F393161

General Info

Members Datasets Scaffolds Average Seq Length
296 192 592 147

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000374|Ga0105237_1000037442
Length 168
Sequence MPHFLYIAFIPSGNVQIKMTAEQYPKVYLYRRIVQAKLFIDNNYAEKIDLGNISDEAYFSKFHFIRLFKSVYGKTPHQYLKYVRIEKAKELLKNEVSVSEACFFVGFDSVSSFSGLFSKVVGTSPSAYLTKHQQTKRKISLAPLSFVPGCYAYQHGWLENSNFEEASD

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
169 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 2738541283 Pedobacter sp. OK701 Isolate Unclassified
189 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
190 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
191 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
192 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 0.68
Rhizosphere 92.23
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10000374 3300009545 Bacteria 63655
2 JGI24737J22298_10016155 3300001990 Bacteria 2410
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 rootH1_10008281 3300003316 Bacteria 9606
5 rootL2_10057629 3300003322 Bacteria 1160
6 rootL2_10080696 3300003322 Bacteria 9513
7 rootH1_10033781 3300003323 Bacteria 42650
8 rootH1_10138725 3300003323 Bacteria 2184
9 Ga0055530_10002397 3300003791 Bacteria 12131
10 Ga0065712_10582188 3300005290 Unclassified 533
11 Ga0070658_10000075 3300005327 Bacteria 95412
12 Ga0070658_10558588 3300005327 Bacteria 991
13 Ga0070676_10086032 3300005328 Bacteria 1917
14 Ga0070683_100488037 3300005329 Bacteria 1176
15 Ga0070690_100974874 3300005330 Bacteria 667
16 Ga0070670_100338540 3300005331 Bacteria 1320
17 Ga0070670_100394691 3300005331 Bacteria 1221
18 Ga0070677_10005515 3300005333 Bacteria 4170
19 Ga0070677_10735638 3300005333 Bacteria 558
20 Ga0070666_10194563 3300005335 Unclassified 1426
21 Ga0070682_101232181 3300005337 Bacteria 633
22 Ga0070689_100778315 3300005340 Unclassified 840
23 Ga0070661_100020803 3300005344 Bacteria 4681
24 Ga0070669_101498380 3300005353 Bacteria 586
25 Ga0070671_100241497 3300005355 Bacteria 1533
26 Ga0070673_102013837 3300005364 Bacteria 548
27 Ga0070667_100019134 3300005367 Bacteria 5678
28 Ga0070667_100238187 3300005367 Bacteria 1624
29 Ga0070694_100712764 3300005444 Bacteria 817
30 Ga0070708_101909259 3300005445 Unclassified 550
31 Ga0070663_100153453 3300005455 Bacteria 1768
32 Ga0070678_100067904 3300005456 Bacteria 2655
33 Ga0068867_101503888 3300005459 Bacteria 627
34 Ga0070685_10626301 3300005466 Unclassified 777
35 Ga0070697_100176540 3300005536 Bacteria 1810
36 Ga0068853_100012203 3300005539 Bacteria 6987
37 Ga0068853_100144414 3300005539 Bacteria 2138
38 Ga0068853_100276328 3300005539 Bacteria 1548
39 Ga0068853_100616324 3300005539 Unclassified 1031
40 Ga0070672_100068708 3300005543 Bacteria 2811
41 Ga0070672_100138225 3300005543 Bacteria 2007
42 Ga0070695_100128516 3300005545 Bacteria 1743
43 Ga0070696_100546425 3300005546 Bacteria 928
44 Ga0070693_100200138 3300005547 Bacteria 1297
45 Ga0070665_100035330 3300005548 Bacteria 5025
46 Ga0070665_100531943 3300005548 Bacteria 1187
47 Ga0068855_100016854 3300005563 Bacteria 8788
48 Ga0068855_100273565 3300005563 Bacteria 1878
49 Ga0068855_100317201 3300005563 Unclassified 1724
50 Ga0068855_100473222 3300005563 Bacteria 1364
51 Ga0070664_100298385 3300005564 Bacteria 1456
52 Ga0070664_101756343 3300005564 Unclassified 588
53 Ga0068857_100474143 3300005577 Unclassified 1172
54 Ga0068854_100631177 3300005578 Bacteria 918
55 Ga0068854_101650535 3300005578 Unclassified 585
56 Ga0068856_100000292 3300005614 Bacteria 54884
57 Ga0068856_100044309 3300005614 Bacteria 4378
58 Ga0070702_101312765 3300005615 Bacteria 588
59 Ga0068852_100128858 3300005616 Bacteria 2327
60 Ga0068852_101489717 3300005616 Bacteria 699
61 Ga0068852_101687080 3300005616 Bacteria 656
62 Ga0068864_100108298 3300005618 Bacteria 2473
63 Ga0068861_100109593 3300005719 Bacteria 2210
64 Ga0068861_101154079 3300005719 Unclassified 747
65 Ga0068861_101181279 3300005719 Bacteria 739
66 Ga0068851_10046354 3300005834 Bacteria 2199
67 Ga0068863_100051719 3300005841 Bacteria 3893
68 Ga0068863_101871546 3300005841 Bacteria 610
69 Ga0068860_100011883 3300005843 Bacteria 8583
70 Ga0068860_100101465 3300005843 Bacteria 2746
71 Ga0068862_100014929 3300005844 Bacteria 6452
72 Ga0081455_10003766 3300005937 Bacteria 17311
73 Ga0081539_10000042 3300005985 Bacteria 289955
74 Ga0075368_10460074 3300006042 Bacteria 564
75 Ga0075366_10001336 3300006195 Bacteria 12316
76 Ga0097621_100053980 3300006237 Bacteria 3276
77 Ga0097621_100374185 3300006237 Bacteria 1271
78 Ga0068871_100192222 3300006358 Bacteria 1759
79 Ga0068871_100476483 3300006358 Bacteria 1122
80 Ga0075428_100018025 3300006844 Bacteria 7802
81 Ga0075428_101347425 3300006844 Bacteria 750
82 Ga0075430_100328003 3300006846 Bacteria 1265
83 Ga0075430_101329218 3300006846 Bacteria 591
84 Ga0075431_100070061 3300006847 Bacteria 3618
85 Ga0075431_100289819 3300006847 Unclassified 1656
86 Ga0075431_101151427 3300006847 Bacteria 739
87 Ga0075433_10112423 3300006852 Unclassified 2416
88 Ga0075433_10545845 3300006852 Bacteria 1019
89 Ga0075434_100034987 3300006871 Bacteria 4964
90 Ga0075434_100102187 3300006871 Unclassified 2874
91 Ga0075429_100336557 3300006880 Bacteria 1321
92 Ga0068865_100081440 3300006881 Bacteria 2324
93 Ga0075435_100060076 3300007076 Bacteria 3081
94 Ga0105240_10088970 3300009093 Bacteria 3777
95 Ga0105240_10139285 3300009093 Bacteria 2902
96 Ga0105240_10352096 3300009093 Bacteria 1670
97 Ga0105240_10700169 3300009093 Bacteria 1106
98 Ga0105240_10805364 3300009093 Bacteria 1017
99 Ga0105240_10992191 3300009093 Bacteria 899
100 Ga0111539_10008388 3300009094 Bacteria 13146
101 Ga0111539_10818054 3300009094 Bacteria 1084
102 Ga0111539_11073924 3300009094 Bacteria 935
103 Ga0114129_10305950 3300009147 Unclassified 2117
104 Ga0105243_10344006 3300009148 Bacteria 1367
105 Ga0105241_10053238 3300009174 Unclassified 3094
106 Ga0105241_10085351 3300009174 Bacteria 2481
107 Ga0105241_10181803 3300009174 Bacteria 1745
108 Ga0105241_10717876 3300009174 Bacteria 914
109 Ga0105248_10787256 3300009177 Bacteria 1073
110 Ga0105237_10000552 3300009545 Bacteria 52409
111 Ga0105237_10001504 3300009545 Bacteria 30678
112 Ga0105237_10016184 3300009545 Bacteria 7756
113 Ga0105237_10639180 3300009545 Bacteria 1071
114 Ga0105237_11940346 3300009545 Unclassified 597
115 Ga0105238_10429642 3300009551 Bacteria 1316
116 Ga0105249_10013386 3300009553 Bacteria 7246
117 Ga0105249_10235464 3300009553 Bacteria 1808
118 Ga0105239_10000166 3300010375 Bacteria 94743
119 Ga0105239_10001262 3300010375 Bacteria 34266
120 Ga0105239_10018887 3300010375 Bacteria 7616
121 Ga0105239_10027905 3300010375 Bacteria 6211
122 Ga0105239_10064232 3300010375 Bacteria 4029
123 Ga0105239_10818115 3300010375 Bacteria 1067
124 Ga0105239_11441803 3300010375 Bacteria 795
125 Ga0157371_10102568 3300013102 Bacteria 2030
126 Ga0157371_10294467 3300013102 Bacteria 1174
127 Ga0157370_10000568 3300013104 Bacteria 46015
128 Ga0157370_10050424 3300013104 Bacteria 3978
129 Ga0157370_10109944 3300013104 Bacteria 2576
130 Ga0157370_10682727 3300013104 Bacteria 938
131 Ga0157369_10100118 3300013105 Bacteria 3089
132 Ga0157369_10127696 3300013105 Bacteria 2695
133 Ga0157374_10317632 3300013296 Bacteria 1543
134 Ga0157378_10409206 3300013297 Bacteria 1338
135 Ga0157378_10574746 3300013297 Bacteria 1135
136 Ga0163162_10002147 3300013306 Bacteria 18504
137 Ga0163162_10517951 3300013306 Bacteria 1322
138 Ga0163162_10918936 3300013306 Bacteria 987
139 Ga0163162_11885478 3300013306 Bacteria 684
140 Ga0157372_10040387 3300013307 Bacteria 5153
141 Ga0157372_10106953 3300013307 Bacteria 3200
142 Ga0157372_10375297 3300013307 Bacteria 1657
143 Ga0157372_10903770 3300013307 Bacteria 1024
144 Ga0157375_10070622 3300013308 Bacteria 3503
145 Ga0157375_11781998 3300013308 Unclassified 730
146 Ga0157375_12260219 3300013308 Bacteria 648
147 Ga0163163_10538249 3300014325 Bacteria 1230
148 Ga0157380_10002949 3300014326 Bacteria 11573
149 Ga0157380_12561910 3300014326 Bacteria 576
150 Ga0182008_10000732 3300014497 Bacteria 23271
151 Ga0157377_10072979 3300014745 Bacteria 1987
152 Ga0157379_10026333 3300014968 Bacteria 5177
153 Ga0157379_12182355 3300014968 Bacteria 550
154 Ga0163161_10000233 3300017792 Bacteria 51225
155 Ga0163161_10006153 3300017792 Bacteria 8312
156 Ga0163161_11386878 3300017792 Bacteria 613
157 Ga0213876_10010743 3300021384 Bacteria 4906
158 Ga0209455_1001480 3300025272 Bacteria 10559
159 Ga0209676_1000001 3300025292 Bacteria 1852142
160 Ga0209050_1000016 3300025298 Bacteria 729149
161 Ga0207656_10355710 3300025321 Bacteria 731
162 Ga0207682_10060099 3300025893 Bacteria 1589
163 Ga0207710_10086376 3300025900 Unclassified 1462
164 Ga0207680_10127812 3300025903 Bacteria 1671
165 Ga0207647_10015941 3300025904 Bacteria 5137
166 Ga0207645_10031418 3300025907 Bacteria 3417
167 Ga0207645_10098440 3300025907 Bacteria 1886
168 Ga0207705_10000102 3300025909 Bacteria 98105
169 Ga0207705_10221732 3300025909 Bacteria 1436
170 Ga0207705_10609852 3300025909 Bacteria 849
171 Ga0207654_10423291 3300025911 Unclassified 930
172 Ga0207695_10003385 3300025913 Bacteria 22535
173 Ga0207695_10038434 3300025913 Bacteria 5153
174 Ga0207695_10258565 3300025913 Bacteria 1639
175 Ga0207695_10335868 3300025913 Bacteria 1399
176 Ga0207695_10766724 3300025913 Bacteria 845
177 Ga0207695_11053212 3300025913 Unclassified 693
178 Ga0207671_10023110 3300025914 Bacteria 4690
179 Ga0207671_10068934 3300025914 Bacteria 2636
180 Ga0207671_10151591 3300025914 Bacteria 1791
181 Ga0207671_11186954 3300025914 Unclassified 597
182 Ga0207657_10013576 3300025919 Bacteria 7990
183 Ga0207650_10016441 3300025925 Bacteria 5171
184 Ga0207650_10302012 3300025925 Bacteria 1307
185 Ga0207659_10017102 3300025926 Bacteria 4732
186 Ga0207644_10024747 3300025931 Unclassified 4124
187 Ga0207706_10054695 3300025933 Bacteria 3522
188 Ga0207686_10705251 3300025934 Unclassified 802
189 Ga0207704_10055289 3300025938 Bacteria 2425
190 Ga0207691_10032362 3300025940 Bacteria 4876
191 Ga0207689_10112250 3300025942 Bacteria 2241
192 Ga0207661_10901148 3300025944 Bacteria 814
193 Ga0207667_10232154 3300025949 Bacteria 1889
194 Ga0207667_10293682 3300025949 Bacteria 1660
195 Ga0207667_10296908 3300025949 Bacteria 1650
196 Ga0207667_10772859 3300025949 Unclassified 959
197 Ga0207651_10007741 3300025960 Bacteria 5742
198 Ga0207712_10031298 3300025961 Bacteria 3582
199 Ga0207712_10158697 3300025961 Unclassified 1755
200 Ga0207668_10053004 3300025972 Bacteria 2809
201 Ga0207668_10664041 3300025972 Unclassified 913
202 Ga0207658_10016809 3300025986 Bacteria 5034
203 Ga0207658_11853753 3300025986 Bacteria 550
204 Ga0207658_12063239 3300025986 Bacteria 518
205 Ga0207703_10084585 3300026035 Bacteria 2653
206 Ga0207639_10020239 3300026041 Bacteria 4760
207 Ga0207639_10069263 3300026041 Bacteria 2752
208 Ga0207702_10000319 3300026078 Bacteria 55143
209 Ga0207702_10039488 3300026078 Bacteria 3955
210 Ga0207702_11980677 3300026078 Unclassified 573
211 Ga0207641_10911493 3300026088 Bacteria 873
212 Ga0207648_10172439 3300026089 Bacteria 1913
213 Ga0207648_10298464 3300026089 Bacteria 1444
214 Ga0207676_10071873 3300026095 Unclassified 2779
215 Ga0207676_10082541 3300026095 Bacteria 2615
216 Ga0207674_10559577 3300026116 Bacteria 1105
217 Ga0207675_100213085 3300026118 Bacteria 1859
218 Ga0207683_10095201 3300026121 Bacteria 2655
219 Ga0207698_10582961 3300026142 Bacteria 1100
220 Ga0207428_10086194 3300027907 Bacteria 2444
221 Ga0268266_10025443 3300028379 Bacteria 5035
222 Ga0268266_10063292 3300028379 Bacteria 3193
223 Ga0268264_10026232 3300028381 Bacteria 4759
224 Ga0268264_10081155 3300028381 Bacteria 2771
225 Ga0265327_10000561 3300031251 Bacteria 63538
226 Ga0265313_10129441 3300031595 Bacteria 1095
227 Ga0307405_10009295 3300031731 Bacteria 5032
228 Ga0307413_10314371 3300031824 Unclassified 1194
229 Ga0307410_10000563 3300031852 Bacteria 15221
230 Ga0307406_10127900 3300031901 Bacteria 1778
231 Ga0307407_10010738 3300031903 Bacteria 4329
232 Ga0307412_10108507 3300031911 Bacteria 1977
233 Ga0307409_100009916 3300031995 Bacteria 5882
234 Ga0307416_100012762 3300032002 Bacteria 5678
235 Ga0307414_10321088 3300032004 Bacteria 1318
236 Ga0307411_10017998 3300032005 Bacteria 4044
237 Ga0307415_100002957 3300032126 Bacteria 8535
238 Ga0307415_100172523 3300032126 Bacteria 1688
239 Ga0395900_0560400 3300037418 Bacteria 1086
240 Ga0436365_1734381 3300039437 Bacteria 11979
241 Ga0451804_0646051 3300041463 Bacteria 601
242 Ga0453683_0245328 3300044673 Bacteria 1141
243 Ga0466957_0007709 3300044842 Bacteria 6088
244 Ga0495650_0000014 3300046471 Bacteria 581606
245 Ga0495585_0000058 3300046492 Bacteria 112144
246 Ga0495606_0000528 3300046507 Bacteria 61795
247 Ga0495610_0001048 3300046512 Bacteria 25414
248 Ga0495628_0612471 3300046516 Unclassified 777
249 Ga0495630_1061431 3300046517 Bacteria 615
250 Ga0495637_0069840 3300046520 Bacteria 1420
251 Ga0495652_0034974 3300046529 Bacteria 4375
252 Ga0495621_0172145 3300046539 Bacteria 861
253 Ga0495622_0204157 3300046557 Bacteria 880
254 Ga0495633_0006348 3300046558 Bacteria 7031
255 Ga0495625_0000009 3300046660 Bacteria 404954
256 Ga0495661_0090376 3300046665 Bacteria 1743
257 Ga0495683_0081286 3300047323 Bacteria 1580
258 Ga0495679_047048 3300047446 Bacteria 1310
259 Ga0495673_0264098 3300047469 Bacteria 625
260 Ga0496109_0000069 3300048912 Bacteria 109077
261 Ga0496122_0000555 3300048925 Bacteria 76648
262 Ga0496123_0002095 3300048926 Bacteria 25654
263 Ga0496124_0346158 3300048927 Bacteria 1053
264 Ga0501033_0016432 3300049570 Bacteria 5606
265 Ga0501033_0937163 3300049570 Unclassified 581
266 Ga0501034_0857794 3300049571 Bacteria 798
267 Ga0501206_046750 3300049653 Unclassified 680
268 Ga0501242_010152 3300049674 Bacteria 1122
269 Ga0501257_156918 3300049686 Bacteria 631
270 Ga0501259_157242 3300049688 Bacteria 566
271 Ga0501225_0194865 3300049705 Unclassified 640
272 Ga0501245_100898 3300049708 Unclassified 585
273 Ga0501081_0701465 3300049743 Bacteria 760
274 Ga0501035_0091424 3300049822 Bacteria 2679
275 Ga0501045_0790450 3300049824 Bacteria 699
276 nmdc:mga0k408_7533_c1 3300050493 Bacteria 5815
277 nmdc:mga05p37_220814_c1 3300050507 Unclassified 2287
278 nmdc:mga09592_152634_c1 3300050508 Bacteria 1993
279 nmdc:mga06r32_111975_c1 3300050510 Unclassified 2686
280 nmdc:mga06r32_282859_c1 3300050510 Unclassified 1646
281 nmdc:mga08y16_216653_c1 3300050511 Bacteria 1982
282 nmdc:mga08y16_262695_c1 3300050511 Bacteria 1783
283 nmdc:mga08y16_649204_c1 3300050511 Bacteria 1059
284 nmdc:mga0n895_124989_c1 3300050512 Unclassified 2596
285 nmdc:mga0n895_22673_c1 3300050512 Bacteria 5888
286 nmdc:mga0a205_40375_c1 3300050515 Bacteria 4492
287 nmdc:mga0a205_849786_c1 3300050515 Unclassified 760
288 Ga0500594_0259808 3300053118 Bacteria 579
289 Ga0500642_0046848 3300053130 Bacteria 1892
290 Ga0500568_0030931 3300053139 Bacteria 2214
291 Ga0501084_0100853 3300054114 Bacteria 2424
292 2738756782 2738541283 Bacteria 7222293
293 2883068966 2883068021 Bacteria 6192739
294 2919191366 2919186247 Bacteria 6244071
295 2919695851 2919692658 Bacteria 5943958
296 2939669715 2939664404 Bacteria 6364494
297 Ga0105237_10000374
298 JGI24737J22298_10016155
299 JGI24735J21928_10000004
300 rootH1_10008281
301 rootL2_10057629
302 rootL2_10080696
303 rootH1_10033781
304 rootH1_10138725
305 Ga0055530_10002397
306 Ga0065712_10582188
307 Ga0070658_10000075
308 Ga0070658_10558588
309 Ga0070676_10086032
310 Ga0070683_100488037
311 Ga0070690_100974874
312 Ga0070670_100338540
313 Ga0070670_100394691
314 Ga0070677_10005515
315 Ga0070677_10735638
316 Ga0070666_10194563
317 Ga0070682_101232181
318 Ga0070689_100778315
319 Ga0070661_100020803
320 Ga0070669_101498380
321 Ga0070671_100241497
322 Ga0070673_102013837
323 Ga0070667_100019134
324 Ga0070667_100238187
325 Ga0070694_100712764
326 Ga0070708_101909259
327 Ga0070663_100153453
328 Ga0070678_100067904
329 Ga0068867_101503888
330 Ga0070685_10626301
331 Ga0070697_100176540
332 Ga0068853_100012203
333 Ga0068853_100144414
334 Ga0068853_100276328
335 Ga0068853_100616324
336 Ga0070672_100068708
337 Ga0070672_100138225
338 Ga0070695_100128516
339 Ga0070696_100546425
340 Ga0070693_100200138
341 Ga0070665_100035330
342 Ga0070665_100531943
343 Ga0068855_100016854
344 Ga0068855_100273565
345 Ga0068855_100317201
346 Ga0068855_100473222
347 Ga0070664_100298385
348 Ga0070664_101756343
349 Ga0068857_100474143
350 Ga0068854_100631177
351 Ga0068854_101650535
352 Ga0068856_100000292
353 Ga0068856_100044309
354 Ga0070702_101312765
355 Ga0068852_100128858
356 Ga0068852_101489717
357 Ga0068852_101687080
358 Ga0068864_100108298
359 Ga0068861_100109593
360 Ga0068861_101154079
361 Ga0068861_101181279
362 Ga0068851_10046354
363 Ga0068863_100051719
364 Ga0068863_101871546
365 Ga0068860_100011883
366 Ga0068860_100101465
367 Ga0068862_100014929
368 Ga0081455_10003766
369 Ga0081539_10000042
370 Ga0075368_10460074
371 Ga0075366_10001336
372 Ga0097621_100053980
373 Ga0097621_100374185
374 Ga0068871_100192222
375 Ga0068871_100476483
376 Ga0075428_100018025
377 Ga0075428_101347425
378 Ga0075430_100328003
379 Ga0075430_101329218
380 Ga0075431_100070061
381 Ga0075431_100289819
382 Ga0075431_101151427
383 Ga0075433_10112423
384 Ga0075433_10545845
385 Ga0075434_100034987
386 Ga0075434_100102187
387 Ga0075429_100336557
388 Ga0068865_100081440
389 Ga0075435_100060076
390 Ga0105240_10088970
391 Ga0105240_10139285
392 Ga0105240_10352096
393 Ga0105240_10700169
394 Ga0105240_10805364
395 Ga0105240_10992191
396 Ga0111539_10008388
397 Ga0111539_10818054
398 Ga0111539_11073924
399 Ga0114129_10305950
400 Ga0105243_10344006
401 Ga0105241_10053238
402 Ga0105241_10085351
403 Ga0105241_10181803
404 Ga0105241_10717876
405 Ga0105248_10787256
406 Ga0105237_10000552
407 Ga0105237_10001504
408 Ga0105237_10016184
409 Ga0105237_10639180
410 Ga0105237_11940346
411 Ga0105238_10429642
412 Ga0105249_10013386
413 Ga0105249_10235464
414 Ga0105239_10000166
415 Ga0105239_10001262
416 Ga0105239_10018887
417 Ga0105239_10027905
418 Ga0105239_10064232
419 Ga0105239_10818115
420 Ga0105239_11441803
421 Ga0157371_10102568
422 Ga0157371_10294467
423 Ga0157370_10000568
424 Ga0157370_10050424
425 Ga0157370_10109944
426 Ga0157370_10682727
427 Ga0157369_10100118
428 Ga0157369_10127696
429 Ga0157374_10317632
430 Ga0157378_10409206
431 Ga0157378_10574746
432 Ga0163162_10002147
433 Ga0163162_10517951
434 Ga0163162_10918936
435 Ga0163162_11885478
436 Ga0157372_10040387
437 Ga0157372_10106953
438 Ga0157372_10375297
439 Ga0157372_10903770
440 Ga0157375_10070622
441 Ga0157375_11781998
442 Ga0157375_12260219
443 Ga0163163_10538249
444 Ga0157380_10002949
445 Ga0157380_12561910
446 Ga0182008_10000732
447 Ga0157377_10072979
448 Ga0157379_10026333
449 Ga0157379_12182355
450 Ga0163161_10000233
451 Ga0163161_10006153
452 Ga0163161_11386878
453 Ga0213876_10010743
454 Ga0209455_1001480
455 Ga0209676_1000001
456 Ga0209050_1000016
457 Ga0207656_10355710
458 Ga0207682_10060099
459 Ga0207710_10086376
460 Ga0207680_10127812
461 Ga0207647_10015941
462 Ga0207645_10031418
463 Ga0207645_10098440
464 Ga0207705_10000102
465 Ga0207705_10221732
466 Ga0207705_10609852
467 Ga0207654_10423291
468 Ga0207695_10003385
469 Ga0207695_10038434
470 Ga0207695_10258565
471 Ga0207695_10335868
472 Ga0207695_10766724
473 Ga0207695_11053212
474 Ga0207671_10023110
475 Ga0207671_10068934
476 Ga0207671_10151591
477 Ga0207671_11186954
478 Ga0207657_10013576
479 Ga0207650_10016441
480 Ga0207650_10302012
481 Ga0207659_10017102
482 Ga0207644_10024747
483 Ga0207706_10054695
484 Ga0207686_10705251
485 Ga0207704_10055289
486 Ga0207691_10032362
487 Ga0207689_10112250
488 Ga0207661_10901148
489 Ga0207667_10232154
490 Ga0207667_10293682
491 Ga0207667_10296908
492 Ga0207667_10772859
493 Ga0207651_10007741
494 Ga0207712_10031298
495 Ga0207712_10158697
496 Ga0207668_10053004
497 Ga0207668_10664041
498 Ga0207658_10016809
499 Ga0207658_11853753
500 Ga0207658_12063239
501 Ga0207703_10084585
502 Ga0207639_10020239
503 Ga0207639_10069263
504 Ga0207702_10000319
505 Ga0207702_10039488
506 Ga0207702_11980677
507 Ga0207641_10911493
508 Ga0207648_10172439
509 Ga0207648_10298464
510 Ga0207676_10071873
511 Ga0207676_10082541
512 Ga0207674_10559577
513 Ga0207675_100213085
514 Ga0207683_10095201
515 Ga0207698_10582961
516 Ga0207428_10086194
517 Ga0268266_10025443
518 Ga0268266_10063292
519 Ga0268264_10026232
520 Ga0268264_10081155
521 Ga0265327_10000561
522 Ga0265313_10129441
523 Ga0307405_10009295
524 Ga0307413_10314371
525 Ga0307410_10000563
526 Ga0307406_10127900
527 Ga0307407_10010738
528 Ga0307412_10108507
529 Ga0307409_100009916
530 Ga0307416_100012762
531 Ga0307414_10321088
532 Ga0307411_10017998
533 Ga0307415_100002957
534 Ga0307415_100172523
535 Ga0395900_0560400
536 Ga0436365_1734381
537 Ga0451804_0646051
538 Ga0453683_0245328
539 Ga0466957_0007709
540 Ga0495650_0000014
541 Ga0495585_0000058
542 Ga0495606_0000528
543 Ga0495610_0001048
544 Ga0495628_0612471
545 Ga0495630_1061431
546 Ga0495637_0069840
547 Ga0495652_0034974
548 Ga0495621_0172145
549 Ga0495622_0204157
550 Ga0495633_0006348
551 Ga0495625_0000009
552 Ga0495661_0090376
553 Ga0495683_0081286
554 Ga0495679_047048
555 Ga0495673_0264098
556 Ga0496109_0000069
557 Ga0496122_0000555
558 Ga0496123_0002095
559 Ga0496124_0346158
560 Ga0501033_0016432
561 Ga0501033_0937163
562 Ga0501034_0857794
563 Ga0501206_046750
564 Ga0501242_010152
565 Ga0501257_156918
566 Ga0501259_157242
567 Ga0501225_0194865
568 Ga0501245_100898
569 Ga0501081_0701465
570 Ga0501035_0091424
571 Ga0501045_0790450
572 nmdc:mga0k408_7533_c1
573 nmdc:mga05p37_220814_c1
574 nmdc:mga09592_152634_c1
575 nmdc:mga06r32_111975_c1
576 nmdc:mga06r32_282859_c1
577 nmdc:mga08y16_216653_c1
578 nmdc:mga08y16_262695_c1
579 nmdc:mga08y16_649204_c1
580 nmdc:mga0n895_124989_c1
581 nmdc:mga0n895_22673_c1
582 nmdc:mga0a205_40375_c1
583 nmdc:mga0a205_849786_c1
584 Ga0500594_0259808
585 Ga0500642_0046848
586 Ga0500568_0030931
587 Ga0501084_0100853
588 2738756782
589 2883068966
590 2919191366
591 2919695851
592 2939669715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

40

81

0.97

PF12833

HTH_18

Helix-turn-helix domain

53

131

0.95

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

90

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9445 11 113
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9412 13 118
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9294 10 112
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9156 17 110
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.9115 12 113
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9727 63 116 1.10.10.60
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9637 12 68 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 62 112 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9607 12 112 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9587 10 113 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7C7E3P8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9947 12 113 GO:0003700
GO:0043565
AF-A0A4U0Z2J2-F1-model_v4 AraC family transcriptional regulator 0.9934 13 113 GO:0003700
GO:0043565
AF-A0A5C8A6U7-F1-model_v4 deleted 0.9913 12 111
AF-A0A1M3C2D2-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9896 13 113 GO:0003700
GO:0043565
AF-A0A4R1RQJ6-F1-model_v4 AraC-like DNA-binding protein 0.9872 11 113 GO:0003700
GO:0043565

Map