga0070672_100009661 3300005543 Bacteria 6659
25 Ga0070672_101259526 3300005543 Bacteria 660
26 Ga0070686_100020604 3300005544 Bacteria 3904
27 Ga0070686_100229389 3300005544 Bacteria 1346
28 Ga0070686_100970672 3300005544 Bacteria 695
29 Ga0070695_100001695 3300005545 Bacteria 12416
30 Ga0070665_100024453 3300005548 Bacteria 6083
31 Ga0070665_100060285 3300005548 Bacteria 3803
32 Ga0070704_100015718 3300005549 Bacteria 4764
33 Ga0070704_100497814 3300005549 Bacteria 1057
34 Ga0068855_100574696 3300005563 Bacteria 1218
35 Ga0070664_100789987 3300005564 Bacteria 887
36 Ga0068854_100304577 3300005578 Bacteria 1290
37 Ga0070702_100211459 3300005615 Bacteria 1291
38 Ga0070702_100282696 3300005615 Bacteria 1140
39 Ga0068859_100299955 3300005617 Unclassified 1700
40 Ga0068859_100336530 3300005617 Bacteria 1604
41 Ga0068859_102075476 3300005617 Bacteria 628
42 Ga0068859_103121396 3300005617 Unclassified 505
43 Ga0068866_10065003 3300005718 Bacteria 1907
44 Ga0068866_10218678 3300005718 Bacteria 1148
45 Ga0068866_10368685 3300005718 Bacteria 917
46 Ga0068861_100465845 3300005719 Archaea 1135
47 Ga0068870_10405288 3300005840 Unclassified 888
48 Ga0068863_100005016 3300005841 Bacteria 13049
49 Ga0068858_100497097 3300005842 Bacteria 1178
50 Ga0068860_100045904 3300005843 Bacteria 4166
51 Ga0068862_100016971 3300005844 Bacteria 6059
52 Ga0068862_100653697 3300005844 Bacteria 1014
53 Ga0068862_101027852 3300005844 Bacteria 816
54 Ga0081455_10072530 3300005937 Bacteria 2850
55 Ga0070715_10465108 3300006163 Unclassified 717
56 Ga0070712_100435732 3300006175 Unclassified 1089
57 Ga0097621_100004036 3300006237 Bacteria 10179
58 Ga0097621_100012095 3300006237 Bacteria 6387
59 Ga0097621_100022205 3300006237 Bacteria 4923
60 Ga0097621_100028133 3300006237 Bacteria 4429
61 Ga0068871_100002184 3300006358 Bacteria 13293
62 Ga0068871_100018638 3300006358 Bacteria 5281
63 Ga0068871_100027733 3300006358 Bacteria 4432
64 Ga0068871_100119182 3300006358 Bacteria 2227
65 Ga0068871_101322392 3300006358 Unclassified 678
66 Ga0075428_102103614 3300006844 Unclassified 584
67 Ga0075431_101145383 3300006847 Unclassified 742
68 Ga0075433_10046534 3300006852 Unclassified 3774
69 Ga0075433_10092356 3300006852 Bacteria 2677
70 Ga0075433_11050299 3300006852 Bacteria 709
71 Ga0075434_100018222 3300006871 Bacteria 6780
72 Ga0075434_100507049 3300006871 Bacteria 1227
73 Ga0075434_100808510 3300006871 Bacteria 954
74 Ga0075434_100822336 3300006871 Unclassified 945
75 Ga0075434_101390183 3300006871 Bacteria 712
76 Ga0068865_100010841 3300006881 Bacteria 5686
77 Ga0068865_100195298 3300006881 Bacteria 1568
78 Ga0068865_100654990 3300006881 Unclassified 893
79 Ga0068865_100928936 3300006881 Unclassified 758
80 Ga0075436_100004695 3300006914 Bacteria 9371
81 Ga0075436_100008912 3300006914 Bacteria 6868
82 Ga0075436_100073632 3300006914 Bacteria 2364
83 Ga0075436_100145068 3300006914 Bacteria 1669
84 Ga0097620_100299978 3300006931 Unclassified 1700
85 Ga0097620_100336519 3300006931 Bacteria 1604
86 Ga0097620_102075417 3300006931 Bacteria 628
87 Ga0097620_103122474 3300006931 Unclassified 505
88 Ga0075435_100036123 3300007076 Bacteria 3925
89 Ga0075435_100585905 3300007076 Unclassified 967
90 Ga0075435_101147291 3300007076 Bacteria 680
91 Ga0105240_10055649 3300009093 Bacteria 4953
92 Ga0111539_10154875 3300009094 Bacteria 2682
93 Ga0111539_10216470 3300009094 Bacteria 2231
94 Ga0111539_10346575 3300009094 Bacteria 1729
95 Ga0111539_11408417 3300009094 Unclassified 809
96 Ga0111539_11723091 3300009094 Bacteria 727
97 Ga0111539_12326616 3300009094 Bacteria 622
98 Ga0105245_10018779 3300009098 Bacteria 6049
99 Ga0114129_10013254 3300009147 Bacteria 11742
100 Ga0114129_10017643 3300009147 Bacteria 10162
101 Ga0114129_10021953 3300009147 Bacteria 9058
102 Ga0114129_10022079 3300009147 Bacteria 9031
103 Ga0114129_10107497 3300009147 Bacteria 3853
104 Ga0114129_10144675 3300009147 Bacteria 3257
105 Ga0114129_10241928 3300009147 Bacteria 2426
106 Ga0114129_10837126 3300009147 Bacteria 1171
107 Ga0105242_10008808 3300009176 Bacteria 7743
108 Ga0105242_10041094 3300009176 Bacteria 3728
109 Ga0105242_10118538 3300009176 Unclassified 2267
110 Ga0105242_10133611 3300009176 Bacteria 2145
111 Ga0105248_10024038 3300009177 Bacteria 6773
112 Ga0105248_10048794 3300009177 Unclassified 4749
113 Ga0105248_10067231 3300009177 Bacteria 4023
114 Ga0105248_10264083 3300009177 Bacteria 1938
115 Ga0105248_10586588 3300009177 Bacteria 1258
116 Ga0105248_10942601 3300009177 Bacteria 975
117 Ga0105238_10410782 3300009551 Bacteria 1347
118 Ga0105249_10400993 3300009553 Bacteria 1402
119 Ga0105249_10482251 3300009553 Bacteria 1283
120 Ga0157315_1004231 3300012508 Unclassified 1016
121 Ga0157374_12193929 3300013296 Unclassified 579
122 Ga0157378_10413053 3300013297 Unclassified 1332
123 Ga0157378_11646602 3300013297 Bacteria 688
124 Ga0163162_10075478 3300013306 Unclassified 3432
125 Ga0163162_10557245 3300013306 Bacteria 1274
126 Ga0163162_10676333 3300013306 Bacteria 1155
127 Ga0157375_11879665 3300013308 Bacteria 710
128 Ga0157380_10213559 3300014326 Bacteria 1721
129 Ga0157380_10221310 3300014326 Bacteria 1694
130 Ga0157377_11136023 3300014745 Bacteria 601
131 Ga0157379_10019939 3300014968 Bacteria 5924
132 Ga0157376_10091823 3300014969 Unclassified 2631
133 Ga0157376_10145299 3300014969 Bacteria 2132
134 Ga0157376_10352525 3300014969 Bacteria 1409
135 Ga0163161_10506348 3300017792 Bacteria 984
136 Ga0207642_10043599 3300025899 Bacteria 1980
137 Ga0207688_10383422 3300025901 Bacteria 870
138 Ga0207685_10365463 3300025905 Unclassified 731
139 Ga0207645_10417015 3300025907 Bacteria 904
140 Ga0207707_10334288 3300025912 Unclassified 1307
141 Ga0207695_10090095 3300025913 Bacteria 3083
142 Ga0207693_10703168 3300025915 Unclassified 783
143 Ga0207663_10300205 3300025916 Bacteria 1199
144 Ga0207663_11039591 3300025916 Unclassified 658
145 Ga0207646_10055015 3300025922 Bacteria 3559
146 Ga0207646_10906347 3300025922 Bacteria 782
147 Ga0207681_10003563 3300025923 Bacteria 9696
148 Ga0207694_11234975 3300025924 Unclassified 632
149 Ga0207650_10374279 3300025925 Bacteria 1175
150 Ga0207687_10032953 3300025927 Bacteria 3512
151 Ga0207664_10038327 3300025929 Bacteria 3716
152 Ga0207706_10182934 3300025933 Unclassified 1841
153 Ga0207686_10008529 3300025934 Bacteria 5536
154 Ga0207686_10146186 3300025934 Bacteria 1640
155 Ga0207686_10165519 3300025934 Bacteria 1554
156 Ga0207686_10329434 3300025934 Unclassified 1143
157 Ga0207686_11491185 3300025934 Unclassified 557
158 Ga0207704_10126394 3300025938 Unclassified 1761
159 Ga0207704_10223761 3300025938 Bacteria 1394
160 Ga0207704_10271588 3300025938 Bacteria 1284
161 Ga0207704_10790085 3300025938 Unclassified 792
162 Ga0207691_10004571 3300025940 Bacteria 13400
163 Ga0207711_10053400 3300025941 Bacteria 3466
164 Ga0207711_10173788 3300025941 Unclassified 1956
165 Ga0207711_10238721 3300025941 Bacteria 1666
166 Ga0207711_10416292 3300025941 Unclassified 1249
167 Ga0207711_10514341 3300025941 Bacteria 1116
168 Ga0207689_10027005 3300025942 Bacteria 4806
169 Ga0207689_10115283 3300025942 Bacteria 2209
170 Ga0207651_10180221 3300025960 Bacteria 1675
171 Ga0207651_11326505 3300025960 Unclassified 647
172 Ga0207640_10469779 3300025981 Unclassified 1041
173 Ga0207677_10061753 3300026023 Bacteria 2596
174 Ga0207677_10200576 3300026023 Bacteria 1585
175 Ga0207703_10265072 3300026035 Bacteria 1554
176 Ga0207708_11642992 3300026075 Unclassified 564
177 Ga0207702_10816842 3300026078 Unclassified 922
178 Ga0207641_10000409 3300026088 Bacteria 50240
179 Ga0207641_10921884 3300026088 Unclassified 868
180 Ga0207648_10053173 3300026089 Bacteria 3540
181 Ga0207648_10110043 3300026089 Unclassified 2418
182 Ga0207648_11114323 3300026089 Bacteria 740
183 Ga0207675_100507441 3300026118 Archaea 1201
184 Ga0207675_102348669 3300026118 Bacteria 546
185 Ga0207683_10063576 3300026121 Bacteria 3251
186 Ga0207683_10063741 3300026121 Bacteria 3247
187 Ga0207428_10066085 3300027907 Unclassified 2850
188 Ga0207428_10090188 3300027907 Bacteria 2381
189 Ga0207428_10259264 3300027907 Bacteria 1295
190 Ga0207428_10389484 3300027907 Unclassified 1021
191 Ga0268266_10021671 3300028379 Bacteria 5475
192 Ga0268266_10167761 3300028379 Bacteria 1990
193 Ga0268265_10002410 3300028380 Bacteria 14131
194 Ga0268264_10074400 3300028381 Unclassified 2885
195 Ga0268264_10561132 3300028381 Unclassified 1121
196 Ga0265316_10968745 3300031344 Unclassified 593
197 Ga0265314_10106224 3300031711 Bacteria 1794
198 Ga0373940_0072706 3300035088 Bacteria 1004
199 Ga0373936_0236633 3300035113 Unclassified 813
200 Ga0373954_0123512 3300035118 Bacteria 1258
201 Ga0373943_0047602 3300035170 Bacteria 2097
202 Ga0373946_0020668 3300035171 Bacteria 2546
203 Ga0373946_0176935 3300035171 Bacteria 1011
204 Ga0373955_0196130 3300035172 Archaea 1201
205 Ga0373924_0004135 3300035410 Bacteria 5049
206 Ga0373924_0497595 3300035410 Bacteria 548
207 Ga0373931_0175806 3300035691 Bacteria 1264
208 Ga0373931_1285017 3300035691 Bacteria 503
209 Ga0373947_0290213 3300035725 Archaea 1089
210 Ga0373937_0210288 3300036401 Bacteria 1830
211 Ga0373937_0484856 3300036401 Unclassified 1174
212 Ga0373925_0084892 3300037068 Bacteria 2413
213 Ga0373925_0374701 3300037068 Unclassified 1158
214 Ga0395905_0939461 3300037471 Unclassified 768
215 Ga0395901_0895137 3300038443 Bacteria 870
216 Ga0436365_1490266 3300039437 Bacteria 1207
217 Ga0439459_0199971 3300042438 Bacteria 545
218 Ga0450916_066908 3300042530 Unclassified 593
219 Ga0466964_0553805 3300044706 Unclassified 625
220 Ga0451576_1057668 3300045051 Unclassified 850
221 Ga0495629_0375322 3300046459 Unclassified 968
222 Ga0495608_0207483 3300046511 Bacteria 1233
223 Ga0495640_0174851 3300046533 Bacteria 1371
224 Ga0495586_0188833 3300046535 Bacteria 1167
225 Ga0495667_0594888 3300046559 Unclassified 689
226 Ga0495634_0500085 3300046642 Unclassified 713
227 Ga0495635_0781997 3300046663 Unclassified 616
228 Ga0495647_0040171 3300046681 Unclassified 1777
229 Ga0495647_0509222 3300046681 Unclassified 561
230 Ga0495669_0019122 3300046684 Unclassified 2954
231 Ga0495669_0138623 3300046684 Unclassified 1148
232 Ga0495670_0591930 3300046691 Bacteria 604
233 Ga0495604_0245598 3300047317 Bacteria 1222
234 Ga0495684_0503027 3300047471 Bacteria 833
235 Ga0496100_0000944 3300048903 Bacteria 13902
236 Ga0496101_0073680 3300048904 Bacteria 2509
237 Ga0496102_0090478 3300048905 Bacteria 2832
238 Ga0496102_1159480 3300048905 Unclassified 692
239 Ga0496104_0006346 3300048907 Bacteria 10397
240 Ga0496104_0477457 3300048907 Bacteria 1158
241 Ga0496105_0631746 3300048908 Bacteria 828
242 Ga0496105_0994251 3300048908 Bacteria 628
243 Ga0496106_0061545 3300048909 Bacteria 2848
244 Ga0496106_0151818 3300048909 Bacteria 1828
245 Ga0496107_0034890 3300048910 Bacteria 3605
246 Ga0496107_0181096 3300048910 Unclassified 1565
247 Ga0496108_0245984 3300048911 Bacteria 1556
248 Ga0496108_0296291 3300048911 Bacteria 1409
249 Ga0496110_0418217 3300048913 Bacteria 1222
250 Ga0496110_0638342 3300048913 Bacteria 964
251 Ga0496111_0397101 3300048914 Unclassified 1019
252 Ga0496112_1370717 3300048915 Unclassified 622
253 Ga0496114_0007259 3300048917 Bacteria 8752
254 Ga0496114_0051446 3300048917 Unclassified 3430
255 Ga0496114_0606260 3300048917 Unclassified 965
256 Ga0496114_1469135 3300048917 Bacteria 569
257 Ga0501067_0727124 3300049583 Unclassified 558
258 Ga0501074_0270460 3300049590 Unclassified 1208
259 Ga0501074_0892690 3300049590 Bacteria 626
260 Ga0501081_0822967 3300049743 Bacteria 699
261 Ga0501083_0103408 3300049744 Unclassified 1877
262 nmdc:mga05p37_107964_c1 3300050507 Bacteria 3424
263 nmdc:mga05p37_12817_c1 3300050507 Bacteria 10023
264 nmdc:mga05p37_20635_c1 3300050507 Bacteria 7971
265 nmdc:mga05p37_3684_c1 3300050507 Bacteria 11668
266 nmdc:mga05p37_37664_c1 3300050507 Bacteria 5931
267 nmdc:mga05p37_52257_c1 3300050507 Bacteria 5025
268 nmdc:mga05p37_69288_c1 3300050507 Bacteria 4338
269 nmdc:mga09592_1441432_c1 3300050508 Unclassified 562
270 nmdc:mga09592_319796_c1 3300050508 Bacteria 1344
271 nmdc:mga0qj67_508388_c1 3300050509 Unclassified 968
272 nmdc:mga06r32_1059261_c1 3300050510 Bacteria 761
273 nmdc:mga08y16_1443994_c1 3300050511 Bacteria 650
274 nmdc:mga08y16_35689_c1 3300050511 Bacteria 5222
275 nmdc:mga08y16_387558_c1 3300050511 Bacteria 1432
276 nmdc:mga08y16_7643_c1 3300050511 Bacteria 11311
277 nmdc:mga0n895_1010278_c1 3300050512 Bacteria 812
278 nmdc:mga0n895_287332_c1 3300050512 Bacteria 1667
279 nmdc:mga0n895_28896_c1 3300050512 Bacteria 5280
280 nmdc:mga0n895_4602_c1 3300050512 Bacteria 11367
281 nmdc:mga0n895_851959_c1 3300050512 Bacteria 899
282 nmdc:mga0n895_965590_c1 3300050512 Unclassified 835
283 nmdc:mga0rr50_1604413_c1 3300050513 Unclassified 549
284 nmdc:mga0rr50_316849_c1 3300050513 Unclassified 1307
285 nmdc:mga0rr50_494033_c1 3300050513 Bacteria 1040
286 nmdc:mga0rr50_54340_c1 3300050513 Bacteria 2983
287 nmdc:mga0rr50_565806_c1 3300050513 Unclassified 968
288 nmdc:mga08x19_175863_c1 3300050514 Bacteria 1460
289 nmdc:mga08x19_392254_c1 3300050514 Bacteria 973
290 nmdc:mga08x19_39672_c1 3300050514 Unclassified 2994
291 nmdc:mga0a205_315033_c1 3300050515 Bacteria 1436
292 nmdc:mga0a205_510108_c1 3300050515 Bacteria 1059
293 nmdc:mga0a205_7558_c1 3300050515 Bacteria 9846
294 nmdc:mga0a205_78553_c1 3300050515 Bacteria 3188
295 nmdc:mga0a205_877912_c1 3300050515 Bacteria 744
296 Ga0495601_0054820 3300053077 Bacteria 2523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10758124 Ga0070709_107581242 134
2 3300006163 Ga0070715_10465108 Ga0070715_104651082 134
3 3300006237 Ga0097621_100012095 Ga0097621_1000120952 134
4 3300006358 Ga0068871_100119182 Ga0068871_1001191822 134
5 3300014969 Ga0157376_10091823 Ga0157376_100918233 134
6 3300025905 Ga0207685_10365463 Ga0207685_103654632 134
7 3300005458 Ga0070681_10230723 Ga0070681_102307233 139
8 3300025912 Ga0207707_10334288 Ga0207707_103342883 139
9 3300005844 Ga0068862_100016971 Ga0068862_1000169715 141
10 3300027907 Ga0207428_10090188 Ga0207428_100901883 141
11 3300028380 Ga0268265_10002410 Ga0268265_100024103 141
12 3300038443 Ga0395901_0895137 Ga0395901_0895137_119_559 141
13 3300026118 Ga0207675_102348669 Ga0207675_1023486691 142
14 3300009147 Ga0114129_10837126 Ga0114129_108371262 143
15 3300031344 Ga0265316_10968745 Ga0265316_109687452 143
16 3300006175 Ga0070712_100435732 Ga0070712_1004357322 144
17 3300025915 Ga0207693_10703168 Ga0207693_107031682 144
18 3300025929 Ga0207664_10038327 Ga0207664_100383273 144
19 3300005356 Ga0070674_100562903 Ga0070674_1005629032 145
20 3300005456 Ga0070678_100388669 Ga0070678_1003886691 145
21 3300005459 Ga0068867_100048955 Ga0068867_1000489553 145
22 3300005466 Ga0070685_10867277 Ga0070685_108672771 145
23 3300005548 Ga0070665_100024453 Ga0070665_1000244535 145
24 3300005563 Ga0068855_100574696 Ga0068855_1005746962 145
25 3300005617 Ga0068859_103121396 Ga0068859_1031213961 145
26 3300005718 Ga0068866_10368685 Ga0068866_103686852 145
27 3300005840 Ga0068870_10405288 Ga0068870_104052881 145
28 3300005842 Ga0068858_100497097 Ga0068858_1004970972 145
29 3300006358 Ga0068871_100002184 Ga0068871_1000021845 145
30 3300006871 Ga0075434_101390183 Ga0075434_1013901832 145
31 3300006881 Ga0068865_100195298 Ga0068865_1001952983 145
32 3300006914 Ga0075436_100145068 Ga0075436_1001450683 145
33 3300006931 Ga0097620_103122474 Ga0097620_1031224741 145
34 3300007076 Ga0075435_100036123 Ga0075435_1000361233 145
35 3300009098 Ga0105245_10018779 Ga0105245_100187795 145
36 3300009176 Ga0105242_10041094 Ga0105242_100410943 145
37 3300009176 Ga0105242_10133611 Ga0105242_101336112 145
38 3300009177 Ga0105248_10586588 Ga0105248_105865881 145
39 3300009177 Ga0105248_10942601 Ga0105248_109426012 145
40 3300009553 Ga0105249_10482251 Ga0105249_104822512 145
41 3300013296 Ga0157374_12193929 Ga0157374_121939291 145
42 3300013297 Ga0157378_10413053 Ga0157378_104130531 145
43 3300013306 Ga0163162_10557245 Ga0163162_105572452 145
44 3300013308 Ga0157375_11879665 Ga0157375_118796651 145
45 3300014969 Ga0157376_10145299 Ga0157376_101452992 145
46 3300014969 Ga0157376_10352525 Ga0157376_103525252 145
47 3300025901 Ga0207688_10383422 Ga0207688_103834221 145
48 3300025927 Ga0207687_10032953 Ga0207687_100329533 145
49 3300025934 Ga0207686_10008529 Ga0207686_100085293 145
50 3300025934 Ga0207686_10329434 Ga0207686_103294342 145
51 3300025938 Ga0207704_10126394 Ga0207704_101263941 145
52 3300025938 Ga0207704_10271588 Ga0207704_102715881 145
53 3300025941 Ga0207711_10238721 Ga0207711_102387213 145
54 3300025941 Ga0207711_10514341 Ga0207711_105143412 145
55 3300025942 Ga0207689_10027005 Ga0207689_100270052 145
56 3300025960 Ga0207651_11326505 Ga0207651_113265051 145
57 3300026023 Ga0207677_10200576 Ga0207677_102005762 145
58 3300026035 Ga0207703_10265072 Ga0207703_102650722 145
59 3300026088 Ga0207641_10921884 Ga0207641_109218841 145
60 3300026089 Ga0207648_10053173 Ga0207648_100531734 145
61 3300026121 Ga0207683_10063741 Ga0207683_100637411 145
62 3300028379 Ga0268266_10167761 Ga0268266_101677612 145
63 3300028381 Ga0268264_10561132 Ga0268264_105611322 145
64 3300035113 Ga0373936_0236633 Ga0373936_0236633_261_698 145
65 3300048907 Ga0496104_0477457 Ga0496104_0477457_330_767 145
66 3300048908 Ga0496105_0631746 Ga0496105_0631746_75_512 145
67 3300048908 Ga0496105_0994251 Ga0496105_0994251_78_515 145
68 3300048911 Ga0496108_0245984 Ga0496108_0245984_282_719 145
69 3300048917 Ga0496114_1469135 Ga0496114_1469135_20_457 145
70 3300050512 nmdc:mga0n895_851959_c1 nmdc:mga0n895_851959_c1_252_689 145
71 3300005439 Ga0070711_101536397 Ga0070711_1015363971 146
72 3300005445 Ga0070708_100050146 Ga0070708_1000501461 146
73 3300005518 Ga0070699_100005320 Ga0070699_10000532013 146
74 3300005549 Ga0070704_100497814 Ga0070704_1004978142 146
75 3300005844 Ga0068862_101027852 Ga0068862_1010278522 146
76 3300006237 Ga0097621_100022205 Ga0097621_1000222053 146
77 3300006358 Ga0068871_100027733 Ga0068871_1000277333 146
78 3300006914 Ga0075436_100004695 Ga0075436_1000046952 146
79 3300009094 Ga0111539_11723091 Ga0111539_117230912 146
80 3300025916 Ga0207663_11039591 Ga0207663_110395911 146
81 3300026089 Ga0207648_11114323 Ga0207648_111143232 146
82 3300042438 Ga0439459_0199971 Ga0439459_0199971_13_453 146
83 3300042530 Ga0450916_066908 Ga0450916_066908_10_450 146
84 3300046533 Ga0495640_0174851 Ga0495640_0174851_728_1168 146
85 3300046684 Ga0495669_0019122 Ga0495669_0019122_1881_2321 146
86 3300048903 Ga0496100_0000944 Ga0496100_0000944_10161_10601 146
87 3300048904 Ga0496101_0073680 Ga0496101_0073680_1285_1725 146
88 3300048905 Ga0496102_0090478 Ga0496102_0090478_886_1326 146
89 3300048907 Ga0496104_0006346 Ga0496104_0006346_2163_2603 146
90 3300048909 Ga0496106_0061545 Ga0496106_0061545_1951_2391 146
91 3300048910 Ga0496107_0034890 Ga0496107_0034890_1898_2338 146
92 3300048917 Ga0496114_0007259 Ga0496114_0007259_1540_1980 146
93 3300050508 nmdc:mga09592_1441432_c1 nmdc:mga09592_1441432_c1_22_462 146
94 3300050513 nmdc:mga0rr50_316849_c1 nmdc:mga0rr50_316849_c1_401_841 146
95 3300050513 nmdc:mga0rr50_54340_c1 nmdc:mga0rr50_54340_c1_2496_2936 146
96 3300050514 nmdc:mga08x19_175863_c1 nmdc:mga08x19_175863_c1_165_605 146
97 3300005564 Ga0070664_100789987 Ga0070664_1007899872 147
98 3300009094 Ga0111539_10346575 Ga0111539_103465752 147
99 3300009094 Ga0111539_11408417 Ga0111539_114084172 147
100 3300025907 Ga0207645_10417015 Ga0207645_104170152 147
101 3300027907 Ga0207428_10259264 Ga0207428_102592642 147
102 3300027907 Ga0207428_10389484 Ga0207428_103894842 147
103 3300035088 Ga0373940_0072706 Ga0373940_0072706_452_895 147
104 3300035118 Ga0373954_0123512 Ga0373954_0123512_486_929 147
105 3300035410 Ga0373924_0497595 Ga0373924_0497595_87_530 147
106 3300046459 Ga0495629_0375322 Ga0495629_0375322_164_625 147
107 3300046642 Ga0495634_0500085 Ga0495634_0500085_257_700 147
108 3300046663 Ga0495635_0781997 Ga0495635_0781997_54_515 147
109 3300046681 Ga0495647_0040171 Ga0495647_0040171_191_652 147
110 3300048913 Ga0496110_0418217 Ga0496110_0418217_734_1177 147
111 3300048915 Ga0496112_1370717 Ga0496112_1370717_30_479 147
112 3300050509 nmdc:mga0qj67_508388_c1 nmdc:mga0qj67_508388_c1_513_956 147
113 3300050511 nmdc:mga08y16_387558_c1 nmdc:mga08y16_387558_c1_340_783 147
114 3300050514 nmdc:mga08x19_392254_c1 nmdc:mga08x19_392254_c1_10_453 147
115 3300050515 nmdc:mga0a205_510108_c1 nmdc:mga0a205_510108_c1_416_859 147
116 3300005438 Ga0070701_10080138 Ga0070701_100801383 148
117 3300005468 Ga0070707_100784951 Ga0070707_1007849512 148
118 3300005719 Ga0068861_100465845 Ga0068861_1004658452 148
119 3300006847 Ga0075431_101145383 Ga0075431_1011453832 148
120 3300006871 Ga0075434_100507049 Ga0075434_1005070491 148
121 3300006914 Ga0075436_100073632 Ga0075436_1000736324 148
122 3300009147 Ga0114129_10017643 Ga0114129_100176434 148
123 3300009147 Ga0114129_10144675 Ga0114129_101446754 148
124 3300014326 Ga0157380_10221310 Ga0157380_102213103 148
125 3300025916 Ga0207663_10300205 Ga0207663_103002052 148
126 3300025922 Ga0207646_10906347 Ga0207646_109063471 148
127 3300026118 Ga0207675_100507441 Ga0207675_1005074412 148
128 3300035170 Ga0373943_0047602 Ga0373943_0047602_734_1183 148
129 3300035171 Ga0373946_0020668 Ga0373946_0020668_645_1094 148
130 3300035172 Ga0373955_0196130 Ga0373955_0196130_374_823 148
131 3300035410 Ga0373924_0004135 Ga0373924_0004135_3838_4287 148
132 3300035691 Ga0373931_0175806 Ga0373931_0175806_377_826 148
133 3300035725 Ga0373947_0290213 Ga0373947_0290213_493_942 148
134 3300036401 Ga0373937_0210288 Ga0373937_0210288_597_1046 148
135 3300036401 Ga0373937_0484856 Ga0373937_0484856_16_465 148
136 3300037068 Ga0373925_0084892 Ga0373925_0084892_1794_2243 148
137 3300046511 Ga0495608_0207483 Ga0495608_0207483_381_830 148
138 3300046535 Ga0495586_0188833 Ga0495586_0188833_391_840 148
139 3300046559 Ga0495667_0594888 Ga0495667_0594888_13_462 148
140 3300047317 Ga0495604_0245598 Ga0495604_0245598_202_651 148
141 3300048905 Ga0496102_1159480 Ga0496102_1159480_31_480 148
142 3300048909 Ga0496106_0151818 Ga0496106_0151818_333_782 148
143 3300048917 Ga0496114_0606260 Ga0496114_0606260_489_938 148
144 3300049583 Ga0501067_0727124 Ga0501067_0727124_51_500 148
145 3300049590 Ga0501074_0270460 Ga0501074_0270460_37_486 148
146 3300049590 Ga0501074_0892690 Ga0501074_0892690_24_470 148
147 3300049744 Ga0501083_0103408 Ga0501083_0103408_1392_1841 148
148 3300050507 nmdc:mga05p37_107964_c1 nmdc:mga05p37_107964_c1_1816_2265 148
149 3300050507 nmdc:mga05p37_69288_c1 nmdc:mga05p37_69288_c1_1089_1535 148
150 3300050508 nmdc:mga09592_319796_c1 nmdc:mga09592_319796_c1_109_558 148
151 3300050510 nmdc:mga06r32_1059261_c1 nmdc:mga06r32_1059261_c1_245_694 148
152 3300050512 nmdc:mga0n895_1010278_c1 nmdc:mga0n895_1010278_c1_42_491 148
153 3300053077 Ga0495601_0054820 Ga0495601_0054820_989_1438 148
154 3300005459 Ga0068867_100084482 Ga0068867_1000844823 149
155 3300005471 Ga0070698_100574592 Ga0070698_1005745922 149
156 3300005544 Ga0070686_100970672 Ga0070686_1009706721 149
157 3300005548 Ga0070665_100060285 Ga0070665_1000602853 149
158 3300005578 Ga0068854_100304577 Ga0068854_1003045772 149
159 3300005615 Ga0070702_100282696 Ga0070702_1002826962 149
160 3300005718 Ga0068866_10065003 Ga0068866_100650032 149
161 3300005718 Ga0068866_10218678 Ga0068866_102186782 149
162 3300005841 Ga0068863_100005016 Ga0068863_1000050169 149
163 3300005844 Ga0068862_100653697 Ga0068862_1006536972 149
164 3300006237 Ga0097621_100004036 Ga0097621_1000040363 149
165 3300006358 Ga0068871_100018638 Ga0068871_1000186384 149
166 3300006358 Ga0068871_101322392 Ga0068871_1013223921 149
167 3300006844 Ga0075428_102103614 Ga0075428_1021036141 149
168 3300006852 Ga0075433_10046534 Ga0075433_100465343 149
169 3300006871 Ga0075434_100822336 Ga0075434_1008223362 149
170 3300006881 Ga0068865_100010841 Ga0068865_1000108413 149
171 3300006881 Ga0068865_100928936 Ga0068865_1009289362 149
172 3300009093 Ga0105240_10055649 Ga0105240_100556493 149
173 3300009094 Ga0111539_12326616 Ga0111539_123266162 149
174 3300009147 Ga0114129_10022079 Ga0114129_100220798 149
175 3300009176 Ga0105242_10008808 Ga0105242_100088082 149
176 3300009177 Ga0105248_10048794 Ga0105248_100487944 149
177 3300009177 Ga0105248_10067231 Ga0105248_100672314 149
178 3300009177 Ga0105248_10264083 Ga0105248_102640833 149
179 3300009551 Ga0105238_10410782 Ga0105238_104107822 149
180 3300013297 Ga0157378_11646602 Ga0157378_116466022 149
181 3300013306 Ga0163162_10676333 Ga0163162_106763332 149
182 3300017792 Ga0163161_10506348 Ga0163161_105063481 149
183 3300025899 Ga0207642_10043599 Ga0207642_100435993 149
184 3300025913 Ga0207695_10090095 Ga0207695_100900953 149
185 3300025924 Ga0207694_11234975 Ga0207694_112349751 149
186 3300025934 Ga0207686_10146186 Ga0207686_101461862 149
187 3300025934 Ga0207686_10165519 Ga0207686_101655193 149
188 3300025934 Ga0207686_11491185 Ga0207686_114911851 149
189 3300025938 Ga0207704_10223761 Ga0207704_102237612 149
190 3300025941 Ga0207711_10053400 Ga0207711_100534003 149
191 3300025941 Ga0207711_10416292 Ga0207711_104162923 149
192 3300025942 Ga0207689_10115283 Ga0207689_101152833 149
193 3300025981 Ga0207640_10469779 Ga0207640_104697792 149
194 3300026023 Ga0207677_10061753 Ga0207677_100617532 149
195 3300026088 Ga0207641_10000409 Ga0207641_1000040938 149
196 3300026089 Ga0207648_10110043 Ga0207648_101100431 149
197 3300026121 Ga0207683_10063576 Ga0207683_100635763 149
198 3300028379 Ga0268266_10021671 Ga0268266_100216712 149
199 3300035171 Ga0373946_0176935 Ga0373946_0176935_333_782 149
200 3300035691 Ga0373931_1285017 Ga0373931_1285017_30_479 149
201 3300037068 Ga0373925_0374701 Ga0373925_0374701_571_1020 149
202 3300037471 Ga0395905_0939461 Ga0395905_0939461_269_718 149
203 3300039437 Ga0436365_1490266 Ga0436365_1490266_394_852 149
204 3300046681 Ga0495647_0509222 Ga0495647_0509222_64_513 149
205 3300047471 Ga0495684_0503027 Ga0495684_0503027_68_517 149
206 3300048913 Ga0496110_0638342 Ga0496110_0638342_475_924 149
207 3300048914 Ga0496111_0397101 Ga0496111_0397101_545_994 149
208 3300048917 Ga0496114_0051446 Ga0496114_0051446_648_1097 149
209 3300049743 Ga0501081_0822967 Ga0501081_0822967_53_505 149
210 3300050507 nmdc:mga05p37_37664_c1 nmdc:mga05p37_37664_c1_794_1243 149
211 3300050511 nmdc:mga08y16_1443994_c1 nmdc:mga08y16_1443994_c1_33_482 149
212 3300050512 nmdc:mga0n895_28896_c1 nmdc:mga0n895_28896_c1_4270_4719 149
213 3300050515 nmdc:mga0a205_7558_c1 nmdc:mga0a205_7558_c1_4848_5297 149
214 3300005340 Ga0070689_100785226 Ga0070689_1007852262 150
215 3300005347 Ga0070668_100122329 Ga0070668_1001223293 150
216 3300005444 Ga0070694_100027053 Ga0070694_1000270534 150
217 3300005468 Ga0070707_100084050 Ga0070707_1000840503 150
218 3300005543 Ga0070672_101259526 Ga0070672_1012595262 150
219 3300005544 Ga0070686_100020604 Ga0070686_1000206044 150
220 3300005545 Ga0070695_100001695 Ga0070695_1000016954 150
221 3300005549 Ga0070704_100015718 Ga0070704_1000157184 150
222 3300005617 Ga0068859_100336530 Ga0068859_1003365302 150
223 3300005937 Ga0081455_10072530 Ga0081455_100725301 150
224 3300006237 Ga0097621_100028133 Ga0097621_1000281332 150
225 3300006852 Ga0075433_10092356 Ga0075433_100923564 150
226 3300006871 Ga0075434_100018222 Ga0075434_1000182227 150
227 3300006871 Ga0075434_100808510 Ga0075434_1008085101 150
228 3300006931 Ga0097620_100336519 Ga0097620_1003365192 150
229 3300007076 Ga0075435_101147291 Ga0075435_1011472911 150
230 3300009094 Ga0111539_10154875 Ga0111539_101548752 150
231 3300009094 Ga0111539_10216470 Ga0111539_102164702 150
232 3300009147 Ga0114129_10021953 Ga0114129_100219535 150
233 3300009147 Ga0114129_10241928 Ga0114129_102419282 150
234 3300012508 Ga0157315_1004231 Ga0157315_10042311 150
235 3300014326 Ga0157380_10213559 Ga0157380_102135593 150
236 3300014745 Ga0157377_11136023 Ga0157377_111360231 150
237 3300025922 Ga0207646_10055015 Ga0207646_100550153 150
238 3300025923 Ga0207681_10003563 Ga0207681_100035639 150
239 3300025933 Ga0207706_10182934 Ga0207706_101829342 150
240 3300025960 Ga0207651_10180221 Ga0207651_101802213 150
241 3300026075 Ga0207708_11642992 Ga0207708_116429921 150
242 3300045051 Ga0451576_1057668 Ga0451576_1057668_52_513 150
243 3300046684 Ga0495669_0138623 Ga0495669_0138623_159_611 150
244 3300046691 Ga0495670_0591930 Ga0495670_0591930_69_521 150
245 3300050507 nmdc:mga05p37_20635_c1 nmdc:mga05p37_20635_c1_7094_7555 150
246 3300050507 nmdc:mga05p37_52257_c1 nmdc:mga05p37_52257_c1_1982_2434 150
247 3300050511 nmdc:mga08y16_35689_c1 nmdc:mga08y16_35689_c1_1068_1535 150
248 3300050512 nmdc:mga0n895_287332_c1 nmdc:mga0n895_287332_c1_1072_1524 150
249 3300050512 nmdc:mga0n895_4602_c1 nmdc:mga0n895_4602_c1_6401_6868 150
250 3300050513 nmdc:mga0rr50_1604413_c1 nmdc:mga0rr50_1604413_c1_61_528 150
251 3300050513 nmdc:mga0rr50_494033_c1 nmdc:mga0rr50_494033_c1_528_980 150
252 3300050515 nmdc:mga0a205_78553_c1 nmdc:mga0a205_78553_c1_2383_2844 150
253 3300005544 Ga0070686_100229389 Ga0070686_1002293892 151
254 3300005617 Ga0068859_102075476 Ga0068859_1020754761 151
255 3300006931 Ga0097620_102075417 Ga0097620_1020754171 151
256 3300025925 Ga0207650_10374279 Ga0207650_103742792 151
257 3300026078 Ga0207702_10816842 Ga0207702_108168422 151
258 3300050512 nmdc:mga0n895_965590_c1 nmdc:mga0n895_965590_c1_357_815 151
259 3300006914 Ga0075436_100008912 Ga0075436_1000089125 152
260 3300009147 Ga0114129_10107497 Ga0114129_101074974 152
261 3300048911 Ga0496108_0296291 Ga0496108_0296291_910_1377 152
262 3300050507 nmdc:mga05p37_3684_c1 nmdc:mga05p37_3684_c1_10289_10750 152
263 3300050514 nmdc:mga08x19_39672_c1 nmdc:mga08x19_39672_c1_400_861 152
264 3300050515 nmdc:mga0a205_315033_c1 nmdc:mga0a205_315033_c1_531_992 152
265 3300005330 Ga0070690_100129344 Ga0070690_1001293443 153
266 3300005365 Ga0070688_100071470 Ga0070688_1000714703 153
267 3300005445 Ga0070708_100156923 Ga0070708_1001569232 153
268 3300005468 Ga0070707_100629086 Ga0070707_1006290862 153
269 3300005471 Ga0070698_100243480 Ga0070698_1002434802 153
270 3300005518 Ga0070699_100987875 Ga0070699_1009878751 153
271 3300005543 Ga0070672_100009661 Ga0070672_1000096614 153
272 3300005615 Ga0070702_100211459 Ga0070702_1002114592 153
273 3300005617 Ga0068859_100299955 Ga0068859_1002999553 153
274 3300005843 Ga0068860_100045904 Ga0068860_1000459044 153
275 3300006852 Ga0075433_11050299 Ga0075433_110502991 153
276 3300006881 Ga0068865_100654990 Ga0068865_1006549902 153
277 3300006931 Ga0097620_100299978 Ga0097620_1002999783 153
278 3300007076 Ga0075435_100585905 Ga0075435_1005859052 153
279 3300009147 Ga0114129_10013254 Ga0114129_100132544 153
280 3300009176 Ga0105242_10118538 Ga0105242_101185383 153
281 3300009177 Ga0105248_10024038 Ga0105248_100240384 153
282 3300009553 Ga0105249_10400993 Ga0105249_104009932 153
283 3300013306 Ga0163162_10075478 Ga0163162_100754785 153
284 3300014968 Ga0157379_10019939 Ga0157379_100199398 153
285 3300025938 Ga0207704_10790085 Ga0207704_107900852 153
286 3300025940 Ga0207691_10004571 Ga0207691_100045719 153
287 3300025941 Ga0207711_10173788 Ga0207711_101737883 153
288 3300027907 Ga0207428_10066085 Ga0207428_100660852 153
289 3300028381 Ga0268264_10074400 Ga0268264_100744003 153
290 3300031711 Ga0265314_10106224 Ga0265314_101062241 153
291 3300044706 Ga0466964_0553805 Ga0466964_0553805_116_589 153
292 3300048910 Ga0496107_0181096 Ga0496107_0181096_791_1252 153
293 3300050507 nmdc:mga05p37_12817_c1 nmdc:mga05p37_12817_c1_4848_5309 153
294 3300050511 nmdc:mga08y16_7643_c1 nmdc:mga08y16_7643_c1_3648_4127 153
295 3300050513 nmdc:mga0rr50_565806_c1 nmdc:mga0rr50_565806_c1_275_751 153
296 3300050515 nmdc:mga0a205_877912_c1 nmdc:mga0a205_877912_c1_204_665 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

3

103

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.824 1 151
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8094 1 151
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.7966 2 148
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.7822 1 149
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.782 2 148
ID Description Score Start End Superfamily
af_Q7TP58_1_230_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.88 3 66 3.40.50.1240
3h6jA01 Mainly Beta;6 Propeller;Neuraminidase; 0.8187 128 150 2.120.10.10
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7976 1 151 3.40.50.1240
af_K7TSF9_113_270_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7848 8 75 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7838 1 151 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A6B0WGF9-F1-model_v4 Phosphohistidine phosphatase SixA 0.8992 3 148
AF-A0A2W6AQ17-F1-model_v4 Phosphohistidine phosphatase SixA 0.8895 1 151 GO:0005737
GO:0036211
GO:0101006
AF-A0A2E7BLD1-F1-model_v4 Phosphohistidine phosphatase SixA 0.8889 1 153
AF-A0A1G1BX12-F1-model_v4 Phosphohistidine phosphatase SixA 0.8862 1 149 GO:0005737
GO:0036211
GO:0101006
AF-A0A2V7W632-F1-model_v4 Phosphohistidine phosphatase SixA 0.8837 2 149 GO:0005737
GO:0036211
GO:0101006

Feature Viewer

pLDDT pTM Quality
89.45 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map