F393305
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 296 | 157 | 296 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0939461|Ga0395905_0939461_269_718 |
| Length | 149 |
| Sequence | MRLFLVHHGEAVGPEVDARRPLSDAGRAAVERLADRAAARGVKPAVVWHSGKLRAKQTAEAFWRACNPLAELAATRDLQPDDPADWMRDRLRGESRDVLIAGHFPHLPRLLSLLVGRDDFPTHGVVALRSDDEGETWQEAWRLGIQNYG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 103 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 104 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 105 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 106 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 117 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 118 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.43 |
| Rhizosphere | 92.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100129344 | 3300005330 | Bacteria | 1704 |
| 2 | Ga0070689_100785226 | 3300005340 | Unclassified | 837 |
| 3 | Ga0070668_100122329 | 3300005347 | Bacteria | 2081 |
| 4 | Ga0070674_100562903 | 3300005356 | Bacteria | 958 |
| 5 | Ga0070688_100071470 | 3300005365 | Bacteria | 2222 |
| 6 | Ga0070709_10758124 | 3300005434 | Unclassified | 759 |
| 7 | Ga0070701_10080138 | 3300005438 | Bacteria | 1765 |
| 8 | Ga0070711_101536397 | 3300005439 | Unclassified | 581 |
| 9 | Ga0070694_100027053 | 3300005444 | Bacteria | 3722 |
| 10 | Ga0070708_100050146 | 3300005445 | Bacteria | 3695 |
| 11 | Ga0070708_100156923 | 3300005445 | Bacteria | 2119 |
| 12 | Ga0070678_100388669 | 3300005456 | Bacteria | 1209 |
| 13 | Ga0070681_10230723 | 3300005458 | Bacteria | 1766 |
| 14 | Ga0068867_100048955 | 3300005459 | Bacteria | 3111 |
| 15 | Ga0068867_100084482 | 3300005459 | Unclassified | 2398 |
| 16 | Ga0070685_10867277 | 3300005466 | Unclassified | 670 |
| 17 | Ga0070707_100084050 | 3300005468 | Unclassified | 3076 |
| 18 | Ga0070707_100629086 | 3300005468 | Unclassified | 1036 |
| 19 | Ga0070707_100784951 | 3300005468 | Unclassified | 916 |
| 20 | Ga0070698_100243480 | 3300005471 | Bacteria | 1731 |
| 21 | Ga0070698_100574592 | 3300005471 | Bacteria | 1067 |
| 22 | Ga0070699_100005320 | 3300005518 | Bacteria | 11294 |
| 23 | Ga0070699_100987875 | 3300005518 | Bacteria | 772 |
| 24 | Ga0070672_100009661 | 3300005543 | Bacteria | 6659 |
| 25 | Ga0070672_101259526 | 3300005543 | Bacteria | 660 |
| 26 | Ga0070686_100020604 | 3300005544 | Bacteria | 3904 |
| 27 | Ga0070686_100229389 | 3300005544 | Bacteria | 1346 |
| 28 | Ga0070686_100970672 | 3300005544 | Bacteria | 695 |
| 29 | Ga0070695_100001695 | 3300005545 | Bacteria | 12416 |
| 30 | Ga0070665_100024453 | 3300005548 | Bacteria | 6083 |
| 31 | Ga0070665_100060285 | 3300005548 | Bacteria | 3803 |
| 32 | Ga0070704_100015718 | 3300005549 | Bacteria | 4764 |
| 33 | Ga0070704_100497814 | 3300005549 | Bacteria | 1057 |
| 34 | Ga0068855_100574696 | 3300005563 | Bacteria | 1218 |
| 35 | Ga0070664_100789987 | 3300005564 | Bacteria | 887 |
| 36 | Ga0068854_100304577 | 3300005578 | Bacteria | 1290 |
| 37 | Ga0070702_100211459 | 3300005615 | Bacteria | 1291 |
| 38 | Ga0070702_100282696 | 3300005615 | Bacteria | 1140 |
| 39 | Ga0068859_100299955 | 3300005617 | Unclassified | 1700 |
| 40 | Ga0068859_100336530 | 3300005617 | Bacteria | 1604 |
| 41 | Ga0068859_102075476 | 3300005617 | Bacteria | 628 |
| 42 | Ga0068859_103121396 | 3300005617 | Unclassified | 505 |
| 43 | Ga0068866_10065003 | 3300005718 | Bacteria | 1907 |
| 44 | Ga0068866_10218678 | 3300005718 | Bacteria | 1148 |
| 45 | Ga0068866_10368685 | 3300005718 | Bacteria | 917 |
| 46 | Ga0068861_100465845 | 3300005719 | Archaea | 1135 |
| 47 | Ga0068870_10405288 | 3300005840 | Unclassified | 888 |
| 48 | Ga0068863_100005016 | 3300005841 | Bacteria | 13049 |
| 49 | Ga0068858_100497097 | 3300005842 | Bacteria | 1178 |
| 50 | Ga0068860_100045904 | 3300005843 | Bacteria | 4166 |
| 51 | Ga0068862_100016971 | 3300005844 | Bacteria | 6059 |
| 52 | Ga0068862_100653697 | 3300005844 | Bacteria | 1014 |
| 53 | Ga0068862_101027852 | 3300005844 | Bacteria | 816 |
| 54 | Ga0081455_10072530 | 3300005937 | Bacteria | 2850 |
| 55 | Ga0070715_10465108 | 3300006163 | Unclassified | 717 |
| 56 | Ga0070712_100435732 | 3300006175 | Unclassified | 1089 |
| 57 | Ga0097621_100004036 | 3300006237 | Bacteria | 10179 |
| 58 | Ga0097621_100012095 | 3300006237 | Bacteria | 6387 |
| 59 | Ga0097621_100022205 | 3300006237 | Bacteria | 4923 |
| 60 | Ga0097621_100028133 | 3300006237 | Bacteria | 4429 |
| 61 | Ga0068871_100002184 | 3300006358 | Bacteria | 13293 |
| 62 | Ga0068871_100018638 | 3300006358 | Bacteria | 5281 |
| 63 | Ga0068871_100027733 | 3300006358 | Bacteria | 4432 |
| 64 | Ga0068871_100119182 | 3300006358 | Bacteria | 2227 |
| 65 | Ga0068871_101322392 | 3300006358 | Unclassified | 678 |
| 66 | Ga0075428_102103614 | 3300006844 | Unclassified | 584 |
| 67 | Ga0075431_101145383 | 3300006847 | Unclassified | 742 |
| 68 | Ga0075433_10046534 | 3300006852 | Unclassified | 3774 |
| 69 | Ga0075433_10092356 | 3300006852 | Bacteria | 2677 |
| 70 | Ga0075433_11050299 | 3300006852 | Bacteria | 709 |
| 71 | Ga0075434_100018222 | 3300006871 | Bacteria | 6780 |
| 72 | Ga0075434_100507049 | 3300006871 | Bacteria | 1227 |
| 73 | Ga0075434_100808510 | 3300006871 | Bacteria | 954 |
| 74 | Ga0075434_100822336 | 3300006871 | Unclassified | 945 |
| 75 | Ga0075434_101390183 | 3300006871 | Bacteria | 712 |
| 76 | Ga0068865_100010841 | 3300006881 | Bacteria | 5686 |
| 77 | Ga0068865_100195298 | 3300006881 | Bacteria | 1568 |
| 78 | Ga0068865_100654990 | 3300006881 | Unclassified | 893 |
| 79 | Ga0068865_100928936 | 3300006881 | Unclassified | 758 |
| 80 | Ga0075436_100004695 | 3300006914 | Bacteria | 9371 |
| 81 | Ga0075436_100008912 | 3300006914 | Bacteria | 6868 |
| 82 | Ga0075436_100073632 | 3300006914 | Bacteria | 2364 |
| 83 | Ga0075436_100145068 | 3300006914 | Bacteria | 1669 |
| 84 | Ga0097620_100299978 | 3300006931 | Unclassified | 1700 |
| 85 | Ga0097620_100336519 | 3300006931 | Bacteria | 1604 |
| 86 | Ga0097620_102075417 | 3300006931 | Bacteria | 628 |
| 87 | Ga0097620_103122474 | 3300006931 | Unclassified | 505 |
| 88 | Ga0075435_100036123 | 3300007076 | Bacteria | 3925 |
| 89 | Ga0075435_100585905 | 3300007076 | Unclassified | 967 |
| 90 | Ga0075435_101147291 | 3300007076 | Bacteria | 680 |
| 91 | Ga0105240_10055649 | 3300009093 | Bacteria | 4953 |
| 92 | Ga0111539_10154875 | 3300009094 | Bacteria | 2682 |
| 93 | Ga0111539_10216470 | 3300009094 | Bacteria | 2231 |
| 94 | Ga0111539_10346575 | 3300009094 | Bacteria | 1729 |
| 95 | Ga0111539_11408417 | 3300009094 | Unclassified | 809 |
| 96 | Ga0111539_11723091 | 3300009094 | Bacteria | 727 |
| 97 | Ga0111539_12326616 | 3300009094 | Bacteria | 622 |
| 98 | Ga0105245_10018779 | 3300009098 | Bacteria | 6049 |
| 99 | Ga0114129_10013254 | 3300009147 | Bacteria | 11742 |
| 100 | Ga0114129_10017643 | 3300009147 | Bacteria | 10162 |
| 101 | Ga0114129_10021953 | 3300009147 | Bacteria | 9058 |
| 102 | Ga0114129_10022079 | 3300009147 | Bacteria | 9031 |
| 103 | Ga0114129_10107497 | 3300009147 | Bacteria | 3853 |
| 104 | Ga0114129_10144675 | 3300009147 | Bacteria | 3257 |
| 105 | Ga0114129_10241928 | 3300009147 | Bacteria | 2426 |
| 106 | Ga0114129_10837126 | 3300009147 | Bacteria | 1171 |
| 107 | Ga0105242_10008808 | 3300009176 | Bacteria | 7743 |
| 108 | Ga0105242_10041094 | 3300009176 | Bacteria | 3728 |
| 109 | Ga0105242_10118538 | 3300009176 | Unclassified | 2267 |
| 110 | Ga0105242_10133611 | 3300009176 | Bacteria | 2145 |
| 111 | Ga0105248_10024038 | 3300009177 | Bacteria | 6773 |
| 112 | Ga0105248_10048794 | 3300009177 | Unclassified | 4749 |
| 113 | Ga0105248_10067231 | 3300009177 | Bacteria | 4023 |
| 114 | Ga0105248_10264083 | 3300009177 | Bacteria | 1938 |
| 115 | Ga0105248_10586588 | 3300009177 | Bacteria | 1258 |
| 116 | Ga0105248_10942601 | 3300009177 | Bacteria | 975 |
| 117 | Ga0105238_10410782 | 3300009551 | Bacteria | 1347 |
| 118 | Ga0105249_10400993 | 3300009553 | Bacteria | 1402 |
| 119 | Ga0105249_10482251 | 3300009553 | Bacteria | 1283 |
| 120 | Ga0157315_1004231 | 3300012508 | Unclassified | 1016 |
| 121 | Ga0157374_12193929 | 3300013296 | Unclassified | 579 |
| 122 | Ga0157378_10413053 | 3300013297 | Unclassified | 1332 |
| 123 | Ga0157378_11646602 | 3300013297 | Bacteria | 688 |
| 124 | Ga0163162_10075478 | 3300013306 | Unclassified | 3432 |
| 125 | Ga0163162_10557245 | 3300013306 | Bacteria | 1274 |
| 126 | Ga0163162_10676333 | 3300013306 | Bacteria | 1155 |
| 127 | Ga0157375_11879665 | 3300013308 | Bacteria | 710 |
| 128 | Ga0157380_10213559 | 3300014326 | Bacteria | 1721 |
| 129 | Ga0157380_10221310 | 3300014326 | Bacteria | 1694 |
| 130 | Ga0157377_11136023 | 3300014745 | Bacteria | 601 |
| 131 | Ga0157379_10019939 | 3300014968 | Bacteria | 5924 |
| 132 | Ga0157376_10091823 | 3300014969 | Unclassified | 2631 |
| 133 | Ga0157376_10145299 | 3300014969 | Bacteria | 2132 |
| 134 | Ga0157376_10352525 | 3300014969 | Bacteria | 1409 |
| 135 | Ga0163161_10506348 | 3300017792 | Bacteria | 984 |
| 136 | Ga0207642_10043599 | 3300025899 | Bacteria | 1980 |
| 137 | Ga0207688_10383422 | 3300025901 | Bacteria | 870 |
| 138 | Ga0207685_10365463 | 3300025905 | Unclassified | 731 |
| 139 | Ga0207645_10417015 | 3300025907 | Bacteria | 904 |
| 140 | Ga0207707_10334288 | 3300025912 | Unclassified | 1307 |
| 141 | Ga0207695_10090095 | 3300025913 | Bacteria | 3083 |
| 142 | Ga0207693_10703168 | 3300025915 | Unclassified | 783 |
| 143 | Ga0207663_10300205 | 3300025916 | Bacteria | 1199 |
| 144 | Ga0207663_11039591 | 3300025916 | Unclassified | 658 |
| 145 | Ga0207646_10055015 | 3300025922 | Bacteria | 3559 |
| 146 | Ga0207646_10906347 | 3300025922 | Bacteria | 782 |
| 147 | Ga0207681_10003563 | 3300025923 | Bacteria | 9696 |
| 148 | Ga0207694_11234975 | 3300025924 | Unclassified | 632 |
| 149 | Ga0207650_10374279 | 3300025925 | Bacteria | 1175 |
| 150 | Ga0207687_10032953 | 3300025927 | Bacteria | 3512 |
| 151 | Ga0207664_10038327 | 3300025929 | Bacteria | 3716 |
| 152 | Ga0207706_10182934 | 3300025933 | Unclassified | 1841 |
| 153 | Ga0207686_10008529 | 3300025934 | Bacteria | 5536 |
| 154 | Ga0207686_10146186 | 3300025934 | Bacteria | 1640 |
| 155 | Ga0207686_10165519 | 3300025934 | Bacteria | 1554 |
| 156 | Ga0207686_10329434 | 3300025934 | Unclassified | 1143 |
| 157 | Ga0207686_11491185 | 3300025934 | Unclassified | 557 |
| 158 | Ga0207704_10126394 | 3300025938 | Unclassified | 1761 |
| 159 | Ga0207704_10223761 | 3300025938 | Bacteria | 1394 |
| 160 | Ga0207704_10271588 | 3300025938 | Bacteria | 1284 |
| 161 | Ga0207704_10790085 | 3300025938 | Unclassified | 792 |
| 162 | Ga0207691_10004571 | 3300025940 | Bacteria | 13400 |
| 163 | Ga0207711_10053400 | 3300025941 | Bacteria | 3466 |
| 164 | Ga0207711_10173788 | 3300025941 | Unclassified | 1956 |
| 165 | Ga0207711_10238721 | 3300025941 | Bacteria | 1666 |
| 166 | Ga0207711_10416292 | 3300025941 | Unclassified | 1249 |
| 167 | Ga0207711_10514341 | 3300025941 | Bacteria | 1116 |
| 168 | Ga0207689_10027005 | 3300025942 | Bacteria | 4806 |
| 169 | Ga0207689_10115283 | 3300025942 | Bacteria | 2209 |
| 170 | Ga0207651_10180221 | 3300025960 | Bacteria | 1675 |
| 171 | Ga0207651_11326505 | 3300025960 | Unclassified | 647 |
| 172 | Ga0207640_10469779 | 3300025981 | Unclassified | 1041 |
| 173 | Ga0207677_10061753 | 3300026023 | Bacteria | 2596 |
| 174 | Ga0207677_10200576 | 3300026023 | Bacteria | 1585 |
| 175 | Ga0207703_10265072 | 3300026035 | Bacteria | 1554 |
| 176 | Ga0207708_11642992 | 3300026075 | Unclassified | 564 |
| 177 | Ga0207702_10816842 | 3300026078 | Unclassified | 922 |
| 178 | Ga0207641_10000409 | 3300026088 | Bacteria | 50240 |
| 179 | Ga0207641_10921884 | 3300026088 | Unclassified | 868 |
| 180 | Ga0207648_10053173 | 3300026089 | Bacteria | 3540 |
| 181 | Ga0207648_10110043 | 3300026089 | Unclassified | 2418 |
| 182 | Ga0207648_11114323 | 3300026089 | Bacteria | 740 |
| 183 | Ga0207675_100507441 | 3300026118 | Archaea | 1201 |
| 184 | Ga0207675_102348669 | 3300026118 | Bacteria | 546 |
| 185 | Ga0207683_10063576 | 3300026121 | Bacteria | 3251 |
| 186 | Ga0207683_10063741 | 3300026121 | Bacteria | 3247 |
| 187 | Ga0207428_10066085 | 3300027907 | Unclassified | 2850 |
| 188 | Ga0207428_10090188 | 3300027907 | Bacteria | 2381 |
| 189 | Ga0207428_10259264 | 3300027907 | Bacteria | 1295 |
| 190 | Ga0207428_10389484 | 3300027907 | Unclassified | 1021 |
| 191 | Ga0268266_10021671 | 3300028379 | Bacteria | 5475 |
| 192 | Ga0268266_10167761 | 3300028379 | Bacteria | 1990 |
| 193 | Ga0268265_10002410 | 3300028380 | Bacteria | 14131 |
| 194 | Ga0268264_10074400 | 3300028381 | Unclassified | 2885 |
| 195 | Ga0268264_10561132 | 3300028381 | Unclassified | 1121 |
| 196 | Ga0265316_10968745 | 3300031344 | Unclassified | 593 |
| 197 | Ga0265314_10106224 | 3300031711 | Bacteria | 1794 |
| 198 | Ga0373940_0072706 | 3300035088 | Bacteria | 1004 |
| 199 | Ga0373936_0236633 | 3300035113 | Unclassified | 813 |
| 200 | Ga0373954_0123512 | 3300035118 | Bacteria | 1258 |
| 201 | Ga0373943_0047602 | 3300035170 | Bacteria | 2097 |
| 202 | Ga0373946_0020668 | 3300035171 | Bacteria | 2546 |
| 203 | Ga0373946_0176935 | 3300035171 | Bacteria | 1011 |
| 204 | Ga0373955_0196130 | 3300035172 | Archaea | 1201 |
| 205 | Ga0373924_0004135 | 3300035410 | Bacteria | 5049 |
| 206 | Ga0373924_0497595 | 3300035410 | Bacteria | 548 |
| 207 | Ga0373931_0175806 | 3300035691 | Bacteria | 1264 |
| 208 | Ga0373931_1285017 | 3300035691 | Bacteria | 503 |
| 209 | Ga0373947_0290213 | 3300035725 | Archaea | 1089 |
| 210 | Ga0373937_0210288 | 3300036401 | Bacteria | 1830 |
| 211 | Ga0373937_0484856 | 3300036401 | Unclassified | 1174 |
| 212 | Ga0373925_0084892 | 3300037068 | Bacteria | 2413 |
| 213 | Ga0373925_0374701 | 3300037068 | Unclassified | 1158 |
| 214 | Ga0395905_0939461 | 3300037471 | Unclassified | 768 |
| 215 | Ga0395901_0895137 | 3300038443 | Bacteria | 870 |
| 216 | Ga0436365_1490266 | 3300039437 | Bacteria | 1207 |
| 217 | Ga0439459_0199971 | 3300042438 | Bacteria | 545 |
| 218 | Ga0450916_066908 | 3300042530 | Unclassified | 593 |
| 219 | Ga0466964_0553805 | 3300044706 | Unclassified | 625 |
| 220 | Ga0451576_1057668 | 3300045051 | Unclassified | 850 |
| 221 | Ga0495629_0375322 | 3300046459 | Unclassified | 968 |
| 222 | Ga0495608_0207483 | 3300046511 | Bacteria | 1233 |
| 223 | Ga0495640_0174851 | 3300046533 | Bacteria | 1371 |
| 224 | Ga0495586_0188833 | 3300046535 | Bacteria | 1167 |
| 225 | Ga0495667_0594888 | 3300046559 | Unclassified | 689 |
| 226 | Ga0495634_0500085 | 3300046642 | Unclassified | 713 |
| 227 | Ga0495635_0781997 | 3300046663 | Unclassified | 616 |
| 228 | Ga0495647_0040171 | 3300046681 | Unclassified | 1777 |
| 229 | Ga0495647_0509222 | 3300046681 | Unclassified | 561 |
| 230 | Ga0495669_0019122 | 3300046684 | Unclassified | 2954 |
| 231 | Ga0495669_0138623 | 3300046684 | Unclassified | 1148 |
| 232 | Ga0495670_0591930 | 3300046691 | Bacteria | 604 |
| 233 | Ga0495604_0245598 | 3300047317 | Bacteria | 1222 |
| 234 | Ga0495684_0503027 | 3300047471 | Bacteria | 833 |
| 235 | Ga0496100_0000944 | 3300048903 | Bacteria | 13902 |
| 236 | Ga0496101_0073680 | 3300048904 | Bacteria | 2509 |
| 237 | Ga0496102_0090478 | 3300048905 | Bacteria | 2832 |
| 238 | Ga0496102_1159480 | 3300048905 | Unclassified | 692 |
| 239 | Ga0496104_0006346 | 3300048907 | Bacteria | 10397 |
| 240 | Ga0496104_0477457 | 3300048907 | Bacteria | 1158 |
| 241 | Ga0496105_0631746 | 3300048908 | Bacteria | 828 |
| 242 | Ga0496105_0994251 | 3300048908 | Bacteria | 628 |
| 243 | Ga0496106_0061545 | 3300048909 | Bacteria | 2848 |
| 244 | Ga0496106_0151818 | 3300048909 | Bacteria | 1828 |
| 245 | Ga0496107_0034890 | 3300048910 | Bacteria | 3605 |
| 246 | Ga0496107_0181096 | 3300048910 | Unclassified | 1565 |
| 247 | Ga0496108_0245984 | 3300048911 | Bacteria | 1556 |
| 248 | Ga0496108_0296291 | 3300048911 | Bacteria | 1409 |
| 249 | Ga0496110_0418217 | 3300048913 | Bacteria | 1222 |
| 250 | Ga0496110_0638342 | 3300048913 | Bacteria | 964 |
| 251 | Ga0496111_0397101 | 3300048914 | Unclassified | 1019 |
| 252 | Ga0496112_1370717 | 3300048915 | Unclassified | 622 |
| 253 | Ga0496114_0007259 | 3300048917 | Bacteria | 8752 |
| 254 | Ga0496114_0051446 | 3300048917 | Unclassified | 3430 |
| 255 | Ga0496114_0606260 | 3300048917 | Unclassified | 965 |
| 256 | Ga0496114_1469135 | 3300048917 | Bacteria | 569 |
| 257 | Ga0501067_0727124 | 3300049583 | Unclassified | 558 |
| 258 | Ga0501074_0270460 | 3300049590 | Unclassified | 1208 |
| 259 | Ga0501074_0892690 | 3300049590 | Bacteria | 626 |
| 260 | Ga0501081_0822967 | 3300049743 | Bacteria | 699 |
| 261 | Ga0501083_0103408 | 3300049744 | Unclassified | 1877 |
| 262 | nmdc:mga05p37_107964_c1 | 3300050507 | Bacteria | 3424 |
| 263 | nmdc:mga05p37_12817_c1 | 3300050507 | Bacteria | 10023 |
| 264 | nmdc:mga05p37_20635_c1 | 3300050507 | Bacteria | 7971 |
| 265 | nmdc:mga05p37_3684_c1 | 3300050507 | Bacteria | 11668 |
| 266 | nmdc:mga05p37_37664_c1 | 3300050507 | Bacteria | 5931 |
| 267 | nmdc:mga05p37_52257_c1 | 3300050507 | Bacteria | 5025 |
| 268 | nmdc:mga05p37_69288_c1 | 3300050507 | Bacteria | 4338 |
| 269 | nmdc:mga09592_1441432_c1 | 3300050508 | Unclassified | 562 |
| 270 | nmdc:mga09592_319796_c1 | 3300050508 | Bacteria | 1344 |
| 271 | nmdc:mga0qj67_508388_c1 | 3300050509 | Unclassified | 968 |
| 272 | nmdc:mga06r32_1059261_c1 | 3300050510 | Bacteria | 761 |
| 273 | nmdc:mga08y16_1443994_c1 | 3300050511 | Bacteria | 650 |
| 274 | nmdc:mga08y16_35689_c1 | 3300050511 | Bacteria | 5222 |
| 275 | nmdc:mga08y16_387558_c1 | 3300050511 | Bacteria | 1432 |
| 276 | nmdc:mga08y16_7643_c1 | 3300050511 | Bacteria | 11311 |
| 277 | nmdc:mga0n895_1010278_c1 | 3300050512 | Bacteria | 812 |
| 278 | nmdc:mga0n895_287332_c1 | 3300050512 | Bacteria | 1667 |
| 279 | nmdc:mga0n895_28896_c1 | 3300050512 | Bacteria | 5280 |
| 280 | nmdc:mga0n895_4602_c1 | 3300050512 | Bacteria | 11367 |
| 281 | nmdc:mga0n895_851959_c1 | 3300050512 | Bacteria | 899 |
| 282 | nmdc:mga0n895_965590_c1 | 3300050512 | Unclassified | 835 |
| 283 | nmdc:mga0rr50_1604413_c1 | 3300050513 | Unclassified | 549 |
| 284 | nmdc:mga0rr50_316849_c1 | 3300050513 | Unclassified | 1307 |
| 285 | nmdc:mga0rr50_494033_c1 | 3300050513 | Bacteria | 1040 |
| 286 | nmdc:mga0rr50_54340_c1 | 3300050513 | Bacteria | 2983 |
| 287 | nmdc:mga0rr50_565806_c1 | 3300050513 | Unclassified | 968 |
| 288 | nmdc:mga08x19_175863_c1 | 3300050514 | Bacteria | 1460 |
| 289 | nmdc:mga08x19_392254_c1 | 3300050514 | Bacteria | 973 |
| 290 | nmdc:mga08x19_39672_c1 | 3300050514 | Unclassified | 2994 |
| 291 | nmdc:mga0a205_315033_c1 | 3300050515 | Bacteria | 1436 |
| 292 | nmdc:mga0a205_510108_c1 | 3300050515 | Bacteria | 1059 |
| 293 | nmdc:mga0a205_7558_c1 | 3300050515 | Bacteria | 9846 |
| 294 | nmdc:mga0a205_78553_c1 | 3300050515 | Bacteria | 3188 |
| 295 | nmdc:mga0a205_877912_c1 | 3300050515 | Bacteria | 744 |
| 296 | Ga0495601_0054820 | 3300053077 | Bacteria | 2523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10758124 | Ga0070709_107581242 | 134 |
| 2 | 3300006163 | Ga0070715_10465108 | Ga0070715_104651082 | 134 |
| 3 | 3300006237 | Ga0097621_100012095 | Ga0097621_1000120952 | 134 |
| 4 | 3300006358 | Ga0068871_100119182 | Ga0068871_1001191822 | 134 |
| 5 | 3300014969 | Ga0157376_10091823 | Ga0157376_100918233 | 134 |
| 6 | 3300025905 | Ga0207685_10365463 | Ga0207685_103654632 | 134 |
| 7 | 3300005458 | Ga0070681_10230723 | Ga0070681_102307233 | 139 |
| 8 | 3300025912 | Ga0207707_10334288 | Ga0207707_103342883 | 139 |
| 9 | 3300005844 | Ga0068862_100016971 | Ga0068862_1000169715 | 141 |
| 10 | 3300027907 | Ga0207428_10090188 | Ga0207428_100901883 | 141 |
| 11 | 3300028380 | Ga0268265_10002410 | Ga0268265_100024103 | 141 |
| 12 | 3300038443 | Ga0395901_0895137 | Ga0395901_0895137_119_559 | 141 |
| 13 | 3300026118 | Ga0207675_102348669 | Ga0207675_1023486691 | 142 |
| 14 | 3300009147 | Ga0114129_10837126 | Ga0114129_108371262 | 143 |
| 15 | 3300031344 | Ga0265316_10968745 | Ga0265316_109687452 | 143 |
| 16 | 3300006175 | Ga0070712_100435732 | Ga0070712_1004357322 | 144 |
| 17 | 3300025915 | Ga0207693_10703168 | Ga0207693_107031682 | 144 |
| 18 | 3300025929 | Ga0207664_10038327 | Ga0207664_100383273 | 144 |
| 19 | 3300005356 | Ga0070674_100562903 | Ga0070674_1005629032 | 145 |
| 20 | 3300005456 | Ga0070678_100388669 | Ga0070678_1003886691 | 145 |
| 21 | 3300005459 | Ga0068867_100048955 | Ga0068867_1000489553 | 145 |
| 22 | 3300005466 | Ga0070685_10867277 | Ga0070685_108672771 | 145 |
| 23 | 3300005548 | Ga0070665_100024453 | Ga0070665_1000244535 | 145 |
| 24 | 3300005563 | Ga0068855_100574696 | Ga0068855_1005746962 | 145 |
| 25 | 3300005617 | Ga0068859_103121396 | Ga0068859_1031213961 | 145 |
| 26 | 3300005718 | Ga0068866_10368685 | Ga0068866_103686852 | 145 |
| 27 | 3300005840 | Ga0068870_10405288 | Ga0068870_104052881 | 145 |
| 28 | 3300005842 | Ga0068858_100497097 | Ga0068858_1004970972 | 145 |
| 29 | 3300006358 | Ga0068871_100002184 | Ga0068871_1000021845 | 145 |
| 30 | 3300006871 | Ga0075434_101390183 | Ga0075434_1013901832 | 145 |
| 31 | 3300006881 | Ga0068865_100195298 | Ga0068865_1001952983 | 145 |
| 32 | 3300006914 | Ga0075436_100145068 | Ga0075436_1001450683 | 145 |
| 33 | 3300006931 | Ga0097620_103122474 | Ga0097620_1031224741 | 145 |
| 34 | 3300007076 | Ga0075435_100036123 | Ga0075435_1000361233 | 145 |
| 35 | 3300009098 | Ga0105245_10018779 | Ga0105245_100187795 | 145 |
| 36 | 3300009176 | Ga0105242_10041094 | Ga0105242_100410943 | 145 |
| 37 | 3300009176 | Ga0105242_10133611 | Ga0105242_101336112 | 145 |
| 38 | 3300009177 | Ga0105248_10586588 | Ga0105248_105865881 | 145 |
| 39 | 3300009177 | Ga0105248_10942601 | Ga0105248_109426012 | 145 |
| 40 | 3300009553 | Ga0105249_10482251 | Ga0105249_104822512 | 145 |
| 41 | 3300013296 | Ga0157374_12193929 | Ga0157374_121939291 | 145 |
| 42 | 3300013297 | Ga0157378_10413053 | Ga0157378_104130531 | 145 |
| 43 | 3300013306 | Ga0163162_10557245 | Ga0163162_105572452 | 145 |
| 44 | 3300013308 | Ga0157375_11879665 | Ga0157375_118796651 | 145 |
| 45 | 3300014969 | Ga0157376_10145299 | Ga0157376_101452992 | 145 |
| 46 | 3300014969 | Ga0157376_10352525 | Ga0157376_103525252 | 145 |
| 47 | 3300025901 | Ga0207688_10383422 | Ga0207688_103834221 | 145 |
| 48 | 3300025927 | Ga0207687_10032953 | Ga0207687_100329533 | 145 |
| 49 | 3300025934 | Ga0207686_10008529 | Ga0207686_100085293 | 145 |
| 50 | 3300025934 | Ga0207686_10329434 | Ga0207686_103294342 | 145 |
| 51 | 3300025938 | Ga0207704_10126394 | Ga0207704_101263941 | 145 |
| 52 | 3300025938 | Ga0207704_10271588 | Ga0207704_102715881 | 145 |
| 53 | 3300025941 | Ga0207711_10238721 | Ga0207711_102387213 | 145 |
| 54 | 3300025941 | Ga0207711_10514341 | Ga0207711_105143412 | 145 |
| 55 | 3300025942 | Ga0207689_10027005 | Ga0207689_100270052 | 145 |
| 56 | 3300025960 | Ga0207651_11326505 | Ga0207651_113265051 | 145 |
| 57 | 3300026023 | Ga0207677_10200576 | Ga0207677_102005762 | 145 |
| 58 | 3300026035 | Ga0207703_10265072 | Ga0207703_102650722 | 145 |
| 59 | 3300026088 | Ga0207641_10921884 | Ga0207641_109218841 | 145 |
| 60 | 3300026089 | Ga0207648_10053173 | Ga0207648_100531734 | 145 |
| 61 | 3300026121 | Ga0207683_10063741 | Ga0207683_100637411 | 145 |
| 62 | 3300028379 | Ga0268266_10167761 | Ga0268266_101677612 | 145 |
| 63 | 3300028381 | Ga0268264_10561132 | Ga0268264_105611322 | 145 |
| 64 | 3300035113 | Ga0373936_0236633 | Ga0373936_0236633_261_698 | 145 |
| 65 | 3300048907 | Ga0496104_0477457 | Ga0496104_0477457_330_767 | 145 |
| 66 | 3300048908 | Ga0496105_0631746 | Ga0496105_0631746_75_512 | 145 |
| 67 | 3300048908 | Ga0496105_0994251 | Ga0496105_0994251_78_515 | 145 |
| 68 | 3300048911 | Ga0496108_0245984 | Ga0496108_0245984_282_719 | 145 |
| 69 | 3300048917 | Ga0496114_1469135 | Ga0496114_1469135_20_457 | 145 |
| 70 | 3300050512 | nmdc:mga0n895_851959_c1 | nmdc:mga0n895_851959_c1_252_689 | 145 |
| 71 | 3300005439 | Ga0070711_101536397 | Ga0070711_1015363971 | 146 |
| 72 | 3300005445 | Ga0070708_100050146 | Ga0070708_1000501461 | 146 |
| 73 | 3300005518 | Ga0070699_100005320 | Ga0070699_10000532013 | 146 |
| 74 | 3300005549 | Ga0070704_100497814 | Ga0070704_1004978142 | 146 |
| 75 | 3300005844 | Ga0068862_101027852 | Ga0068862_1010278522 | 146 |
| 76 | 3300006237 | Ga0097621_100022205 | Ga0097621_1000222053 | 146 |
| 77 | 3300006358 | Ga0068871_100027733 | Ga0068871_1000277333 | 146 |
| 78 | 3300006914 | Ga0075436_100004695 | Ga0075436_1000046952 | 146 |
| 79 | 3300009094 | Ga0111539_11723091 | Ga0111539_117230912 | 146 |
| 80 | 3300025916 | Ga0207663_11039591 | Ga0207663_110395911 | 146 |
| 81 | 3300026089 | Ga0207648_11114323 | Ga0207648_111143232 | 146 |
| 82 | 3300042438 | Ga0439459_0199971 | Ga0439459_0199971_13_453 | 146 |
| 83 | 3300042530 | Ga0450916_066908 | Ga0450916_066908_10_450 | 146 |
| 84 | 3300046533 | Ga0495640_0174851 | Ga0495640_0174851_728_1168 | 146 |
| 85 | 3300046684 | Ga0495669_0019122 | Ga0495669_0019122_1881_2321 | 146 |
| 86 | 3300048903 | Ga0496100_0000944 | Ga0496100_0000944_10161_10601 | 146 |
| 87 | 3300048904 | Ga0496101_0073680 | Ga0496101_0073680_1285_1725 | 146 |
| 88 | 3300048905 | Ga0496102_0090478 | Ga0496102_0090478_886_1326 | 146 |
| 89 | 3300048907 | Ga0496104_0006346 | Ga0496104_0006346_2163_2603 | 146 |
| 90 | 3300048909 | Ga0496106_0061545 | Ga0496106_0061545_1951_2391 | 146 |
| 91 | 3300048910 | Ga0496107_0034890 | Ga0496107_0034890_1898_2338 | 146 |
| 92 | 3300048917 | Ga0496114_0007259 | Ga0496114_0007259_1540_1980 | 146 |
| 93 | 3300050508 | nmdc:mga09592_1441432_c1 | nmdc:mga09592_1441432_c1_22_462 | 146 |
| 94 | 3300050513 | nmdc:mga0rr50_316849_c1 | nmdc:mga0rr50_316849_c1_401_841 | 146 |
| 95 | 3300050513 | nmdc:mga0rr50_54340_c1 | nmdc:mga0rr50_54340_c1_2496_2936 | 146 |
| 96 | 3300050514 | nmdc:mga08x19_175863_c1 | nmdc:mga08x19_175863_c1_165_605 | 146 |
| 97 | 3300005564 | Ga0070664_100789987 | Ga0070664_1007899872 | 147 |
| 98 | 3300009094 | Ga0111539_10346575 | Ga0111539_103465752 | 147 |
| 99 | 3300009094 | Ga0111539_11408417 | Ga0111539_114084172 | 147 |
| 100 | 3300025907 | Ga0207645_10417015 | Ga0207645_104170152 | 147 |
| 101 | 3300027907 | Ga0207428_10259264 | Ga0207428_102592642 | 147 |
| 102 | 3300027907 | Ga0207428_10389484 | Ga0207428_103894842 | 147 |
| 103 | 3300035088 | Ga0373940_0072706 | Ga0373940_0072706_452_895 | 147 |
| 104 | 3300035118 | Ga0373954_0123512 | Ga0373954_0123512_486_929 | 147 |
| 105 | 3300035410 | Ga0373924_0497595 | Ga0373924_0497595_87_530 | 147 |
| 106 | 3300046459 | Ga0495629_0375322 | Ga0495629_0375322_164_625 | 147 |
| 107 | 3300046642 | Ga0495634_0500085 | Ga0495634_0500085_257_700 | 147 |
| 108 | 3300046663 | Ga0495635_0781997 | Ga0495635_0781997_54_515 | 147 |
| 109 | 3300046681 | Ga0495647_0040171 | Ga0495647_0040171_191_652 | 147 |
| 110 | 3300048913 | Ga0496110_0418217 | Ga0496110_0418217_734_1177 | 147 |
| 111 | 3300048915 | Ga0496112_1370717 | Ga0496112_1370717_30_479 | 147 |
| 112 | 3300050509 | nmdc:mga0qj67_508388_c1 | nmdc:mga0qj67_508388_c1_513_956 | 147 |
| 113 | 3300050511 | nmdc:mga08y16_387558_c1 | nmdc:mga08y16_387558_c1_340_783 | 147 |
| 114 | 3300050514 | nmdc:mga08x19_392254_c1 | nmdc:mga08x19_392254_c1_10_453 | 147 |
| 115 | 3300050515 | nmdc:mga0a205_510108_c1 | nmdc:mga0a205_510108_c1_416_859 | 147 |
| 116 | 3300005438 | Ga0070701_10080138 | Ga0070701_100801383 | 148 |
| 117 | 3300005468 | Ga0070707_100784951 | Ga0070707_1007849512 | 148 |
| 118 | 3300005719 | Ga0068861_100465845 | Ga0068861_1004658452 | 148 |
| 119 | 3300006847 | Ga0075431_101145383 | Ga0075431_1011453832 | 148 |
| 120 | 3300006871 | Ga0075434_100507049 | Ga0075434_1005070491 | 148 |
| 121 | 3300006914 | Ga0075436_100073632 | Ga0075436_1000736324 | 148 |
| 122 | 3300009147 | Ga0114129_10017643 | Ga0114129_100176434 | 148 |
| 123 | 3300009147 | Ga0114129_10144675 | Ga0114129_101446754 | 148 |
| 124 | 3300014326 | Ga0157380_10221310 | Ga0157380_102213103 | 148 |
| 125 | 3300025916 | Ga0207663_10300205 | Ga0207663_103002052 | 148 |
| 126 | 3300025922 | Ga0207646_10906347 | Ga0207646_109063471 | 148 |
| 127 | 3300026118 | Ga0207675_100507441 | Ga0207675_1005074412 | 148 |
| 128 | 3300035170 | Ga0373943_0047602 | Ga0373943_0047602_734_1183 | 148 |
| 129 | 3300035171 | Ga0373946_0020668 | Ga0373946_0020668_645_1094 | 148 |
| 130 | 3300035172 | Ga0373955_0196130 | Ga0373955_0196130_374_823 | 148 |
| 131 | 3300035410 | Ga0373924_0004135 | Ga0373924_0004135_3838_4287 | 148 |
| 132 | 3300035691 | Ga0373931_0175806 | Ga0373931_0175806_377_826 | 148 |
| 133 | 3300035725 | Ga0373947_0290213 | Ga0373947_0290213_493_942 | 148 |
| 134 | 3300036401 | Ga0373937_0210288 | Ga0373937_0210288_597_1046 | 148 |
| 135 | 3300036401 | Ga0373937_0484856 | Ga0373937_0484856_16_465 | 148 |
| 136 | 3300037068 | Ga0373925_0084892 | Ga0373925_0084892_1794_2243 | 148 |
| 137 | 3300046511 | Ga0495608_0207483 | Ga0495608_0207483_381_830 | 148 |
| 138 | 3300046535 | Ga0495586_0188833 | Ga0495586_0188833_391_840 | 148 |
| 139 | 3300046559 | Ga0495667_0594888 | Ga0495667_0594888_13_462 | 148 |
| 140 | 3300047317 | Ga0495604_0245598 | Ga0495604_0245598_202_651 | 148 |
| 141 | 3300048905 | Ga0496102_1159480 | Ga0496102_1159480_31_480 | 148 |
| 142 | 3300048909 | Ga0496106_0151818 | Ga0496106_0151818_333_782 | 148 |
| 143 | 3300048917 | Ga0496114_0606260 | Ga0496114_0606260_489_938 | 148 |
| 144 | 3300049583 | Ga0501067_0727124 | Ga0501067_0727124_51_500 | 148 |
| 145 | 3300049590 | Ga0501074_0270460 | Ga0501074_0270460_37_486 | 148 |
| 146 | 3300049590 | Ga0501074_0892690 | Ga0501074_0892690_24_470 | 148 |
| 147 | 3300049744 | Ga0501083_0103408 | Ga0501083_0103408_1392_1841 | 148 |
| 148 | 3300050507 | nmdc:mga05p37_107964_c1 | nmdc:mga05p37_107964_c1_1816_2265 | 148 |
| 149 | 3300050507 | nmdc:mga05p37_69288_c1 | nmdc:mga05p37_69288_c1_1089_1535 | 148 |
| 150 | 3300050508 | nmdc:mga09592_319796_c1 | nmdc:mga09592_319796_c1_109_558 | 148 |
| 151 | 3300050510 | nmdc:mga06r32_1059261_c1 | nmdc:mga06r32_1059261_c1_245_694 | 148 |
| 152 | 3300050512 | nmdc:mga0n895_1010278_c1 | nmdc:mga0n895_1010278_c1_42_491 | 148 |
| 153 | 3300053077 | Ga0495601_0054820 | Ga0495601_0054820_989_1438 | 148 |
| 154 | 3300005459 | Ga0068867_100084482 | Ga0068867_1000844823 | 149 |
| 155 | 3300005471 | Ga0070698_100574592 | Ga0070698_1005745922 | 149 |
| 156 | 3300005544 | Ga0070686_100970672 | Ga0070686_1009706721 | 149 |
| 157 | 3300005548 | Ga0070665_100060285 | Ga0070665_1000602853 | 149 |
| 158 | 3300005578 | Ga0068854_100304577 | Ga0068854_1003045772 | 149 |
| 159 | 3300005615 | Ga0070702_100282696 | Ga0070702_1002826962 | 149 |
| 160 | 3300005718 | Ga0068866_10065003 | Ga0068866_100650032 | 149 |
| 161 | 3300005718 | Ga0068866_10218678 | Ga0068866_102186782 | 149 |
| 162 | 3300005841 | Ga0068863_100005016 | Ga0068863_1000050169 | 149 |
| 163 | 3300005844 | Ga0068862_100653697 | Ga0068862_1006536972 | 149 |
| 164 | 3300006237 | Ga0097621_100004036 | Ga0097621_1000040363 | 149 |
| 165 | 3300006358 | Ga0068871_100018638 | Ga0068871_1000186384 | 149 |
| 166 | 3300006358 | Ga0068871_101322392 | Ga0068871_1013223921 | 149 |
| 167 | 3300006844 | Ga0075428_102103614 | Ga0075428_1021036141 | 149 |
| 168 | 3300006852 | Ga0075433_10046534 | Ga0075433_100465343 | 149 |
| 169 | 3300006871 | Ga0075434_100822336 | Ga0075434_1008223362 | 149 |
| 170 | 3300006881 | Ga0068865_100010841 | Ga0068865_1000108413 | 149 |
| 171 | 3300006881 | Ga0068865_100928936 | Ga0068865_1009289362 | 149 |
| 172 | 3300009093 | Ga0105240_10055649 | Ga0105240_100556493 | 149 |
| 173 | 3300009094 | Ga0111539_12326616 | Ga0111539_123266162 | 149 |
| 174 | 3300009147 | Ga0114129_10022079 | Ga0114129_100220798 | 149 |
| 175 | 3300009176 | Ga0105242_10008808 | Ga0105242_100088082 | 149 |
| 176 | 3300009177 | Ga0105248_10048794 | Ga0105248_100487944 | 149 |
| 177 | 3300009177 | Ga0105248_10067231 | Ga0105248_100672314 | 149 |
| 178 | 3300009177 | Ga0105248_10264083 | Ga0105248_102640833 | 149 |
| 179 | 3300009551 | Ga0105238_10410782 | Ga0105238_104107822 | 149 |
| 180 | 3300013297 | Ga0157378_11646602 | Ga0157378_116466022 | 149 |
| 181 | 3300013306 | Ga0163162_10676333 | Ga0163162_106763332 | 149 |
| 182 | 3300017792 | Ga0163161_10506348 | Ga0163161_105063481 | 149 |
| 183 | 3300025899 | Ga0207642_10043599 | Ga0207642_100435993 | 149 |
| 184 | 3300025913 | Ga0207695_10090095 | Ga0207695_100900953 | 149 |
| 185 | 3300025924 | Ga0207694_11234975 | Ga0207694_112349751 | 149 |
| 186 | 3300025934 | Ga0207686_10146186 | Ga0207686_101461862 | 149 |
| 187 | 3300025934 | Ga0207686_10165519 | Ga0207686_101655193 | 149 |
| 188 | 3300025934 | Ga0207686_11491185 | Ga0207686_114911851 | 149 |
| 189 | 3300025938 | Ga0207704_10223761 | Ga0207704_102237612 | 149 |
| 190 | 3300025941 | Ga0207711_10053400 | Ga0207711_100534003 | 149 |
| 191 | 3300025941 | Ga0207711_10416292 | Ga0207711_104162923 | 149 |
| 192 | 3300025942 | Ga0207689_10115283 | Ga0207689_101152833 | 149 |
| 193 | 3300025981 | Ga0207640_10469779 | Ga0207640_104697792 | 149 |
| 194 | 3300026023 | Ga0207677_10061753 | Ga0207677_100617532 | 149 |
| 195 | 3300026088 | Ga0207641_10000409 | Ga0207641_1000040938 | 149 |
| 196 | 3300026089 | Ga0207648_10110043 | Ga0207648_101100431 | 149 |
| 197 | 3300026121 | Ga0207683_10063576 | Ga0207683_100635763 | 149 |
| 198 | 3300028379 | Ga0268266_10021671 | Ga0268266_100216712 | 149 |
| 199 | 3300035171 | Ga0373946_0176935 | Ga0373946_0176935_333_782 | 149 |
| 200 | 3300035691 | Ga0373931_1285017 | Ga0373931_1285017_30_479 | 149 |
| 201 | 3300037068 | Ga0373925_0374701 | Ga0373925_0374701_571_1020 | 149 |
| 202 | 3300037471 | Ga0395905_0939461 | Ga0395905_0939461_269_718 | 149 |
| 203 | 3300039437 | Ga0436365_1490266 | Ga0436365_1490266_394_852 | 149 |
| 204 | 3300046681 | Ga0495647_0509222 | Ga0495647_0509222_64_513 | 149 |
| 205 | 3300047471 | Ga0495684_0503027 | Ga0495684_0503027_68_517 | 149 |
| 206 | 3300048913 | Ga0496110_0638342 | Ga0496110_0638342_475_924 | 149 |
| 207 | 3300048914 | Ga0496111_0397101 | Ga0496111_0397101_545_994 | 149 |
| 208 | 3300048917 | Ga0496114_0051446 | Ga0496114_0051446_648_1097 | 149 |
| 209 | 3300049743 | Ga0501081_0822967 | Ga0501081_0822967_53_505 | 149 |
| 210 | 3300050507 | nmdc:mga05p37_37664_c1 | nmdc:mga05p37_37664_c1_794_1243 | 149 |
| 211 | 3300050511 | nmdc:mga08y16_1443994_c1 | nmdc:mga08y16_1443994_c1_33_482 | 149 |
| 212 | 3300050512 | nmdc:mga0n895_28896_c1 | nmdc:mga0n895_28896_c1_4270_4719 | 149 |
| 213 | 3300050515 | nmdc:mga0a205_7558_c1 | nmdc:mga0a205_7558_c1_4848_5297 | 149 |
| 214 | 3300005340 | Ga0070689_100785226 | Ga0070689_1007852262 | 150 |
| 215 | 3300005347 | Ga0070668_100122329 | Ga0070668_1001223293 | 150 |
| 216 | 3300005444 | Ga0070694_100027053 | Ga0070694_1000270534 | 150 |
| 217 | 3300005468 | Ga0070707_100084050 | Ga0070707_1000840503 | 150 |
| 218 | 3300005543 | Ga0070672_101259526 | Ga0070672_1012595262 | 150 |
| 219 | 3300005544 | Ga0070686_100020604 | Ga0070686_1000206044 | 150 |
| 220 | 3300005545 | Ga0070695_100001695 | Ga0070695_1000016954 | 150 |
| 221 | 3300005549 | Ga0070704_100015718 | Ga0070704_1000157184 | 150 |
| 222 | 3300005617 | Ga0068859_100336530 | Ga0068859_1003365302 | 150 |
| 223 | 3300005937 | Ga0081455_10072530 | Ga0081455_100725301 | 150 |
| 224 | 3300006237 | Ga0097621_100028133 | Ga0097621_1000281332 | 150 |
| 225 | 3300006852 | Ga0075433_10092356 | Ga0075433_100923564 | 150 |
| 226 | 3300006871 | Ga0075434_100018222 | Ga0075434_1000182227 | 150 |
| 227 | 3300006871 | Ga0075434_100808510 | Ga0075434_1008085101 | 150 |
| 228 | 3300006931 | Ga0097620_100336519 | Ga0097620_1003365192 | 150 |
| 229 | 3300007076 | Ga0075435_101147291 | Ga0075435_1011472911 | 150 |
| 230 | 3300009094 | Ga0111539_10154875 | Ga0111539_101548752 | 150 |
| 231 | 3300009094 | Ga0111539_10216470 | Ga0111539_102164702 | 150 |
| 232 | 3300009147 | Ga0114129_10021953 | Ga0114129_100219535 | 150 |
| 233 | 3300009147 | Ga0114129_10241928 | Ga0114129_102419282 | 150 |
| 234 | 3300012508 | Ga0157315_1004231 | Ga0157315_10042311 | 150 |
| 235 | 3300014326 | Ga0157380_10213559 | Ga0157380_102135593 | 150 |
| 236 | 3300014745 | Ga0157377_11136023 | Ga0157377_111360231 | 150 |
| 237 | 3300025922 | Ga0207646_10055015 | Ga0207646_100550153 | 150 |
| 238 | 3300025923 | Ga0207681_10003563 | Ga0207681_100035639 | 150 |
| 239 | 3300025933 | Ga0207706_10182934 | Ga0207706_101829342 | 150 |
| 240 | 3300025960 | Ga0207651_10180221 | Ga0207651_101802213 | 150 |
| 241 | 3300026075 | Ga0207708_11642992 | Ga0207708_116429921 | 150 |
| 242 | 3300045051 | Ga0451576_1057668 | Ga0451576_1057668_52_513 | 150 |
| 243 | 3300046684 | Ga0495669_0138623 | Ga0495669_0138623_159_611 | 150 |
| 244 | 3300046691 | Ga0495670_0591930 | Ga0495670_0591930_69_521 | 150 |
| 245 | 3300050507 | nmdc:mga05p37_20635_c1 | nmdc:mga05p37_20635_c1_7094_7555 | 150 |
| 246 | 3300050507 | nmdc:mga05p37_52257_c1 | nmdc:mga05p37_52257_c1_1982_2434 | 150 |
| 247 | 3300050511 | nmdc:mga08y16_35689_c1 | nmdc:mga08y16_35689_c1_1068_1535 | 150 |
| 248 | 3300050512 | nmdc:mga0n895_287332_c1 | nmdc:mga0n895_287332_c1_1072_1524 | 150 |
| 249 | 3300050512 | nmdc:mga0n895_4602_c1 | nmdc:mga0n895_4602_c1_6401_6868 | 150 |
| 250 | 3300050513 | nmdc:mga0rr50_1604413_c1 | nmdc:mga0rr50_1604413_c1_61_528 | 150 |
| 251 | 3300050513 | nmdc:mga0rr50_494033_c1 | nmdc:mga0rr50_494033_c1_528_980 | 150 |
| 252 | 3300050515 | nmdc:mga0a205_78553_c1 | nmdc:mga0a205_78553_c1_2383_2844 | 150 |
| 253 | 3300005544 | Ga0070686_100229389 | Ga0070686_1002293892 | 151 |
| 254 | 3300005617 | Ga0068859_102075476 | Ga0068859_1020754761 | 151 |
| 255 | 3300006931 | Ga0097620_102075417 | Ga0097620_1020754171 | 151 |
| 256 | 3300025925 | Ga0207650_10374279 | Ga0207650_103742792 | 151 |
| 257 | 3300026078 | Ga0207702_10816842 | Ga0207702_108168422 | 151 |
| 258 | 3300050512 | nmdc:mga0n895_965590_c1 | nmdc:mga0n895_965590_c1_357_815 | 151 |
| 259 | 3300006914 | Ga0075436_100008912 | Ga0075436_1000089125 | 152 |
| 260 | 3300009147 | Ga0114129_10107497 | Ga0114129_101074974 | 152 |
| 261 | 3300048911 | Ga0496108_0296291 | Ga0496108_0296291_910_1377 | 152 |
| 262 | 3300050507 | nmdc:mga05p37_3684_c1 | nmdc:mga05p37_3684_c1_10289_10750 | 152 |
| 263 | 3300050514 | nmdc:mga08x19_39672_c1 | nmdc:mga08x19_39672_c1_400_861 | 152 |
| 264 | 3300050515 | nmdc:mga0a205_315033_c1 | nmdc:mga0a205_315033_c1_531_992 | 152 |
| 265 | 3300005330 | Ga0070690_100129344 | Ga0070690_1001293443 | 153 |
| 266 | 3300005365 | Ga0070688_100071470 | Ga0070688_1000714703 | 153 |
| 267 | 3300005445 | Ga0070708_100156923 | Ga0070708_1001569232 | 153 |
| 268 | 3300005468 | Ga0070707_100629086 | Ga0070707_1006290862 | 153 |
| 269 | 3300005471 | Ga0070698_100243480 | Ga0070698_1002434802 | 153 |
| 270 | 3300005518 | Ga0070699_100987875 | Ga0070699_1009878751 | 153 |
| 271 | 3300005543 | Ga0070672_100009661 | Ga0070672_1000096614 | 153 |
| 272 | 3300005615 | Ga0070702_100211459 | Ga0070702_1002114592 | 153 |
| 273 | 3300005617 | Ga0068859_100299955 | Ga0068859_1002999553 | 153 |
| 274 | 3300005843 | Ga0068860_100045904 | Ga0068860_1000459044 | 153 |
| 275 | 3300006852 | Ga0075433_11050299 | Ga0075433_110502991 | 153 |
| 276 | 3300006881 | Ga0068865_100654990 | Ga0068865_1006549902 | 153 |
| 277 | 3300006931 | Ga0097620_100299978 | Ga0097620_1002999783 | 153 |
| 278 | 3300007076 | Ga0075435_100585905 | Ga0075435_1005859052 | 153 |
| 279 | 3300009147 | Ga0114129_10013254 | Ga0114129_100132544 | 153 |
| 280 | 3300009176 | Ga0105242_10118538 | Ga0105242_101185383 | 153 |
| 281 | 3300009177 | Ga0105248_10024038 | Ga0105248_100240384 | 153 |
| 282 | 3300009553 | Ga0105249_10400993 | Ga0105249_104009932 | 153 |
| 283 | 3300013306 | Ga0163162_10075478 | Ga0163162_100754785 | 153 |
| 284 | 3300014968 | Ga0157379_10019939 | Ga0157379_100199398 | 153 |
| 285 | 3300025938 | Ga0207704_10790085 | Ga0207704_107900852 | 153 |
| 286 | 3300025940 | Ga0207691_10004571 | Ga0207691_100045719 | 153 |
| 287 | 3300025941 | Ga0207711_10173788 | Ga0207711_101737883 | 153 |
| 288 | 3300027907 | Ga0207428_10066085 | Ga0207428_100660852 | 153 |
| 289 | 3300028381 | Ga0268264_10074400 | Ga0268264_100744003 | 153 |
| 290 | 3300031711 | Ga0265314_10106224 | Ga0265314_101062241 | 153 |
| 291 | 3300044706 | Ga0466964_0553805 | Ga0466964_0553805_116_589 | 153 |
| 292 | 3300048910 | Ga0496107_0181096 | Ga0496107_0181096_791_1252 | 153 |
| 293 | 3300050507 | nmdc:mga05p37_12817_c1 | nmdc:mga05p37_12817_c1_4848_5309 | 153 |
| 294 | 3300050511 | nmdc:mga08y16_7643_c1 | nmdc:mga08y16_7643_c1_3648_4127 | 153 |
| 295 | 3300050513 | nmdc:mga0rr50_565806_c1 | nmdc:mga0rr50_565806_c1_275_751 | 153 |
| 296 | 3300050515 | nmdc:mga0a205_877912_c1 | nmdc:mga0a205_877912_c1_204_665 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ujc-assembly1.cif.gz_A | structure of the protein histidine phosphatase sixa complexed with tungstate | 0.824 | 1 | 151 |
| 1ujc-assembly1.cif.gz_A | structure of the protein histidine phosphatase sixa complexed with tungstate | 0.8094 | 1 | 151 |
| 2rfl-assembly3.cif.gz_C | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.7966 | 2 | 148 |
| 3f2i-assembly3.cif.gz_E | crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. | 0.7822 | 1 | 149 |
| 2rfl-assembly5.cif.gz_E | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.782 | 2 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7TP58_1_230_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.88 | 3 | 66 | 3.40.50.1240 |
| 3h6jA01 | Mainly Beta;6 Propeller;Neuraminidase; | 0.8187 | 128 | 150 | 2.120.10.10 |
| 1ujbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.7976 | 1 | 151 | 3.40.50.1240 |
| af_K7TSF9_113_270_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.7848 | 8 | 75 | 3.40.50.1240 |
| 1ujbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.7838 | 1 | 151 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B0WGF9-F1-model_v4 | Phosphohistidine phosphatase SixA | 0.8992 | 3 | 148 |
|
| AF-A0A2W6AQ17-F1-model_v4 | Phosphohistidine phosphatase SixA | 0.8895 | 1 | 151 |
GO:0005737
GO:0036211 GO:0101006 |
| AF-A0A2E7BLD1-F1-model_v4 | Phosphohistidine phosphatase SixA | 0.8889 | 1 | 153 |
|
| AF-A0A1G1BX12-F1-model_v4 | Phosphohistidine phosphatase SixA | 0.8862 | 1 | 149 |
GO:0005737
GO:0036211 GO:0101006 |
| AF-A0A2V7W632-F1-model_v4 | Phosphohistidine phosphatase SixA | 0.8837 | 2 | 149 |
GO:0005737
GO:0036211 GO:0101006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar