F393255

General Info

Members Datasets Scaffolds Average Seq Length
296 146 592 156

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10003294|Ga0265760_100032943
Length 163
Sequence MPHRILHPVFLKMCVVVVLMSVAYAQQSHWATADDKTAKFMIDMERKWAEGVCTNNGVVSELLADDFQGTDTRGERFNKENELRDQKGPHSAHDCGLDDAKVHFFSSSGQGEDVAIIYGSEHAVGKDKTHPDAKQCQVWTDTWLKRNGKWQIAASQDNKVDCK

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.38
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 24.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10003294 3300031090 Bacteria 4730
2 JGI24743J22301_10009762 3300001991 Bacteria 1705
3 rootH2_10214697 3300003320 Bacteria 1985
4 rootH1_10297679 3300003323 Bacteria 2719
5 Ga0070683_100001021 3300005329 Bacteria 21002
6 Ga0070683_100038724 3300005329 Bacteria 4372
7 Ga0070683_100056129 3300005329 Unclassified 3657
8 Ga0070683_100353991 3300005329 Bacteria 1398
9 Ga0070683_100826882 3300005329 Bacteria 888
10 Ga0070670_100028795 3300005331 Plasmid 4782
11 Ga0068869_100075982 3300005334 Unclassified 2497
12 Ga0068868_100000200 3300005338 Bacteria 40137
13 Ga0068868_100726067 3300005338 Unclassified 891
14 Ga0070661_100326365 3300005344 Unclassified 1200
15 Ga0070671_100046878 3300005355 Bacteria 3594
16 Ga0070671_100049146 3300005355 Bacteria 3509
17 Ga0070667_100000800 3300005367 Bacteria 29453
18 Ga0070709_10787857 3300005434 Unclassified 745
19 Ga0070713_100031064 3300005436 Bacteria 4250
20 Ga0070713_100322101 3300005436 Bacteria 1428
21 Ga0070711_100068973 3300005439 Bacteria 2486
22 Ga0070663_100153486 3300005455 Bacteria 1768
23 Ga0070662_101043994 3300005457 Unclassified 700
24 Ga0070685_10057203 3300005466 Unclassified 2269
25 Ga0070707_100354059 3300005468 Bacteria 1426
26 Ga0070707_100492458 3300005468 Unclassified 1187
27 Ga0070684_100001524 3300005535 Bacteria 16745
28 Ga0070684_100028251 3300005535 Unclassified 4744
29 Ga0070684_100160368 3300005535 Bacteria 2040
30 Ga0068853_100000090 3300005539 Bacteria 61982
31 Ga0068853_100102634 3300005539 Unclassified 2531
32 Ga0068853_100370227 3300005539 Bacteria 1336
33 Ga0070693_100518094 3300005547 Unclassified 848
34 Ga0070665_100036235 3300005548 Bacteria 4963
35 Ga0070665_100049933 3300005548 Unclassified 4198
36 Ga0068855_100000250 3300005563 Bacteria 67441
37 Ga0068855_100268283 3300005563 Unclassified 1899
38 Ga0068855_101277904 3300005563 Bacteria 760
39 Ga0068855_101410166 3300005563 Unclassified 718
40 Ga0068857_100000342 3300005577 Bacteria 32171
41 Ga0068857_100116655 3300005577 Bacteria 2402
42 Ga0068857_100258153 3300005577 Bacteria 1599
43 Ga0068856_100005208 3300005614 Bacteria 12838
44 Ga0068856_100017635 3300005614 Bacteria 6920
45 Ga0068856_100051130 3300005614 Bacteria 4075
46 Ga0068856_100144225 3300005614 Bacteria 2389
47 Ga0068856_100728085 3300005614 Bacteria 1012
48 Ga0068852_100000010 3300005616 Bacteria 141683
49 Ga0068852_100009373 3300005616 Bacteria 7271
50 Ga0068852_100070593 3300005616 Bacteria 3065
51 Ga0068852_100082491 3300005616 Unclassified 2857
52 Ga0068859_100071061 3300005617 Bacteria 3516
53 Ga0068859_100077678 3300005617 Bacteria 3361
54 Ga0068859_100088704 3300005617 Bacteria 3142
55 Ga0068859_102554800 3300005617 Unclassified 562
56 Ga0068864_100005891 3300005618 Bacteria 10046
57 Ga0068866_10255486 3300005718 Bacteria 1074
58 Ga0068861_100201673 3300005719 Unclassified 1670
59 Ga0068851_10113559 3300005834 Bacteria 1448
60 Ga0068851_10378141 3300005834 Bacteria 829
61 Ga0068863_100017827 3300005841 Bacteria 6796
62 Ga0068863_100333909 3300005841 Unclassified 1474
63 Ga0068858_100006749 3300005842 Bacteria 11171
64 Ga0068858_100014056 3300005842 Bacteria 7549
65 Ga0068860_100006371 3300005843 Bacteria 11846
66 Ga0068860_100013333 3300005843 Bacteria 8058
67 Ga0068862_100104300 3300005844 Bacteria 2484
68 Ga0081540_1002697 3300005983 Bacteria 14441
69 Ga0070717_10076010 3300006028 Bacteria 2810
70 Ga0070717_10082393 3300006028 Bacteria 2703
71 Ga0070717_10263392 3300006028 Bacteria 1526
72 Ga0070712_100000192 3300006175 Bacteria 33875
73 Ga0097621_100061250 3300006237 Bacteria 3086
74 Ga0097621_100069273 3300006237 Bacteria 2913
75 Ga0097621_100134062 3300006237 Unclassified 2111
76 Ga0097621_100161429 3300006237 Bacteria 1927
77 Ga0097621_100210554 3300006237 Bacteria 1691
78 Ga0097621_102266407 3300006237 Unclassified 520
79 Ga0068871_100015481 3300006358 Bacteria 5710
80 Ga0068871_100545347 3300006358 Bacteria 1050
81 Ga0075434_100027711 3300006871 Bacteria 5563
82 Ga0068865_100251892 3300006881 Unclassified 1394
83 Ga0068865_100758666 3300006881 Unclassified 834
84 Ga0097620_100071062 3300006931 Bacteria 3516
85 Ga0097620_100077679 3300006931 Bacteria 3361
86 Ga0097620_100088700 3300006931 Bacteria 3142
87 Ga0097620_102554553 3300006931 Unclassified 562
88 Ga0075435_100008323 3300007076 Bacteria 7432
89 Ga0099794_10248161 3300007265 Bacteria 917
90 Ga0099795_10073389 3300007788 Unclassified 1295
91 Ga0099795_10074377 3300007788 Bacteria 1288
92 Ga0105240_10000529 3300009093 Bacteria 70418
93 Ga0105240_10000897 3300009093 Bacteria 53086
94 Ga0105240_10006920 3300009093 Bacteria 16566
95 Ga0105240_10012011 3300009093 Bacteria 12004
96 Ga0105240_10016947 3300009093 Bacteria 9846
97 Ga0105240_10028789 3300009093 Bacteria 7247
98 Ga0105240_10148057 3300009093 Bacteria 2799
99 Ga0105245_10084307 3300009098 Bacteria 2911
100 Ga0105245_10182850 3300009098 Bacteria 2004
101 Ga0105247_10159105 3300009101 Unclassified 1494
102 Ga0105247_10352097 3300009101 Bacteria 1036
103 Ga0105247_10803888 3300009101 Unclassified 718
104 Ga0105241_10000014 3300009174 Bacteria 171306
105 Ga0105241_10011055 3300009174 Bacteria 6622
106 Ga0105241_10034901 3300009174 Bacteria 3782
107 Ga0105241_10048058 3300009174 Bacteria 3246
108 Ga0105248_10026016 3300009177 Bacteria 6509
109 Ga0105248_10033285 3300009177 Bacteria 5757
110 Ga0105248_10135287 3300009177 Bacteria 2780
111 Ga0105237_10021496 3300009545 Bacteria 6632
112 Ga0105237_10093132 3300009545 Bacteria 3003
113 Ga0105237_10107820 3300009545 Bacteria 2777
114 Ga0105237_10330382 3300009545 Bacteria 1529
115 Ga0105237_10369231 3300009545 Bacteria 1440
116 Ga0105237_10570107 3300009545 Bacteria 1139
117 Ga0105237_11214286 3300009545 Unclassified 760
118 Ga0105238_10000390 3300009551 Bacteria 46780
119 Ga0105238_10011321 3300009551 Bacteria 8973
120 Ga0105238_10067207 3300009551 Bacteria 3586
121 Ga0105238_10085239 3300009551 Unclassified 3148
122 Ga0105238_10242594 3300009551 Bacteria 1780
123 Ga0105249_11328336 3300009553 Bacteria 791
124 Ga0099796_10067999 3300010159 Bacteria 1279
125 Ga0105239_10001644 3300010375 Bacteria 29466
126 Ga0105239_10012098 3300010375 Bacteria 9624
127 Ga0105239_10073513 3300010375 Bacteria 3758
128 Ga0105246_10068108 3300011119 Bacteria 2496
129 Ga0157371_10242656 3300013102 Unclassified 1296
130 Ga0157371_10316282 3300013102 Unclassified 1132
131 Ga0157370_10000005 3300013104 Bacteria 288514
132 Ga0157369_10000049 3300013105 Bacteria 169239
133 Ga0157369_10004263 3300013105 Bacteria 16906
134 Ga0157369_10096133 3300013105 Bacteria 3161
135 Ga0157369_10119674 3300013105 Bacteria 2795
136 Ga0157369_10198227 3300013105 Bacteria 2107
137 Ga0157369_10541454 3300013105 Unclassified 1204
138 Ga0157374_10007036 3300013296 Bacteria 9574
139 Ga0157374_10062620 3300013296 Bacteria 3487
140 Ga0157374_10085267 3300013296 Bacteria 3003
141 Ga0157374_10255879 3300013296 Bacteria 1724
142 Ga0157374_10606181 3300013296 Bacteria 1105
143 Ga0157374_10999339 3300013296 Unclassified 856
144 Ga0157374_11239925 3300013296 Bacteria 767
145 Ga0157374_11653657 3300013296 Bacteria 665
146 Ga0157374_12289305 3300013296 Unclassified 567
147 Ga0157378_10002748 3300013297 Bacteria 15679
148 Ga0157378_10254662 3300013297 Bacteria 1682
149 Ga0157378_10510755 3300013297 Unclassified 1202
150 Ga0157378_11399324 3300013297 Unclassified 742
151 Ga0163162_10004606 3300013306 Bacteria 13287
152 Ga0163162_10134928 3300013306 Bacteria 2579
153 Ga0163162_10205171 3300013306 Bacteria 2100
154 Ga0163162_10408407 3300013306 Unclassified 1491
155 Ga0157372_10000047 3300013307 Bacteria 145881
156 Ga0157372_10015027 3300013307 Bacteria 8286
157 Ga0157372_10029996 3300013307 Bacteria 5945
158 Ga0157372_10060686 3300013307 Bacteria 4231
159 Ga0157375_10056553 3300013308 Bacteria 3874
160 Ga0157375_10224954 3300013308 Bacteria 2035
161 Ga0157375_11864730 3300013308 Bacteria 713
162 Ga0163163_10033545 3300014325 Bacteria 4967
163 Ga0163163_10401134 3300014325 Bacteria 1429
164 Ga0163163_10953545 3300014325 Bacteria 921
165 Ga0163163_11658272 3300014325 Bacteria 700
166 Ga0182008_10572075 3300014497 Unclassified 630
167 Ga0157377_10164764 3300014745 Bacteria 1381
168 Ga0157379_10004893 3300014968 Bacteria 11501
169 Ga0157379_10075342 3300014968 Bacteria 3021
170 Ga0157376_10012219 3300014969 Bacteria 6365
171 Ga0157376_10031770 3300014969 Unclassified 4233
172 Ga0157376_10160444 3300014969 Unclassified 2038
173 Ga0157376_10546688 3300014969 Unclassified 1145
174 Ga0157376_10568762 3300014969 Bacteria 1124
175 Ga0157376_11635608 3300014969 Unclassified 679
176 Ga0228598_1000028 3300024227 Bacteria 20121
177 Ga0207656_10028231 3300025321 Bacteria 2302
178 Ga0207710_10143335 3300025900 Unclassified 1155
179 Ga0207647_10040986 3300025904 Bacteria 2914
180 Ga0207647_10062597 3300025904 Unclassified 2266
181 Ga0207647_10420797 3300025904 Unclassified 751
182 Ga0207654_10000018 3300025911 Bacteria 173245
183 Ga0207654_10027168 3300025911 Bacteria 3109
184 Ga0207654_10092637 3300025911 Bacteria 1846
185 Ga0207707_10796745 3300025912 Unclassified 787
186 Ga0207695_10000119 3300025913 Bacteria 235221
187 Ga0207695_10000598 3300025913 Bacteria 72240
188 Ga0207695_10000630 3300025913 Bacteria 70641
189 Ga0207695_10024667 3300025913 Bacteria 6755
190 Ga0207695_10169062 3300025913 Bacteria 2113
191 Ga0207695_11132826 3300025913 Unclassified 662
192 Ga0207671_10000047 3300025914 Bacteria 196307
193 Ga0207693_10001005 3300025915 Bacteria 25358
194 Ga0207663_10116389 3300025916 Bacteria 1822
195 Ga0207657_10216855 3300025919 Unclassified 1534
196 Ga0207646_10291886 3300025922 Bacteria 1474
197 Ga0207694_10000089 3300025924 Bacteria 103520
198 Ga0207694_10000198 3300025924 Bacteria 60251
199 Ga0207694_10001800 3300025924 Bacteria 17856
200 Ga0207650_10051487 3300025925 Bacteria 3048
201 Ga0207687_10006560 3300025927 Bacteria 7680
202 Ga0207687_10028313 3300025927 Bacteria 3764
203 Ga0207687_10184869 3300025927 Bacteria 1617
204 Ga0207700_10079945 3300025928 Bacteria 2548
205 Ga0207700_10278940 3300025928 Bacteria 1437
206 Ga0207700_10534216 3300025928 Unclassified 1040
207 Ga0207664_10015012 3300025929 Bacteria 5609
208 Ga0207644_10034167 3300025931 Bacteria 3558
209 Ga0207644_10253509 3300025931 Bacteria 1405
210 Ga0207665_10336414 3300025939 Unclassified 1136
211 Ga0207665_10413095 3300025939 Unclassified 1030
212 Ga0207711_10021945 3300025941 Bacteria 5334
213 Ga0207711_10663369 3300025941 Unclassified 973
214 Ga0207689_10010678 3300025942 Bacteria 7900
215 Ga0207689_10018212 3300025942 Bacteria 5928
216 Ga0207661_10000111 3300025944 Bacteria 51639
217 Ga0207661_10026772 3300025944 Bacteria 4398
218 Ga0207661_10042676 3300025944 Unclassified 3577
219 Ga0207661_10193121 3300025944 Bacteria 1786
220 Ga0207679_10064239 3300025945 Bacteria 2743
221 Ga0207667_10000949 3300025949 Bacteria 36988
222 Ga0207667_10030113 3300025949 Bacteria 5874
223 Ga0207667_10053694 3300025949 Unclassified 4239
224 Ga0207667_10457624 3300025949 Bacteria 1296
225 Ga0207667_10588978 3300025949 Bacteria 1122
226 Ga0207667_10615950 3300025949 Bacteria 1093
227 Ga0207658_10000076 3300025986 Bacteria 108585
228 Ga0207677_10000572 3300026023 Bacteria 22955
229 Ga0207677_10452803 3300026023 Bacteria 1100
230 Ga0207703_10009729 3300026035 Bacteria 7545
231 Ga0207703_10015354 3300026035 Bacteria 5973
232 Ga0207639_10000178 3300026041 Bacteria 49479
233 Ga0207678_10201710 3300026067 Bacteria 1701
234 Ga0207702_10047618 3300026078 Bacteria 3613
235 Ga0207702_10245446 3300026078 Unclassified 1679
236 Ga0207702_10398201 3300026078 Unclassified 1327
237 Ga0207648_10445319 3300026089 Bacteria 1179
238 Ga0207676_10005485 3300026095 Bacteria 8980
239 Ga0207674_10008437 3300026116 Bacteria 11902
240 Ga0207674_10013704 3300026116 Bacteria 8979
241 Ga0207674_10393982 3300026116 Unclassified 1338
242 Ga0207675_100438085 3300026118 Bacteria 1293
243 Ga0207698_10000003 3300026142 Bacteria 321303
244 Ga0268266_10007001 3300028379 Bacteria 10244
245 Ga0268266_10015640 3300028379 Bacteria 6502
246 Ga0268265_10087929 3300028380 Bacteria 2474
247 Ga0268264_10000442 3300028381 Bacteria 56945
248 Ga0268264_10334159 3300028381 Unclassified 1437
249 Ga0268264_11985013 3300028381 Unclassified 591
250 Ga0265326_10036663 3300028558 Unclassified 1394
251 Ga0265318_10137717 3300028577 Bacteria 897
252 Ga0265338_10135377 3300028800 Bacteria 1938
253 Ga0265760_10001376 3300031090 Bacteria 7135
254 Ga0265760_10095324 3300031090 Unclassified 936
255 Ga0265330_10075447 3300031235 Unclassified 1456
256 Ga0265320_10134326 3300031240 Bacteria 1123
257 Ga0265325_10018761 3300031241 Bacteria 3835
258 Ga0265325_10027872 3300031241 Bacteria 3049
259 Ga0265340_10003888 3300031247 Bacteria 8417
260 Ga0265339_10053565 3300031249 Bacteria 2194
261 Ga0265331_10146558 3300031250 Bacteria 1072
262 Ga0265327_10092621 3300031251 Unclassified 1471
263 Ga0265316_10015184 3300031344 Bacteria 6745
264 Ga0265313_10021491 3300031595 Bacteria 3528
265 Ga0265313_10034111 3300031595 Bacteria 2577
266 Ga0307510_10119079 3300033180 Bacteria 2352
267 Ga0436365_1645365 3300039437 Bacteria 1035
268 Ga0466963_0000875 3300044694 Bacteria 15265
269 Ga0466971_0281674 3300044719 Unclassified 796
270 Ga0466959_0546782 3300045049 Unclassified 781
271 Ga0451576_1411610 3300045051 Unclassified 724
272 Ga0466958_0035476 3300045836 Unclassified 2980
273 Ga0466967_0004000 3300045976 Bacteria 9822
274 Ga0466967_1635426 3300045976 Unclassified 641
275 Ga0495580_0326282 3300046472 Bacteria 1043
276 Ga0495585_0160324 3300046492 Unclassified 1168
277 Ga0495586_0187478 3300046535 Bacteria 1171
278 Ga0495645_0035204 3300046543 Bacteria 3651
279 Ga0495669_0028016 3300046684 Bacteria 2465
280 Ga0495669_0066284 3300046684 Bacteria 1640
281 Ga0495581_0220807 3300047315 Bacteria 1108
282 Ga0496102_1071909 3300048905 Bacteria 726
283 Ga0496104_0405439 3300048907 Unclassified 1276
284 Ga0496108_0231951 3300048911 Bacteria 1605
285 Ga0496109_0584266 3300048912 Unclassified 1053
286 Ga0496110_0038831 3300048913 Bacteria 4144
287 Ga0496112_0020533 3300048915 Bacteria 6263
288 Ga0496112_0059179 3300048915 Bacteria 3775
289 Ga0496112_0079397 3300048915 Bacteria 3245
290 Ga0496112_1333163 3300048915 Unclassified 633
291 Ga0496115_0061971 3300048918 Bacteria 3017
292 Ga0496126_0003444 3300048929 Bacteria 19969
293 nmdc:mga0rr50_4755_c1 3300050513 Bacteria 8010
294 nmdc:mga0a205_541986_c1 3300050515 Bacteria 1019
295 Ga0495601_0821918 3300053077 Unclassified 589
296 Ga0466962_0174640 3300061719 Unclassified 1047
297 Ga0265760_10003294
298 JGI24743J22301_10009762
299 rootH2_10214697
300 rootH1_10297679
301 Ga0070683_100001021
302 Ga0070683_100038724
303 Ga0070683_100056129
304 Ga0070683_100353991
305 Ga0070683_100826882
306 Ga0070670_100028795
307 Ga0068869_100075982
308 Ga0068868_100000200
309 Ga0068868_100726067
310 Ga0070661_100326365
311 Ga0070671_100046878
312 Ga0070671_100049146
313 Ga0070667_100000800
314 Ga0070709_10787857
315 Ga0070713_100031064
316 Ga0070713_100322101
317 Ga0070711_100068973
318 Ga0070663_100153486
319 Ga0070662_101043994
320 Ga0070685_10057203
321 Ga0070707_100354059
322 Ga0070707_100492458
323 Ga0070684_100001524
324 Ga0070684_100028251
325 Ga0070684_100160368
326 Ga0068853_100000090
327 Ga0068853_100102634
328 Ga0068853_100370227
329 Ga0070693_100518094
330 Ga0070665_100036235
331 Ga0070665_100049933
332 Ga0068855_100000250
333 Ga0068855_100268283
334 Ga0068855_101277904
335 Ga0068855_101410166
336 Ga0068857_100000342
337 Ga0068857_100116655
338 Ga0068857_100258153
339 Ga0068856_100005208
340 Ga0068856_100017635
341 Ga0068856_100051130
342 Ga0068856_100144225
343 Ga0068856_100728085
344 Ga0068852_100000010
345 Ga0068852_100009373
346 Ga0068852_100070593
347 Ga0068852_100082491
348 Ga0068859_100071061
349 Ga0068859_100077678
350 Ga0068859_100088704
351 Ga0068859_102554800
352 Ga0068864_100005891
353 Ga0068866_10255486
354 Ga0068861_100201673
355 Ga0068851_10113559
356 Ga0068851_10378141
357 Ga0068863_100017827
358 Ga0068863_100333909
359 Ga0068858_100006749
360 Ga0068858_100014056
361 Ga0068860_100006371
362 Ga0068860_100013333
363 Ga0068862_100104300
364 Ga0081540_1002697
365 Ga0070717_10076010
366 Ga0070717_10082393
367 Ga0070717_10263392
368 Ga0070712_100000192
369 Ga0097621_100061250
370 Ga0097621_100069273
371 Ga0097621_100134062
372 Ga0097621_100161429
373 Ga0097621_100210554
374 Ga0097621_102266407
375 Ga0068871_100015481
376 Ga0068871_100545347
377 Ga0075434_100027711
378 Ga0068865_100251892
379 Ga0068865_100758666
380 Ga0097620_100071062
381 Ga0097620_100077679
382 Ga0097620_100088700
383 Ga0097620_102554553
384 Ga0075435_100008323
385 Ga0099794_10248161
386 Ga0099795_10073389
387 Ga0099795_10074377
388 Ga0105240_10000529
389 Ga0105240_10000897
390 Ga0105240_10006920
391 Ga0105240_10012011
392 Ga0105240_10016947
393 Ga0105240_10028789
394 Ga0105240_10148057
395 Ga0105245_10084307
396 Ga0105245_10182850
397 Ga0105247_10159105
398 Ga0105247_10352097
399 Ga0105247_10803888
400 Ga0105241_10000014
401 Ga0105241_10011055
402 Ga0105241_10034901
403 Ga0105241_10048058
404 Ga0105248_10026016
405 Ga0105248_10033285
406 Ga0105248_10135287
407 Ga0105237_10021496
408 Ga0105237_10093132
409 Ga0105237_10107820
410 Ga0105237_10330382
411 Ga0105237_10369231
412 Ga0105237_10570107
413 Ga0105237_11214286
414 Ga0105238_10000390
415 Ga0105238_10011321
416 Ga0105238_10067207
417 Ga0105238_10085239
418 Ga0105238_10242594
419 Ga0105249_11328336
420 Ga0099796_10067999
421 Ga0105239_10001644
422 Ga0105239_10012098
423 Ga0105239_10073513
424 Ga0105246_10068108
425 Ga0157371_10242656
426 Ga0157371_10316282
427 Ga0157370_10000005
428 Ga0157369_10000049
429 Ga0157369_10004263
430 Ga0157369_10096133
431 Ga0157369_10119674
432 Ga0157369_10198227
433 Ga0157369_10541454
434 Ga0157374_10007036
435 Ga0157374_10062620
436 Ga0157374_10085267
437 Ga0157374_10255879
438 Ga0157374_10606181
439 Ga0157374_10999339
440 Ga0157374_11239925
441 Ga0157374_11653657
442 Ga0157374_12289305
443 Ga0157378_10002748
444 Ga0157378_10254662
445 Ga0157378_10510755
446 Ga0157378_11399324
447 Ga0163162_10004606
448 Ga0163162_10134928
449 Ga0163162_10205171
450 Ga0163162_10408407
451 Ga0157372_10000047
452 Ga0157372_10015027
453 Ga0157372_10029996
454 Ga0157372_10060686
455 Ga0157375_10056553
456 Ga0157375_10224954
457 Ga0157375_11864730
458 Ga0163163_10033545
459 Ga0163163_10401134
460 Ga0163163_10953545
461 Ga0163163_11658272
462 Ga0182008_10572075
463 Ga0157377_10164764
464 Ga0157379_10004893
465 Ga0157379_10075342
466 Ga0157376_10012219
467 Ga0157376_10031770
468 Ga0157376_10160444
469 Ga0157376_10546688
470 Ga0157376_10568762
471 Ga0157376_11635608
472 Ga0228598_1000028
473 Ga0207656_10028231
474 Ga0207710_10143335
475 Ga0207647_10040986
476 Ga0207647_10062597
477 Ga0207647_10420797
478 Ga0207654_10000018
479 Ga0207654_10027168
480 Ga0207654_10092637
481 Ga0207707_10796745
482 Ga0207695_10000119
483 Ga0207695_10000598
484 Ga0207695_10000630
485 Ga0207695_10024667
486 Ga0207695_10169062
487 Ga0207695_11132826
488 Ga0207671_10000047
489 Ga0207693_10001005
490 Ga0207663_10116389
491 Ga0207657_10216855
492 Ga0207646_10291886
493 Ga0207694_10000089
494 Ga0207694_10000198
495 Ga0207694_10001800
496 Ga0207650_10051487
497 Ga0207687_10006560
498 Ga0207687_10028313
499 Ga0207687_10184869
500 Ga0207700_10079945
501 Ga0207700_10278940
502 Ga0207700_10534216
503 Ga0207664_10015012
504 Ga0207644_10034167
505 Ga0207644_10253509
506 Ga0207665_10336414
507 Ga0207665_10413095
508 Ga0207711_10021945
509 Ga0207711_10663369
510 Ga0207689_10010678
511 Ga0207689_10018212
512 Ga0207661_10000111
513 Ga0207661_10026772
514 Ga0207661_10042676
515 Ga0207661_10193121
516 Ga0207679_10064239
517 Ga0207667_10000949
518 Ga0207667_10030113
519 Ga0207667_10053694
520 Ga0207667_10457624
521 Ga0207667_10588978
522 Ga0207667_10615950
523 Ga0207658_10000076
524 Ga0207677_10000572
525 Ga0207677_10452803
526 Ga0207703_10009729
527 Ga0207703_10015354
528 Ga0207639_10000178
529 Ga0207678_10201710
530 Ga0207702_10047618
531 Ga0207702_10245446
532 Ga0207702_10398201
533 Ga0207648_10445319
534 Ga0207676_10005485
535 Ga0207674_10008437
536 Ga0207674_10013704
537 Ga0207674_10393982
538 Ga0207675_100438085
539 Ga0207698_10000003
540 Ga0268266_10007001
541 Ga0268266_10015640
542 Ga0268265_10087929
543 Ga0268264_10000442
544 Ga0268264_10334159
545 Ga0268264_11985013
546 Ga0265326_10036663
547 Ga0265318_10137717
548 Ga0265338_10135377
549 Ga0265760_10001376
550 Ga0265760_10095324
551 Ga0265330_10075447
552 Ga0265320_10134326
553 Ga0265325_10018761
554 Ga0265325_10027872
555 Ga0265340_10003888
556 Ga0265339_10053565
557 Ga0265331_10146558
558 Ga0265327_10092621
559 Ga0265316_10015184
560 Ga0265313_10021491
561 Ga0265313_10034111
562 Ga0307510_10119079
563 Ga0436365_1645365
564 Ga0466963_0000875
565 Ga0466971_0281674
566 Ga0466959_0546782
567 Ga0451576_1411610
568 Ga0466958_0035476
569 Ga0466967_0004000
570 Ga0466967_1635426
571 Ga0495580_0326282
572 Ga0495585_0160324
573 Ga0495586_0187478
574 Ga0495645_0035204
575 Ga0495669_0028016
576 Ga0495669_0066284
577 Ga0495581_0220807
578 Ga0496102_1071909
579 Ga0496104_0405439
580 Ga0496108_0231951
581 Ga0496109_0584266
582 Ga0496110_0038831
583 Ga0496112_0020533
584 Ga0496112_0059179
585 Ga0496112_0079397
586 Ga0496112_1333163
587 Ga0496115_0061971
588 Ga0496126_0003444
589 nmdc:mga0rr50_4755_c1
590 nmdc:mga0a205_541986_c1
591 Ga0495601_0821918
592 Ga0466962_0174640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

42

152

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h5o-assembly1.cif.gz_A crystal structure of pbp2a from mrsa in complex with piperacillin at active site. 0.8619 98 153
1mws-assembly1.cif.gz_A structure of nitrocefin acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.00 a resolution. 0.8613 98 153
1vqq-assembly1.cif.gz_A structure of penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 1.80 a resolution. 0.8556 98 153
4cpk-assembly2.cif.gz_B crystal structure of pbp2a double clinical mutant n146k-e150k from mrsa 0.8548 98 153
1mwt-assembly1.cif.gz_A structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution. 0.8544 98 153
ID Description Score Start End Superfamily
af_O53651_117_225_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8229 98 156 3.10.450.230
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8128 42 161 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8074 41 162 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8068 42 161 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8015 41 162 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A0N1LJS2-F1-model_v4 DUF4440 domain-containing protein 0.9472 27 162
AF-A0A7V8NUU7-F1-model_v4 Nuclear transport factor 2 family protein 0.9454 69 164
AF-A0A2U3L1L6-F1-model_v4 DUF4440 domain-containing protein 0.9254 12 164
AF-A0A2V9PTB2-F1-model_v4 Nuclear transport factor 2 family protein 0.9251 13 164
AF-A0A2E1KJ58-F1-model_v4 DUF4440 domain-containing protein 0.9093 40 159

Map