F393172

General Info

Members Datasets Scaffolds Average Seq Length
296 188 592 126

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10983261|Ga0105239_109832612
Length 146
Sequence LREDVGRQAAPAASQAGPSLPERMARRSGLGRQAEALAAAALERAGLQIVARNWRRPEGELDLIARATDGTCVFVEVRSRTGDAFGDPLETITPRKQAQIIRAARLYLDEEKPNAPAYRFDVVAVTFTAGGDPTVVHVPSAFDTSR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.41
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10983261 3300010375 Bacteria 970
2 Ga0070676_10011372 3300005328 Bacteria 4839
3 Ga0070683_100078777 3300005329 Bacteria 3083
4 Ga0070683_101397147 3300005329 Bacteria 673
5 Ga0070690_100221974 3300005330 Bacteria 1324
6 Ga0068869_100292183 3300005334 Bacteria 1313
7 Ga0070666_10151368 3300005335 Bacteria 1619
8 Ga0070680_100077141 3300005336 Bacteria 2744
9 Ga0070680_101566172 3300005336 Bacteria 571
10 Ga0070682_100509965 3300005337 Bacteria 934
11 Ga0070682_101087426 3300005337 Bacteria 669
12 Ga0068868_100205023 3300005338 Bacteria 1646
13 Ga0068868_101388762 3300005338 Unclassified 655
14 Ga0070660_100252284 3300005339 Bacteria 1439
15 Ga0070660_101121595 3300005339 Bacteria 666
16 Ga0070689_100000010 3300005340 Bacteria 222713
17 Ga0070689_100016628 3300005340 Bacteria 5384
18 Ga0070689_100276526 3300005340 Bacteria 1392
19 Ga0070689_100441600 3300005340 Bacteria 1106
20 Ga0070687_100059051 3300005343 Bacteria 2018
21 Ga0070687_100347557 3300005343 Bacteria 956
22 Ga0070687_100907097 3300005343 Bacteria 632
23 Ga0070692_10020355 3300005345 Bacteria 3217
24 Ga0070668_100009085 3300005347 Bacteria 7381
25 Ga0070669_100004558 3300005353 Bacteria 10001
26 Ga0070675_100336836 3300005354 Bacteria 1336
27 Ga0070671_100291046 3300005355 Bacteria 1390
28 Ga0070671_100350543 3300005355 Bacteria 1260
29 Ga0070671_101559014 3300005355 Bacteria 585
30 Ga0070674_100011656 3300005356 Bacteria 5358
31 Ga0070674_101678758 3300005356 Unclassified 574
32 Ga0070673_100003648 3300005364 Bacteria 9637
33 Ga0070673_100004229 3300005364 Bacteria 9058
34 Ga0070688_100015506 3300005365 Bacteria 4339
35 Ga0070688_100030836 3300005365 Bacteria 3220
36 Ga0070688_100676522 3300005365 Bacteria 797
37 Ga0070688_101059863 3300005365 Bacteria 646
38 Ga0070659_100048234 3300005366 Bacteria 3345
39 Ga0070667_100329732 3300005367 Bacteria 1379
40 Ga0070667_100734250 3300005367 Unclassified 915
41 Ga0070667_101105315 3300005367 Bacteria 741
42 Ga0070714_101071174 3300005435 Bacteria 785
43 Ga0070713_100209270 3300005436 Bacteria 1765
44 Ga0070713_101057748 3300005436 Bacteria 784
45 Ga0070710_10190531 3300005437 Unclassified 1289
46 Ga0070701_10103792 3300005438 Bacteria 1578
47 Ga0070701_10267086 3300005438 Bacteria 1039
48 Ga0070711_100184729 3300005439 Bacteria 1598
49 Ga0070705_100201739 3300005440 Bacteria 1364
50 Ga0070705_100224076 3300005440 Bacteria 1304
51 Ga0070705_100933886 3300005440 Bacteria 700
52 Ga0070700_101483375 3300005441 Bacteria 576
53 Ga0070700_101821451 3300005441 Bacteria 525
54 Ga0070708_100951888 3300005445 Bacteria 806
55 Ga0070678_100086245 3300005456 Bacteria 2394
56 Ga0070662_101858767 3300005457 Unclassified 520
57 Ga0070681_10032541 3300005458 Bacteria 5233
58 Ga0070681_10271906 3300005458 Bacteria 1606
59 Ga0068867_100020366 3300005459 Bacteria 4726
60 Ga0068867_100753148 3300005459 Bacteria 864
61 Ga0070685_10314419 3300005466 Bacteria 1059
62 Ga0070679_100022163 3300005530 Bacteria 6206
63 Ga0070679_100026080 3300005530 Bacteria 5737
64 Ga0070679_100749474 3300005530 Bacteria 919
65 Ga0070679_102112824 3300005530 Bacteria 513
66 Ga0070684_100073830 3300005535 Bacteria 3006
67 Ga0068853_100403465 3300005539 Bacteria 1280
68 Ga0068853_102054967 3300005539 Unclassified 554
69 Ga0070672_100019160 3300005543 Bacteria 4962
70 Ga0070672_100025823 3300005543 Bacteria 4363
71 Ga0070672_100233786 3300005543 Bacteria 1545
72 Ga0070686_100014737 3300005544 Bacteria 4511
73 Ga0070686_100671439 3300005544 Bacteria 824
74 Ga0070686_101531667 3300005544 Bacteria 563
75 Ga0070695_100425325 3300005545 Bacteria 1012
76 Ga0068855_100093708 3300005563 Bacteria 3463
77 Ga0068855_100211253 3300005563 Bacteria 2180
78 Ga0070664_102337459 3300005564 Bacteria 507
79 Ga0068857_101542254 3300005577 Bacteria 648
80 Ga0068856_100284736 3300005614 Bacteria 1670
81 Ga0068856_100375938 3300005614 Bacteria 1440
82 Ga0068856_100423301 3300005614 Bacteria 1351
83 Ga0068856_100727107 3300005614 Bacteria 1013
84 Ga0068856_101353666 3300005614 Unclassified 727
85 Ga0068856_101358912 3300005614 Bacteria 725
86 Ga0070702_100008978 3300005615 Bacteria 4870
87 Ga0070702_100112337 3300005615 Bacteria 1691
88 Ga0068852_100170635 3300005616 Bacteria 2039
89 Ga0068859_100194351 3300005617 Bacteria 2113
90 Ga0068864_100771840 3300005618 Bacteria 943
91 Ga0068870_10472042 3300005840 Bacteria 831
92 Ga0068863_100921135 3300005841 Bacteria 875
93 Ga0068858_100105486 3300005842 Bacteria 2630
94 Ga0068860_100458078 3300005843 Bacteria 1269
95 Ga0068860_102254394 3300005843 Unclassified 565
96 Ga0068862_100098377 3300005844 Bacteria 2555
97 Ga0081455_10607135 3300005937 Unclassified 712
98 Ga0070717_10053407 3300006028 Bacteria 3331
99 Ga0070716_100362137 3300006173 Bacteria 1030
100 Ga0070712_101300235 3300006175 Bacteria 634
101 Ga0097621_102281960 3300006237 Bacteria 518
102 Ga0075428_100869546 3300006844 Bacteria 957
103 Ga0068865_100041776 3300006881 Bacteria 3123
104 Ga0097620_100194350 3300006931 Bacteria 2113
105 Ga0105240_10459732 3300009093 Bacteria 1423
106 Ga0105240_11244473 3300009093 Bacteria 787
107 Ga0111539_10172650 3300009094 Bacteria 2525
108 Ga0105243_10029053 3300009148 Bacteria 4250
109 Ga0105237_10000115 3300009545 Bacteria 112419
110 Ga0105238_10042226 3300009551 Bacteria 4618
111 Ga0105249_10127259 3300009553 Bacteria 2427
112 Ga0157369_10274322 3300013105 Bacteria 1757
113 Ga0157369_11689541 3300013105 Bacteria 643
114 Ga0157374_10071202 3300013296 Bacteria 3278
115 Ga0157374_11804023 3300013296 Unclassified 637
116 Ga0157378_10158731 3300013297 Bacteria 2113
117 Ga0163163_11171600 3300014325 Bacteria 831
118 Ga0157379_10151300 3300014968 Bacteria 2093
119 Ga0157379_11114787 3300014968 Bacteria 756
120 Ga0157376_10337727 3300014969 Bacteria 1438
121 Ga0157376_10875484 3300014969 Bacteria 915
122 Ga0157376_11317645 3300014969 Unclassified 752
123 Ga0213876_10152877 3300021384 Bacteria 1227
124 Ga0207666_1003004 3300025271 Bacteria 2051
125 Ga0207642_10166039 3300025899 Bacteria 1190
126 Ga0207688_10065296 3300025901 Bacteria 2056
127 Ga0207680_10111751 3300025903 Bacteria 1773
128 Ga0207647_10323319 3300025904 Bacteria 876
129 Ga0207643_10186514 3300025908 Bacteria 1257
130 Ga0207705_10249920 3300025909 Bacteria 1352
131 Ga0207707_10437292 3300025912 Bacteria 1120
132 Ga0207707_11118158 3300025912 Bacteria 641
133 Ga0207695_10810938 3300025913 Bacteria 816
134 Ga0207671_10000335 3300025914 Bacteria 69222
135 Ga0207660_10290688 3300025917 Unclassified 1299
136 Ga0207660_11492230 3300025917 Unclassified 546
137 Ga0207662_10066560 3300025918 Bacteria 2171
138 Ga0207657_11489885 3300025919 Bacteria 506
139 Ga0207652_10002880 3300025921 Bacteria 14391
140 Ga0207652_10184028 3300025921 Bacteria 1878
141 Ga0207681_10000576 3300025923 Bacteria 24993
142 Ga0207694_10054853 3300025924 Bacteria 3093
143 Ga0207650_10062584 3300025925 Bacteria 2781
144 Ga0207659_10471329 3300025926 Bacteria 1060
145 Ga0207687_10203204 3300025927 Bacteria 1550
146 Ga0207700_10324668 3300025928 Bacteria 1335
147 Ga0207644_10061029 3300025931 Bacteria 2730
148 Ga0207706_10124765 3300025933 Bacteria 2265
149 Ga0207706_11420735 3300025933 Unclassified 569
150 Ga0207709_10012909 3300025935 Bacteria 4606
151 Ga0207670_10026253 3300025936 Bacteria 3668
152 Ga0207670_10804612 3300025936 Bacteria 783
153 Ga0207669_10014150 3300025937 Bacteria 3991
154 Ga0207691_10060026 3300025940 Bacteria 3457
155 Ga0207691_10072164 3300025940 Bacteria 3114
156 Ga0207691_10078946 3300025940 Bacteria 2963
157 Ga0207689_10071465 3300025942 Bacteria 2850
158 Ga0207661_10041935 3300025944 Bacteria 3606
159 Ga0207661_10978267 3300025944 Bacteria 779
160 Ga0207679_11875456 3300025945 Bacteria 547
161 Ga0207667_10039386 3300025949 Bacteria 5037
162 Ga0207667_10195127 3300025949 Bacteria 2077
163 Ga0207651_10004826 3300025960 Bacteria 6863
164 Ga0207712_10087310 3300025961 Bacteria 2287
165 Ga0207668_10260630 3300025972 Bacteria 1412
166 Ga0207658_10920219 3300025986 Unclassified 796
167 Ga0207677_11138476 3300026023 Bacteria 712
168 Ga0207703_10468162 3300026035 Bacteria 1179
169 Ga0207639_10426823 3300026041 Bacteria 1199
170 Ga0207708_10003484 3300026075 Bacteria 11605
171 Ga0207708_11860387 3300026075 Bacteria 528
172 Ga0207702_10220162 3300026078 Bacteria 1769
173 Ga0207702_10254986 3300026078 Bacteria 1649
174 Ga0207702_10305001 3300026078 Bacteria 1512
175 Ga0207702_10319034 3300026078 Bacteria 1479
176 Ga0207702_10732490 3300026078 Bacteria 975
177 Ga0207702_11174903 3300026078 Bacteria 762
178 Ga0207648_10008472 3300026089 Bacteria 9952
179 Ga0207648_11102699 3300026089 Bacteria 744
180 Ga0207674_10160567 3300026116 Bacteria 2202
181 Ga0207674_10353762 3300026116 Bacteria 1420
182 Ga0207675_100018494 3300026118 Bacteria 6499
183 Ga0207683_10049388 3300026121 Bacteria 3683
184 Ga0207683_10384819 3300026121 Bacteria 1290
185 Ga0207698_10085738 3300026142 Bacteria 2559
186 Ga0209998_10158190 3300027717 Unclassified 584
187 Ga0207428_10002643 3300027907 Bacteria 17859
188 Ga0268265_10147646 3300028380 Bacteria 1978
189 Ga0268264_10064257 3300028381 Bacteria 3088
190 Ga0265337_1021302 3300028556 Bacteria 2022
191 Ga0265319_1127914 3300028563 Unclassified 790
192 Ga0265318_10279768 3300028577 Unclassified 609
193 Ga0265323_10183110 3300028653 Bacteria 663
194 Ga0265322_10121307 3300028654 Unclassified 745
195 Ga0265338_10023599 3300028800 Bacteria 6317
196 Ga0265338_10228477 3300028800 Bacteria 1385
197 Ga0265338_10886575 3300028800 Unclassified 608
198 Ga0265324_10000019 3300029957 Bacteria 177592
199 Ga0265324_10014883 3300029957 Bacteria 2867
200 Ga0265330_10002529 3300031235 Bacteria 9940
201 Ga0265330_10005299 3300031235 Bacteria 6425
202 Ga0265330_10029125 3300031235 Bacteria 2485
203 Ga0265332_10260311 3300031238 Bacteria 717
204 Ga0265320_10001917 3300031240 Bacteria 14683
205 Ga0265329_10030874 3300031242 Bacteria 1743
206 Ga0265340_10032674 3300031247 Unclassified 2597
207 Ga0265339_10000019 3300031249 Bacteria 177620
208 Ga0265339_10006030 3300031249 Bacteria 8010
209 Ga0265316_10000227 3300031344 Bacteria 65091
210 Ga0265316_10007220 3300031344 Bacteria 10494
211 Ga0265316_10030010 3300031344 Bacteria 4463
212 Ga0265316_10314075 3300031344 Bacteria 1139
213 Ga0265316_10319128 3300031344 Bacteria 1129
214 Ga0265316_10367543 3300031344 Bacteria 1039
215 Ga0265313_10088471 3300031595 Bacteria 1394
216 Ga0265313_10120068 3300031595 Bacteria 1147
217 Ga0265313_10156504 3300031595 Bacteria 970
218 Ga0265314_10058566 3300031711 Bacteria 2639
219 Ga0265342_10003174 3300031712 Bacteria 13681
220 Ga0265342_10243331 3300031712 Unclassified 962
221 Ga0373953_0217226 3300035117 Bacteria 828
222 Ga0373954_0054531 3300035118 Bacteria 1880
223 Ga0373956_0020887 3300035119 Bacteria 2791
224 Ga0373956_0144396 3300035119 Bacteria 1118
225 Ga0373957_0025429 3300035120 Bacteria 2133
226 Ga0373957_0054589 3300035120 Unclassified 1535
227 Ga0373943_0039876 3300035170 Bacteria 2265
228 Ga0373955_0075244 3300035172 Bacteria 1897
229 Ga0373955_0206129 3300035172 Bacteria 1171
230 Ga0373924_0304092 3300035410 Bacteria 708
231 Ga0373935_0044964 3300035692 Bacteria 2785
232 Ga0373927_0227333 3300035695 Bacteria 1226
233 Ga0373927_0483518 3300035695 Bacteria 818
234 Ga0373933_0065265 3300035724 Bacteria 2204
235 Ga0373933_0129710 3300035724 Bacteria 1584
236 Ga0373947_0879232 3300035725 Bacteria 612
237 Ga0373937_0004140 3300036401 Bacteria 12305
238 Ga0373937_0378689 3300036401 Bacteria 1342
239 Ga0373937_0482169 3300036401 Bacteria 1178
240 Ga0373937_1244667 3300036401 Unclassified 692
241 Ga0373925_0308509 3300037068 Bacteria 1279
242 Ga0436365_0748421 3300039437 Bacteria 1867
243 Ga0466963_1086008 3300044694 Bacteria 563
244 Ga0453684_0000999 3300044712 Bacteria 92098
245 Ga0495603_0512959 3300046455 Unclassified 687
246 Ga0495628_0372710 3300046516 Bacteria 1046
247 Ga0495628_0995134 3300046516 Bacteria 577
248 Ga0495630_0262236 3300046517 Bacteria 1320
249 Ga0495586_0141311 3300046535 Bacteria 1351
250 Ga0495634_0043418 3300046642 Bacteria 3046
251 Ga0495674_0063781 3300047319 Bacteria 3204
252 Ga0495672_0446130 3300047320 Unclassified 584
253 Ga0496100_1164860 3300048903 Bacteria 608
254 Ga0496102_1435068 3300048905 Bacteria 609
255 Ga0496104_0030938 3300048907 Bacteria 4976
256 Ga0496104_0069635 3300048907 Bacteria 3344
257 Ga0496104_1257685 3300048907 Unclassified 643
258 Ga0496105_0153907 3300048908 Bacteria 1889
259 Ga0496106_0321632 3300048909 Bacteria 1242
260 Ga0496108_0021013 3300048911 Bacteria 5366
261 Ga0496109_0034827 3300048912 Bacteria 4538
262 Ga0496109_0299181 3300048912 Bacteria 1517
263 Ga0496110_0509068 3300048913 Bacteria 1096
264 Ga0496112_0127720 3300048915 Unclassified 2513
265 Ga0496114_0005745 3300048917 Bacteria 9735
266 Ga0496115_0099742 3300048918 Bacteria 2380
267 Ga0496115_0479539 3300048918 Bacteria 1002
268 Ga0496115_0665026 3300048918 Bacteria 822
269 Ga0501036_0738214 3300049572 Bacteria 812
270 Ga0501067_0007954 3300049583 Bacteria 5890
271 Ga0501068_0017293 3300049584 Bacteria 4169
272 Ga0501069_0054518 3300049585 Bacteria 2227
273 Ga0501069_0132888 3300049585 Bacteria 1425
274 Ga0501070_0000575 3300049586 Bacteria 33460
275 Ga0501070_0043534 3300049586 Bacteria 3736
276 Ga0501073_0013167 3300049589 Bacteria 6030
277 Ga0501073_0019704 3300049589 Bacteria 4869
278 Ga0501073_0085175 3300049589 Bacteria 2199
279 Ga0501073_0761907 3300049589 Bacteria 667
280 Ga0501074_0006924 3300049590 Bacteria 8185
281 Ga0501074_0084568 3300049590 Bacteria 2274
282 Ga0501079_0695969 3300049741 Bacteria 800
283 Ga0501080_0046562 3300049742 Bacteria 4038
284 Ga0501080_0128794 3300049742 Bacteria 2343
285 Ga0501080_0253693 3300049742 Bacteria 1604
286 Ga0501080_0539481 3300049742 Bacteria 1040
287 Ga0501081_0054058 3300049743 Bacteria 2774
288 Ga0501081_0680572 3300049743 Unclassified 772
289 Ga0501083_0017020 3300049744 Bacteria 5075
290 Ga0501083_0354721 3300049744 Bacteria 953
291 Ga0501083_0734722 3300049744 Unclassified 642
292 nmdc:mga08y16_2139_c1 3300050511 Bacteria 20263
293 Ga0501084_0430993 3300054114 Bacteria 1115
294 Ga0501084_1180059 3300054114 Bacteria 642
295 Ga0501082_0000739 3300060353 Bacteria 28788
296 Ga0501082_0062517 3300060353 Bacteria 3205
297 Ga0105239_10983261
298 Ga0070676_10011372
299 Ga0070683_100078777
300 Ga0070683_101397147
301 Ga0070690_100221974
302 Ga0068869_100292183
303 Ga0070666_10151368
304 Ga0070680_100077141
305 Ga0070680_101566172
306 Ga0070682_100509965
307 Ga0070682_101087426
308 Ga0068868_100205023
309 Ga0068868_101388762
310 Ga0070660_100252284
311 Ga0070660_101121595
312 Ga0070689_100000010
313 Ga0070689_100016628
314 Ga0070689_100276526
315 Ga0070689_100441600
316 Ga0070687_100059051
317 Ga0070687_100347557
318 Ga0070687_100907097
319 Ga0070692_10020355
320 Ga0070668_100009085
321 Ga0070669_100004558
322 Ga0070675_100336836
323 Ga0070671_100291046
324 Ga0070671_100350543
325 Ga0070671_101559014
326 Ga0070674_100011656
327 Ga0070674_101678758
328 Ga0070673_100003648
329 Ga0070673_100004229
330 Ga0070688_100015506
331 Ga0070688_100030836
332 Ga0070688_100676522
333 Ga0070688_101059863
334 Ga0070659_100048234
335 Ga0070667_100329732
336 Ga0070667_100734250
337 Ga0070667_101105315
338 Ga0070714_101071174
339 Ga0070713_100209270
340 Ga0070713_101057748
341 Ga0070710_10190531
342 Ga0070701_10103792
343 Ga0070701_10267086
344 Ga0070711_100184729
345 Ga0070705_100201739
346 Ga0070705_100224076
347 Ga0070705_100933886
348 Ga0070700_101483375
349 Ga0070700_101821451
350 Ga0070708_100951888
351 Ga0070678_100086245
352 Ga0070662_101858767
353 Ga0070681_10032541
354 Ga0070681_10271906
355 Ga0068867_100020366
356 Ga0068867_100753148
357 Ga0070685_10314419
358 Ga0070679_100022163
359 Ga0070679_100026080
360 Ga0070679_100749474
361 Ga0070679_102112824
362 Ga0070684_100073830
363 Ga0068853_100403465
364 Ga0068853_102054967
365 Ga0070672_100019160
366 Ga0070672_100025823
367 Ga0070672_100233786
368 Ga0070686_100014737
369 Ga0070686_100671439
370 Ga0070686_101531667
371 Ga0070695_100425325
372 Ga0068855_100093708
373 Ga0068855_100211253
374 Ga0070664_102337459
375 Ga0068857_101542254
376 Ga0068856_100284736
377 Ga0068856_100375938
378 Ga0068856_100423301
379 Ga0068856_100727107
380 Ga0068856_101353666
381 Ga0068856_101358912
382 Ga0070702_100008978
383 Ga0070702_100112337
384 Ga0068852_100170635
385 Ga0068859_100194351
386 Ga0068864_100771840
387 Ga0068870_10472042
388 Ga0068863_100921135
389 Ga0068858_100105486
390 Ga0068860_100458078
391 Ga0068860_102254394
392 Ga0068862_100098377
393 Ga0081455_10607135
394 Ga0070717_10053407
395 Ga0070716_100362137
396 Ga0070712_101300235
397 Ga0097621_102281960
398 Ga0075428_100869546
399 Ga0068865_100041776
400 Ga0097620_100194350
401 Ga0105240_10459732
402 Ga0105240_11244473
403 Ga0111539_10172650
404 Ga0105243_10029053
405 Ga0105237_10000115
406 Ga0105238_10042226
407 Ga0105249_10127259
408 Ga0157369_10274322
409 Ga0157369_11689541
410 Ga0157374_10071202
411 Ga0157374_11804023
412 Ga0157378_10158731
413 Ga0163163_11171600
414 Ga0157379_10151300
415 Ga0157379_11114787
416 Ga0157376_10337727
417 Ga0157376_10875484
418 Ga0157376_11317645
419 Ga0213876_10152877
420 Ga0207666_1003004
421 Ga0207642_10166039
422 Ga0207688_10065296
423 Ga0207680_10111751
424 Ga0207647_10323319
425 Ga0207643_10186514
426 Ga0207705_10249920
427 Ga0207707_10437292
428 Ga0207707_11118158
429 Ga0207695_10810938
430 Ga0207671_10000335
431 Ga0207660_10290688
432 Ga0207660_11492230
433 Ga0207662_10066560
434 Ga0207657_11489885
435 Ga0207652_10002880
436 Ga0207652_10184028
437 Ga0207681_10000576
438 Ga0207694_10054853
439 Ga0207650_10062584
440 Ga0207659_10471329
441 Ga0207687_10203204
442 Ga0207700_10324668
443 Ga0207644_10061029
444 Ga0207706_10124765
445 Ga0207706_11420735
446 Ga0207709_10012909
447 Ga0207670_10026253
448 Ga0207670_10804612
449 Ga0207669_10014150
450 Ga0207691_10060026
451 Ga0207691_10072164
452 Ga0207691_10078946
453 Ga0207689_10071465
454 Ga0207661_10041935
455 Ga0207661_10978267
456 Ga0207679_11875456
457 Ga0207667_10039386
458 Ga0207667_10195127
459 Ga0207651_10004826
460 Ga0207712_10087310
461 Ga0207668_10260630
462 Ga0207658_10920219
463 Ga0207677_11138476
464 Ga0207703_10468162
465 Ga0207639_10426823
466 Ga0207708_10003484
467 Ga0207708_11860387
468 Ga0207702_10220162
469 Ga0207702_10254986
470 Ga0207702_10305001
471 Ga0207702_10319034
472 Ga0207702_10732490
473 Ga0207702_11174903
474 Ga0207648_10008472
475 Ga0207648_11102699
476 Ga0207674_10160567
477 Ga0207674_10353762
478 Ga0207675_100018494
479 Ga0207683_10049388
480 Ga0207683_10384819
481 Ga0207698_10085738
482 Ga0209998_10158190
483 Ga0207428_10002643
484 Ga0268265_10147646
485 Ga0268264_10064257
486 Ga0265337_1021302
487 Ga0265319_1127914
488 Ga0265318_10279768
489 Ga0265323_10183110
490 Ga0265322_10121307
491 Ga0265338_10023599
492 Ga0265338_10228477
493 Ga0265338_10886575
494 Ga0265324_10000019
495 Ga0265324_10014883
496 Ga0265330_10002529
497 Ga0265330_10005299
498 Ga0265330_10029125
499 Ga0265332_10260311
500 Ga0265320_10001917
501 Ga0265329_10030874
502 Ga0265340_10032674
503 Ga0265339_10000019
504 Ga0265339_10006030
505 Ga0265316_10000227
506 Ga0265316_10007220
507 Ga0265316_10030010
508 Ga0265316_10314075
509 Ga0265316_10319128
510 Ga0265316_10367543
511 Ga0265313_10088471
512 Ga0265313_10120068
513 Ga0265313_10156504
514 Ga0265314_10058566
515 Ga0265342_10003174
516 Ga0265342_10243331
517 Ga0373953_0217226
518 Ga0373954_0054531
519 Ga0373956_0020887
520 Ga0373956_0144396
521 Ga0373957_0025429
522 Ga0373957_0054589
523 Ga0373943_0039876
524 Ga0373955_0075244
525 Ga0373955_0206129
526 Ga0373924_0304092
527 Ga0373935_0044964
528 Ga0373927_0227333
529 Ga0373927_0483518
530 Ga0373933_0065265
531 Ga0373933_0129710
532 Ga0373947_0879232
533 Ga0373937_0004140
534 Ga0373937_0378689
535 Ga0373937_0482169
536 Ga0373937_1244667
537 Ga0373925_0308509
538 Ga0436365_0748421
539 Ga0466963_1086008
540 Ga0453684_0000999
541 Ga0495603_0512959
542 Ga0495628_0372710
543 Ga0495628_0995134
544 Ga0495630_0262236
545 Ga0495586_0141311
546 Ga0495634_0043418
547 Ga0495674_0063781
548 Ga0495672_0446130
549 Ga0496100_1164860
550 Ga0496102_1435068
551 Ga0496104_0030938
552 Ga0496104_0069635
553 Ga0496104_1257685
554 Ga0496105_0153907
555 Ga0496106_0321632
556 Ga0496108_0021013
557 Ga0496109_0034827
558 Ga0496109_0299181
559 Ga0496110_0509068
560 Ga0496112_0127720
561 Ga0496114_0005745
562 Ga0496115_0099742
563 Ga0496115_0479539
564 Ga0496115_0665026
565 Ga0501036_0738214
566 Ga0501067_0007954
567 Ga0501068_0017293
568 Ga0501069_0054518
569 Ga0501069_0132888
570 Ga0501070_0000575
571 Ga0501070_0043534
572 Ga0501073_0013167
573 Ga0501073_0019704
574 Ga0501073_0085175
575 Ga0501073_0761907
576 Ga0501074_0006924
577 Ga0501074_0084568
578 Ga0501079_0695969
579 Ga0501080_0046562
580 Ga0501080_0128794
581 Ga0501080_0253693
582 Ga0501080_0539481
583 Ga0501081_0054058
584 Ga0501081_0680572
585 Ga0501083_0017020
586 Ga0501083_0354721
587 Ga0501083_0734722
588 nmdc:mga08y16_2139_c1
589 Ga0501084_0430993
590 Ga0501084_1180059
591 Ga0501082_0000739
592 Ga0501082_0062517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

34

125

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8488 11 123
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8335 11 123
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6543 8 116
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6489 13 116
2wcz-assembly1.cif.gz_A 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6483 12 116
ID Description Score Start End Superfamily
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9436 11 116 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8874 11 116 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8718 12 121 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8589 11 123 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8437 11 123 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A494T1E2-F1-model_v4 UPF0102 protein D8W71_15020 0.9612 7 119 GO:0003676
AF-A0A1P8Y975-F1-model_v4 UPF0102 protein BTZ20_2213 0.9607 15 119 GO:0003676
AF-W5TMA9-F1-model_v4 UPF0102 protein NONO_c55970 0.9582 7 119 GO:0003676
AF-Q5YS49-F1-model_v4 UPF0102 protein NFA_41430 0.9582 7 119 GO:0003676
AF-A0A355FV60-F1-model_v4 UPF0102 protein DDZ19_05065 0.958 7 123 GO:0003676

Map