F393160
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 296 | 194 | 296 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_11038555|Ga0105248_110385552 |
| Length | 119 |
| Sequence | MRAFGARSYPRSRQLEPEGALMDTYVILRRDGWRSAADLEAAAARSTAEGERMPDDIRWIRSYVLAEPANGGLGTVCIYQASSPEAIRRHAAAAELPVDEIVQVADTVLVRPDPVPAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 125 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 126 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 127 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 186 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.31 |
| Metatranscriptomes | 1.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.69 |
| Nodule | 0 |
| Rhizoplane | 10.14 |
| Rhizosphere | 86.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0007409J51694_1159594 | 3300003575 | Unclassified | 517 |
| 2 | Ga0058860_12198514 | 3300004801 | Unclassified | 509 |
| 3 | Ga0070683_100075871 | 3300005329 | Bacteria | 3142 |
| 4 | Ga0070683_100516737 | 3300005329 | Bacteria | 1141 |
| 5 | Ga0070683_100543706 | 3300005329 | Bacteria | 1110 |
| 6 | Ga0070683_101552881 | 3300005329 | Unclassified | 636 |
| 7 | Ga0070690_100192802 | 3300005330 | Bacteria | 1414 |
| 8 | Ga0068869_100855287 | 3300005334 | Bacteria | 785 |
| 9 | Ga0070660_100985075 | 3300005339 | Bacteria | 712 |
| 10 | Ga0070689_102143174 | 3300005340 | Bacteria | 512 |
| 11 | Ga0070687_100500188 | 3300005343 | Bacteria | 818 |
| 12 | Ga0070661_100325455 | 3300005344 | Bacteria | 1201 |
| 13 | Ga0070671_100168331 | 3300005355 | Bacteria | 1853 |
| 14 | Ga0070671_101522733 | 3300005355 | Bacteria | 592 |
| 15 | Ga0070674_100100028 | 3300005356 | Bacteria | 2110 |
| 16 | Ga0070674_100639515 | 3300005356 | Unclassified | 903 |
| 17 | Ga0070674_102086636 | 3300005356 | Bacteria | 517 |
| 18 | Ga0070673_100117636 | 3300005364 | Bacteria | 2212 |
| 19 | Ga0070673_101066057 | 3300005364 | Bacteria | 754 |
| 20 | Ga0070659_100286094 | 3300005366 | Bacteria | 1372 |
| 21 | Ga0070713_100405709 | 3300005436 | Bacteria | 1273 |
| 22 | Ga0070710_10455584 | 3300005437 | Bacteria | 868 |
| 23 | Ga0070710_11149338 | 3300005437 | Bacteria | 572 |
| 24 | Ga0070711_100908474 | 3300005439 | Bacteria | 752 |
| 25 | Ga0070711_100998506 | 3300005439 | Bacteria | 718 |
| 26 | Ga0070705_100199954 | 3300005440 | Bacteria | 1369 |
| 27 | Ga0070708_101106452 | 3300005445 | Bacteria | 742 |
| 28 | Ga0070663_102043056 | 3300005455 | Bacteria | 516 |
| 29 | Ga0070678_101156505 | 3300005456 | Bacteria | 716 |
| 30 | Ga0070662_100226250 | 3300005457 | Bacteria | 1495 |
| 31 | Ga0068867_100386984 | 3300005459 | Unclassified | 1176 |
| 32 | Ga0070685_11240658 | 3300005466 | Bacteria | 568 |
| 33 | Ga0070685_11339707 | 3300005466 | Bacteria | 548 |
| 34 | Ga0070699_100471437 | 3300005518 | Bacteria | 1139 |
| 35 | Ga0070684_100040878 | 3300005535 | Bacteria | 3995 |
| 36 | Ga0070684_100194178 | 3300005535 | Bacteria | 1848 |
| 37 | Ga0070684_100374262 | 3300005535 | Bacteria | 1311 |
| 38 | Ga0070684_100908309 | 3300005535 | Bacteria | 825 |
| 39 | Ga0068853_100851190 | 3300005539 | Bacteria | 875 |
| 40 | Ga0068853_102226173 | 3300005539 | Unclassified | 531 |
| 41 | Ga0070686_100068172 | 3300005544 | Bacteria | 2320 |
| 42 | Ga0070693_100173809 | 3300005547 | Bacteria | 1382 |
| 43 | Ga0070693_101295867 | 3300005547 | Bacteria | 563 |
| 44 | Ga0070665_100321089 | 3300005548 | Bacteria | 1553 |
| 45 | Ga0068855_100257070 | 3300005563 | Bacteria | 1947 |
| 46 | Ga0068855_101219485 | 3300005563 | Unclassified | 782 |
| 47 | Ga0070664_101830960 | 3300005564 | Bacteria | 576 |
| 48 | Ga0068857_100735849 | 3300005577 | Bacteria | 939 |
| 49 | Ga0068854_100880074 | 3300005578 | Bacteria | 786 |
| 50 | Ga0070702_100204384 | 3300005615 | Bacteria | 1310 |
| 51 | Ga0070702_100216052 | 3300005615 | Bacteria | 1279 |
| 52 | Ga0068852_100465635 | 3300005616 | Bacteria | 1254 |
| 53 | Ga0068859_101858384 | 3300005617 | Bacteria | 665 |
| 54 | Ga0068866_10072263 | 3300005718 | Bacteria | 1827 |
| 55 | Ga0068866_10616470 | 3300005718 | Bacteria | 735 |
| 56 | Ga0068861_100889060 | 3300005719 | Bacteria | 843 |
| 57 | Ga0068851_11077071 | 3300005834 | Bacteria | 509 |
| 58 | Ga0068870_10291312 | 3300005840 | Bacteria | 1027 |
| 59 | Ga0068870_11390908 | 3300005840 | Bacteria | 514 |
| 60 | Ga0081455_10010429 | 3300005937 | Bacteria | 9433 |
| 61 | Ga0081455_10812319 | 3300005937 | Unclassified | 586 |
| 62 | Ga0070717_10590591 | 3300006028 | Bacteria | 1007 |
| 63 | Ga0075364_10042050 | 3300006051 | Bacteria | 2969 |
| 64 | Ga0075364_10156936 | 3300006051 | Bacteria | 1535 |
| 65 | Ga0075364_10560752 | 3300006051 | Bacteria | 781 |
| 66 | Ga0070716_100186237 | 3300006173 | Bacteria | 1368 |
| 67 | Ga0070716_101793662 | 3300006173 | Bacteria | 508 |
| 68 | Ga0097621_101173208 | 3300006237 | Bacteria | 723 |
| 69 | Ga0075433_10230350 | 3300006852 | Bacteria | 1645 |
| 70 | Ga0075433_10307715 | 3300006852 | Bacteria | 1403 |
| 71 | Ga0075433_11765786 | 3300006852 | Archaea | 532 |
| 72 | Ga0075434_100006734 | 3300006871 | Bacteria | 10559 |
| 73 | Ga0075434_100012672 | 3300006871 | Bacteria | 7996 |
| 74 | Ga0075434_100188270 | 3300006871 | Bacteria | 2084 |
| 75 | Ga0068865_100296597 | 3300006881 | Bacteria | 1292 |
| 76 | Ga0075436_100030388 | 3300006914 | Bacteria | 3718 |
| 77 | Ga0097620_101858277 | 3300006931 | Bacteria | 665 |
| 78 | Ga0075435_100006758 | 3300007076 | Bacteria | 8137 |
| 79 | Ga0075435_100085231 | 3300007076 | Bacteria | 2600 |
| 80 | Ga0075435_100678314 | 3300007076 | Bacteria | 895 |
| 81 | Ga0105245_10013977 | 3300009098 | Bacteria | 6992 |
| 82 | Ga0105245_10138680 | 3300009098 | Bacteria | 2288 |
| 83 | Ga0105245_10861820 | 3300009098 | Bacteria | 946 |
| 84 | Ga0105247_10118525 | 3300009101 | Bacteria | 1712 |
| 85 | Ga0114129_11272132 | 3300009147 | Bacteria | 913 |
| 86 | Ga0105243_10099366 | 3300009148 | Bacteria | 2412 |
| 87 | Ga0105243_12086036 | 3300009148 | Bacteria | 602 |
| 88 | Ga0105242_10136277 | 3300009176 | Bacteria | 2125 |
| 89 | Ga0105248_11038555 | 3300009177 | Bacteria | 926 |
| 90 | Ga0105248_12049504 | 3300009177 | Bacteria | 650 |
| 91 | Ga0105237_10392636 | 3300009545 | Bacteria | 1392 |
| 92 | Ga0105238_11049083 | 3300009551 | Bacteria | 837 |
| 93 | Ga0105238_12922549 | 3300009551 | Bacteria | 514 |
| 94 | Ga0105239_10911220 | 3300010375 | Bacteria | 1009 |
| 95 | Ga0105239_11546570 | 3300010375 | Bacteria | 767 |
| 96 | Ga0105246_10640570 | 3300011119 | Bacteria | 924 |
| 97 | Ga0105246_10900758 | 3300011119 | Bacteria | 793 |
| 98 | Ga0157329_1045224 | 3300012491 | Unclassified | 506 |
| 99 | Ga0157373_11088334 | 3300013100 | Bacteria | 599 |
| 100 | Ga0157370_11199762 | 3300013104 | Bacteria | 685 |
| 101 | Ga0157369_10013363 | 3300013105 | Bacteria | 9288 |
| 102 | Ga0157374_11216118 | 3300013296 | Bacteria | 775 |
| 103 | Ga0157378_12502858 | 3300013297 | Bacteria | 568 |
| 104 | Ga0163162_10399888 | 3300013306 | Bacteria | 1506 |
| 105 | Ga0163162_10603104 | 3300013306 | Bacteria | 1224 |
| 106 | Ga0163162_12392280 | 3300013306 | Bacteria | 607 |
| 107 | Ga0157372_10618259 | 3300013307 | Bacteria | 1262 |
| 108 | Ga0157372_10833289 | 3300013307 | Bacteria | 1071 |
| 109 | Ga0157372_12432313 | 3300013307 | Bacteria | 601 |
| 110 | Ga0157372_13436489 | 3300013307 | Bacteria | 504 |
| 111 | Ga0157375_10191986 | 3300013308 | Bacteria | 2197 |
| 112 | Ga0163163_10419072 | 3300014325 | Bacteria | 1398 |
| 113 | Ga0163163_10545202 | 3300014325 | Bacteria | 1222 |
| 114 | Ga0157377_10599229 | 3300014745 | Bacteria | 786 |
| 115 | Ga0157379_10092012 | 3300014968 | Bacteria | 2721 |
| 116 | Ga0157376_11352889 | 3300014969 | Bacteria | 743 |
| 117 | Ga0157376_11661620 | 3300014969 | Bacteria | 673 |
| 118 | Ga0206354_11272189 | 3300020081 | Bacteria | 1700 |
| 119 | Ga0206353_11122745 | 3300020082 | Bacteria | 530 |
| 120 | Ga0206353_11644368 | 3300020082 | Bacteria | 1785 |
| 121 | Ga0207692_10172966 | 3300025898 | Bacteria | 1253 |
| 122 | Ga0207692_10777476 | 3300025898 | Bacteria | 625 |
| 123 | Ga0207642_10133396 | 3300025899 | Bacteria | 1299 |
| 124 | Ga0207642_10403801 | 3300025899 | Bacteria | 818 |
| 125 | Ga0207688_10498703 | 3300025901 | Bacteria | 762 |
| 126 | Ga0207643_10342075 | 3300025908 | Bacteria | 938 |
| 127 | Ga0207654_10263000 | 3300025911 | Unclassified | 1161 |
| 128 | Ga0207663_11396182 | 3300025916 | Bacteria | 564 |
| 129 | Ga0207657_10822102 | 3300025919 | Bacteria | 718 |
| 130 | Ga0207657_11197360 | 3300025919 | Bacteria | 577 |
| 131 | Ga0207652_10738607 | 3300025921 | Bacteria | 877 |
| 132 | Ga0207646_10474038 | 3300025922 | Bacteria | 1129 |
| 133 | Ga0207694_10851310 | 3300025924 | Bacteria | 771 |
| 134 | Ga0207694_11214351 | 3300025924 | Bacteria | 638 |
| 135 | Ga0207687_10042574 | 3300025927 | Bacteria | 3125 |
| 136 | Ga0207700_11407095 | 3300025928 | Bacteria | 620 |
| 137 | Ga0207644_10127500 | 3300025931 | Bacteria | 1944 |
| 138 | Ga0207690_10865800 | 3300025932 | Bacteria | 748 |
| 139 | Ga0207706_10187823 | 3300025933 | Bacteria | 1814 |
| 140 | Ga0207709_10095879 | 3300025935 | Bacteria | 1950 |
| 141 | Ga0207709_11221814 | 3300025935 | Bacteria | 620 |
| 142 | Ga0207669_10816756 | 3300025937 | Bacteria | 774 |
| 143 | Ga0207665_10153339 | 3300025939 | Bacteria | 1652 |
| 144 | Ga0207665_10362718 | 3300025939 | Bacteria | 1096 |
| 145 | Ga0207711_10579350 | 3300025941 | Bacteria | 1047 |
| 146 | Ga0207689_10293261 | 3300025942 | Unclassified | 1347 |
| 147 | Ga0207689_10818655 | 3300025942 | Bacteria | 786 |
| 148 | Ga0207661_10080419 | 3300025944 | Bacteria | 2689 |
| 149 | Ga0207661_10147654 | 3300025944 | Bacteria | 2030 |
| 150 | Ga0207661_10380161 | 3300025944 | Bacteria | 1278 |
| 151 | Ga0207679_10088963 | 3300025945 | Bacteria | 2382 |
| 152 | Ga0207679_11132800 | 3300025945 | Bacteria | 718 |
| 153 | Ga0207667_10313320 | 3300025949 | Bacteria | 1603 |
| 154 | Ga0207712_10040164 | 3300025961 | Bacteria | 3209 |
| 155 | Ga0207640_10570735 | 3300025981 | Unclassified | 953 |
| 156 | Ga0207658_10997079 | 3300025986 | Bacteria | 764 |
| 157 | Ga0207703_11091190 | 3300026035 | Bacteria | 767 |
| 158 | Ga0207703_11223307 | 3300026035 | Bacteria | 722 |
| 159 | Ga0207708_10270020 | 3300026075 | Bacteria | 1375 |
| 160 | Ga0207702_10452215 | 3300026078 | Bacteria | 1246 |
| 161 | Ga0207674_10040064 | 3300026116 | Bacteria | 4855 |
| 162 | Ga0207674_10049306 | 3300026116 | Bacteria | 4307 |
| 163 | Ga0207675_100308415 | 3300026118 | Bacteria | 1543 |
| 164 | Ga0207683_10962568 | 3300026121 | Bacteria | 793 |
| 165 | Ga0207698_10371610 | 3300026142 | Bacteria | 1357 |
| 166 | Ga0207698_11411232 | 3300026142 | Bacteria | 711 |
| 167 | Ga0268266_10177577 | 3300028379 | Bacteria | 1937 |
| 168 | Ga0265319_1247090 | 3300028563 | Unclassified | 544 |
| 169 | Ga0265318_10138196 | 3300028577 | Unclassified | 895 |
| 170 | Ga0307407_11470902 | 3300031903 | Unclassified | 538 |
| 171 | Ga0307409_100060829 | 3300031995 | Bacteria | 2948 |
| 172 | Ga0307411_11437992 | 3300032005 | Unclassified | 632 |
| 173 | Ga0373952_0017667 | 3300035092 | Bacteria | 1466 |
| 174 | Ga0373933_0906391 | 3300035724 | Unclassified | 580 |
| 175 | Ga0395899_0008067 | 3300037312 | Bacteria | 8108 |
| 176 | Ga0395898_1131715 | 3300037466 | Bacteria | 715 |
| 177 | Ga0395898_1555886 | 3300037466 | Unclassified | 586 |
| 178 | Ga0395898_1778814 | 3300037466 | Archaea | 538 |
| 179 | Ga0395901_0505273 | 3300038443 | Bacteria | 1230 |
| 180 | Ga0395901_0651805 | 3300038443 | Bacteria | 1056 |
| 181 | Ga0436365_1724499 | 3300039437 | Bacteria | 597 |
| 182 | Ga0436360_0064738 | 3300039438 | Unclassified | 559 |
| 183 | Ga0436363_0616967 | 3300039450 | Bacteria | 722 |
| 184 | Ga0436362_1099967 | 3300039453 | Bacteria | 3389 |
| 185 | Ga0466963_0006174 | 3300044694 | Bacteria | 7072 |
| 186 | Ga0466963_0017150 | 3300044694 | Bacteria | 4510 |
| 187 | Ga0466971_0155291 | 3300044719 | Bacteria | 1070 |
| 188 | Ga0466971_0277006 | 3300044719 | Bacteria | 802 |
| 189 | Ga0466960_0016443 | 3300044901 | Bacteria | 3210 |
| 190 | Ga0466958_0028430 | 3300045836 | Bacteria | 3315 |
| 191 | Ga0466958_0504284 | 3300045836 | Bacteria | 785 |
| 192 | Ga0466967_0004397 | 3300045976 | Bacteria | 9492 |
| 193 | Ga0466967_0005692 | 3300045976 | Bacteria | 8688 |
| 194 | Ga0466967_0061705 | 3300045976 | Bacteria | 3326 |
| 195 | Ga0495592_0179981 | 3300046454 | Bacteria | 1441 |
| 196 | Ga0495651_0278602 | 3300046462 | Unclassified | 1131 |
| 197 | Ga0495608_0616449 | 3300046511 | Unclassified | 650 |
| 198 | Ga0495628_0413326 | 3300046516 | Unclassified | 984 |
| 199 | Ga0495634_0000840 | 3300046642 | Bacteria | 29619 |
| 200 | Ga0495657_0033880 | 3300046675 | Unclassified | 3552 |
| 201 | Ga0495599_0243179 | 3300046678 | Bacteria | 1097 |
| 202 | Ga0495658_0357733 | 3300046683 | Unclassified | 928 |
| 203 | Ga0495674_0950907 | 3300047319 | Unclassified | 661 |
| 204 | Ga0496100_0050087 | 3300048903 | Bacteria | 2704 |
| 205 | Ga0496101_0035060 | 3300048904 | Bacteria | 3548 |
| 206 | Ga0496102_0001033 | 3300048905 | Bacteria | 25892 |
| 207 | Ga0496102_0025176 | 3300048905 | Bacteria | 5294 |
| 208 | Ga0496102_0382533 | 3300048905 | Bacteria | 1324 |
| 209 | Ga0496102_1012649 | 3300048905 | Bacteria | 751 |
| 210 | Ga0496103_0048155 | 3300048906 | Bacteria | 2634 |
| 211 | Ga0496104_0058266 | 3300048907 | Bacteria | 3656 |
| 212 | Ga0496104_0654372 | 3300048907 | Unclassified | 960 |
| 213 | Ga0496104_0889260 | 3300048907 | Bacteria | 796 |
| 214 | Ga0496105_0244951 | 3300048908 | Unclassified | 1454 |
| 215 | Ga0496105_0266701 | 3300048908 | Bacteria | 1384 |
| 216 | Ga0496106_0000412 | 3300048909 | Bacteria | 30346 |
| 217 | Ga0496106_0041520 | 3300048909 | Bacteria | 3447 |
| 218 | Ga0496107_0008993 | 3300048910 | Bacteria | 6923 |
| 219 | Ga0496107_0041651 | 3300048910 | Bacteria | 3298 |
| 220 | Ga0496108_1496636 | 3300048911 | Bacteria | 562 |
| 221 | Ga0496109_0095771 | 3300048912 | Bacteria | 2749 |
| 222 | Ga0496109_1417050 | 3300048912 | Bacteria | 630 |
| 223 | Ga0496109_1581593 | 3300048912 | Bacteria | 590 |
| 224 | Ga0496110_0590902 | 3300048913 | Bacteria | 1008 |
| 225 | Ga0496110_1541540 | 3300048913 | Bacteria | 574 |
| 226 | Ga0496112_0004963 | 3300048915 | Bacteria | 11401 |
| 227 | Ga0496112_1694570 | 3300048915 | Bacteria | 545 |
| 228 | Ga0496113_0781862 | 3300048916 | Bacteria | 759 |
| 229 | Ga0496114_0002993 | 3300048917 | Bacteria | 12954 |
| 230 | Ga0496114_0178790 | 3300048917 | Bacteria | 1852 |
| 231 | Ga0496114_0335769 | 3300048917 | Bacteria | 1336 |
| 232 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 233 | Ga0496115_0235190 | 3300048918 | Unclassified | 1510 |
| 234 | Ga0496121_0194389 | 3300048924 | Bacteria | 1452 |
| 235 | Ga0501031_0086785 | 3300049568 | Bacteria | 2040 |
| 236 | Ga0501032_0253369 | 3300049569 | Bacteria | 1142 |
| 237 | Ga0501034_1286570 | 3300049571 | Bacteria | 608 |
| 238 | Ga0501036_0005850 | 3300049572 | Bacteria | 9959 |
| 239 | Ga0501036_0147656 | 3300049572 | Bacteria | 1984 |
| 240 | Ga0501037_0154935 | 3300049573 | Bacteria | 1636 |
| 241 | Ga0501038_0069587 | 3300049574 | Bacteria | 2989 |
| 242 | Ga0501038_0614638 | 3300049574 | Bacteria | 821 |
| 243 | Ga0501039_0228918 | 3300049575 | Bacteria | 1461 |
| 244 | Ga0501040_0005733 | 3300049576 | Bacteria | 8032 |
| 245 | Ga0501041_0019558 | 3300049577 | Bacteria | 4044 |
| 246 | Ga0501042_0025280 | 3300049578 | Bacteria | 4170 |
| 247 | Ga0501042_0032340 | 3300049578 | Bacteria | 3704 |
| 248 | Ga0501043_0442937 | 3300049579 | Bacteria | 977 |
| 249 | Ga0501046_0048345 | 3300049580 | Bacteria | 3369 |
| 250 | Ga0501048_0001135 | 3300049582 | Bacteria | 19978 |
| 251 | Ga0501048_0359782 | 3300049582 | Bacteria | 1038 |
| 252 | Ga0501067_0016792 | 3300049583 | Bacteria | 4045 |
| 253 | Ga0501067_0026985 | 3300049583 | Bacteria | 3180 |
| 254 | Ga0501069_0007146 | 3300049585 | Bacteria | 5852 |
| 255 | Ga0501069_0266949 | 3300049585 | Bacteria | 1000 |
| 256 | Ga0501069_0655569 | 3300049585 | Unclassified | 632 |
| 257 | Ga0501069_0706363 | 3300049585 | Bacteria | 608 |
| 258 | Ga0501070_0285834 | 3300049586 | Bacteria | 1345 |
| 259 | Ga0501071_0001408 | 3300049587 | Bacteria | 13820 |
| 260 | Ga0501072_0108810 | 3300049588 | Bacteria | 2205 |
| 261 | Ga0501072_0254266 | 3300049588 | Bacteria | 1399 |
| 262 | Ga0501073_0130903 | 3300049589 | Bacteria | 1739 |
| 263 | Ga0501074_0027875 | 3300049590 | Bacteria | 4094 |
| 264 | Ga0501074_0595532 | 3300049590 | Bacteria | 782 |
| 265 | Ga0501075_0005620 | 3300049591 | Bacteria | 8575 |
| 266 | Ga0501075_0189256 | 3300049591 | Bacteria | 1570 |
| 267 | Ga0501076_0000793 | 3300049592 | Bacteria | 20434 |
| 268 | Ga0501077_0035110 | 3300049593 | Bacteria | 3192 |
| 269 | Ga0501079_0106727 | 3300049741 | Bacteria | 2173 |
| 270 | Ga0501080_0025529 | 3300049742 | Bacteria | 5485 |
| 271 | Ga0501081_0001673 | 3300049743 | Bacteria | 13715 |
| 272 | Ga0501083_0135132 | 3300049744 | Bacteria | 1616 |
| 273 | Ga0501035_0017297 | 3300049822 | Bacteria | 6648 |
| 274 | Ga0501044_0602073 | 3300049823 | Bacteria | 992 |
| 275 | Ga0501045_0001734 | 3300049824 | Bacteria | 14688 |
| 276 | nmdc:mga00v17_255235_c1 | 3300050491 | Bacteria | 1137 |
| 277 | nmdc:mga00v17_257770_c1 | 3300050491 | Bacteria | 1131 |
| 278 | nmdc:mga0n895_370369_c1 | 3300050512 | Bacteria | 1450 |
| 279 | nmdc:mga0n895_6837_c1 | 3300050512 | Bacteria | 9741 |
| 280 | nmdc:mga0rr50_1064944_c1 | 3300050513 | Bacteria | 688 |
| 281 | nmdc:mga0rr50_1428965_c1 | 3300050513 | Bacteria | 585 |
| 282 | nmdc:mga0rr50_1448055_c1 | 3300050513 | Bacteria | 581 |
| 283 | nmdc:mga0rr50_8401_c1 | 3300050513 | Bacteria | 6426 |
| 284 | nmdc:mga08x19_3341_c1 | 3300050514 | Bacteria | 9600 |
| 285 | nmdc:mga08x19_898363_c1 | 3300050514 | Bacteria | 629 |
| 286 | nmdc:mga0a205_357822_c1 | 3300050515 | Bacteria | 1326 |
| 287 | Ga0495601_0563897 | 3300053077 | Bacteria | 732 |
| 288 | Ga0495595_0077486 | 3300053084 | Unclassified | 1579 |
| 289 | Ga0495595_0568845 | 3300053084 | Bacteria | 579 |
| 290 | Ga0501084_0581938 | 3300054114 | Bacteria | 946 |
| 291 | Ga0501082_0002809 | 3300060353 | Bacteria | 15201 |
| 292 | Ga0501082_0158550 | 3300060353 | Bacteria | 1966 |
| 293 | Ga0530510_0012679 | 3300061734 | Bacteria | 5926 |
| 294 | Ga0530510_0357500 | 3300061734 | Bacteria | 1097 |
| 295 | Ga0530510_0528164 | 3300061734 | Bacteria | 895 |
| 296 | Ga0530510_0534051 | 3300061734 | Bacteria | 890 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005535 | Ga0070684_100374262 | Ga0070684_1003742623 | 93 |
| 2 | 3300010375 | Ga0105239_10911220 | Ga0105239_109112201 | 93 |
| 3 | 3300046642 | Ga0495634_0000840 | Ga0495634_0000840_6170_6454 | 93 |
| 4 | 3300048915 | Ga0496112_0004963 | Ga0496112_0004963_3939_4226 | 93 |
| 5 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_235880_236182 | 93 |
| 6 | 3300049590 | Ga0501074_0595532 | Ga0501074_0595532_462_743 | 93 |
| 7 | 3300053077 | Ga0495601_0563897 | Ga0495601_0563897_214_498 | 93 |
| 8 | 3300053084 | Ga0495595_0568845 | Ga0495595_0568845_257_547 | 95 |
| 9 | 3300054114 | Ga0501084_0581938 | Ga0501084_0581938_479_769 | 95 |
| 10 | 3300005518 | Ga0070699_100471437 | Ga0070699_1004714372 | 96 |
| 11 | 3300005840 | Ga0068870_10291312 | Ga0068870_102913122 | 96 |
| 12 | 3300013306 | Ga0163162_12392280 | Ga0163162_123922802 | 96 |
| 13 | 3300038443 | Ga0395901_0505273 | Ga0395901_0505273_914_1207 | 96 |
| 14 | 3300039450 | Ga0436363_0616967 | Ga0436363_0616967_343_636 | 96 |
| 15 | 3300048905 | Ga0496102_0025176 | Ga0496102_0025176_1697_2032 | 96 |
| 16 | 3300048924 | Ga0496121_0194389 | Ga0496121_0194389_446_781 | 96 |
| 17 | 3300049568 | Ga0501031_0086785 | Ga0501031_0086785_545_835 | 96 |
| 18 | 3300049569 | Ga0501032_0253369 | Ga0501032_0253369_337_627 | 96 |
| 19 | 3300049572 | Ga0501036_0005850 | Ga0501036_0005850_8403_8693 | 96 |
| 20 | 3300049573 | Ga0501037_0154935 | Ga0501037_0154935_52_342 | 96 |
| 21 | 3300049574 | Ga0501038_0069587 | Ga0501038_0069587_837_1127 | 96 |
| 22 | 3300049575 | Ga0501039_0228918 | Ga0501039_0228918_81_371 | 96 |
| 23 | 3300049576 | Ga0501040_0005733 | Ga0501040_0005733_350_640 | 96 |
| 24 | 3300049577 | Ga0501041_0019558 | Ga0501041_0019558_1705_1995 | 96 |
| 25 | 3300049578 | Ga0501042_0032340 | Ga0501042_0032340_606_896 | 96 |
| 26 | 3300049579 | Ga0501043_0442937 | Ga0501043_0442937_498_788 | 96 |
| 27 | 3300049580 | Ga0501046_0048345 | Ga0501046_0048345_1887_2177 | 96 |
| 28 | 3300049582 | Ga0501048_0001135 | Ga0501048_0001135_10661_10951 | 96 |
| 29 | 3300049585 | Ga0501069_0266949 | Ga0501069_0266949_31_321 | 96 |
| 30 | 3300049587 | Ga0501071_0001408 | Ga0501071_0001408_8166_8456 | 96 |
| 31 | 3300049588 | Ga0501072_0108810 | Ga0501072_0108810_672_962 | 96 |
| 32 | 3300049589 | Ga0501073_0130903 | Ga0501073_0130903_599_889 | 96 |
| 33 | 3300049590 | Ga0501074_0027875 | Ga0501074_0027875_1509_1799 | 96 |
| 34 | 3300049591 | Ga0501075_0005620 | Ga0501075_0005620_5497_5787 | 96 |
| 35 | 3300049592 | Ga0501076_0000793 | Ga0501076_0000793_5554_5844 | 96 |
| 36 | 3300049593 | Ga0501077_0035110 | Ga0501077_0035110_2190_2480 | 96 |
| 37 | 3300049741 | Ga0501079_0106727 | Ga0501079_0106727_920_1210 | 96 |
| 38 | 3300049742 | Ga0501080_0025529 | Ga0501080_0025529_2736_3026 | 96 |
| 39 | 3300049743 | Ga0501081_0001673 | Ga0501081_0001673_5671_5961 | 96 |
| 40 | 3300049744 | Ga0501083_0135132 | Ga0501083_0135132_95_385 | 96 |
| 41 | 3300049822 | Ga0501035_0017297 | Ga0501035_0017297_6042_6332 | 96 |
| 42 | 3300049823 | Ga0501044_0602073 | Ga0501044_0602073_99_389 | 96 |
| 43 | 3300049824 | Ga0501045_0001734 | Ga0501045_0001734_12094_12384 | 96 |
| 44 | 3300060353 | Ga0501082_0002809 | Ga0501082_0002809_9118_9408 | 96 |
| 45 | 3300061734 | Ga0530510_0012679 | Ga0530510_0012679_754_1044 | 96 |
| 46 | 3300003575 | Ga0007409J51694_1159594 | Ga0007409J51694_11595941 | 97 |
| 47 | 3300004801 | Ga0058860_12198514 | Ga0058860_121985142 | 97 |
| 48 | 3300005329 | Ga0070683_100075871 | Ga0070683_1000758712 | 97 |
| 49 | 3300005329 | Ga0070683_100516737 | Ga0070683_1005167372 | 97 |
| 50 | 3300005329 | Ga0070683_100543706 | Ga0070683_1005437062 | 97 |
| 51 | 3300005329 | Ga0070683_101552881 | Ga0070683_1015528811 | 97 |
| 52 | 3300005330 | Ga0070690_100192802 | Ga0070690_1001928021 | 97 |
| 53 | 3300005334 | Ga0068869_100855287 | Ga0068869_1008552872 | 97 |
| 54 | 3300005339 | Ga0070660_100985075 | Ga0070660_1009850751 | 97 |
| 55 | 3300005340 | Ga0070689_102143174 | Ga0070689_1021431741 | 97 |
| 56 | 3300005343 | Ga0070687_100500188 | Ga0070687_1005001881 | 97 |
| 57 | 3300005344 | Ga0070661_100325455 | Ga0070661_1003254551 | 97 |
| 58 | 3300005355 | Ga0070671_100168331 | Ga0070671_1001683312 | 97 |
| 59 | 3300005355 | Ga0070671_101522733 | Ga0070671_1015227331 | 97 |
| 60 | 3300005356 | Ga0070674_100100028 | Ga0070674_1001000282 | 97 |
| 61 | 3300005356 | Ga0070674_100639515 | Ga0070674_1006395152 | 97 |
| 62 | 3300005356 | Ga0070674_102086636 | Ga0070674_1020866362 | 97 |
| 63 | 3300005364 | Ga0070673_100117636 | Ga0070673_1001176362 | 97 |
| 64 | 3300005364 | Ga0070673_101066057 | Ga0070673_1010660572 | 97 |
| 65 | 3300005366 | Ga0070659_100286094 | Ga0070659_1002860942 | 97 |
| 66 | 3300005436 | Ga0070713_100405709 | Ga0070713_1004057092 | 97 |
| 67 | 3300005437 | Ga0070710_10455584 | Ga0070710_104555842 | 97 |
| 68 | 3300005437 | Ga0070710_11149338 | Ga0070710_111493381 | 97 |
| 69 | 3300005439 | Ga0070711_100908474 | Ga0070711_1009084741 | 97 |
| 70 | 3300005439 | Ga0070711_100998506 | Ga0070711_1009985062 | 97 |
| 71 | 3300005440 | Ga0070705_100199954 | Ga0070705_1001999541 | 97 |
| 72 | 3300005445 | Ga0070708_101106452 | Ga0070708_1011064522 | 97 |
| 73 | 3300005455 | Ga0070663_102043056 | Ga0070663_1020430561 | 97 |
| 74 | 3300005456 | Ga0070678_101156505 | Ga0070678_1011565052 | 97 |
| 75 | 3300005457 | Ga0070662_100226250 | Ga0070662_1002262503 | 97 |
| 76 | 3300005459 | Ga0068867_100386984 | Ga0068867_1003869842 | 97 |
| 77 | 3300005466 | Ga0070685_11240658 | Ga0070685_112406581 | 97 |
| 78 | 3300005466 | Ga0070685_11339707 | Ga0070685_113397072 | 97 |
| 79 | 3300005535 | Ga0070684_100040878 | Ga0070684_1000408783 | 97 |
| 80 | 3300005535 | Ga0070684_100194178 | Ga0070684_1001941783 | 97 |
| 81 | 3300005535 | Ga0070684_100908309 | Ga0070684_1009083092 | 97 |
| 82 | 3300005539 | Ga0068853_100851190 | Ga0068853_1008511902 | 97 |
| 83 | 3300005539 | Ga0068853_102226173 | Ga0068853_1022261731 | 97 |
| 84 | 3300005544 | Ga0070686_100068172 | Ga0070686_1000681722 | 97 |
| 85 | 3300005547 | Ga0070693_100173809 | Ga0070693_1001738091 | 97 |
| 86 | 3300005547 | Ga0070693_101295867 | Ga0070693_1012958671 | 97 |
| 87 | 3300005548 | Ga0070665_100321089 | Ga0070665_1003210893 | 97 |
| 88 | 3300005563 | Ga0068855_100257070 | Ga0068855_1002570703 | 97 |
| 89 | 3300005563 | Ga0068855_101219485 | Ga0068855_1012194852 | 97 |
| 90 | 3300005564 | Ga0070664_101830960 | Ga0070664_1018309601 | 97 |
| 91 | 3300005577 | Ga0068857_100735849 | Ga0068857_1007358493 | 97 |
| 92 | 3300005578 | Ga0068854_100880074 | Ga0068854_1008800742 | 97 |
| 93 | 3300005615 | Ga0070702_100204384 | Ga0070702_1002043842 | 97 |
| 94 | 3300005615 | Ga0070702_100216052 | Ga0070702_1002160522 | 97 |
| 95 | 3300005616 | Ga0068852_100465635 | Ga0068852_1004656353 | 97 |
| 96 | 3300005617 | Ga0068859_101858384 | Ga0068859_1018583842 | 97 |
| 97 | 3300005718 | Ga0068866_10072263 | Ga0068866_100722633 | 97 |
| 98 | 3300005718 | Ga0068866_10616470 | Ga0068866_106164702 | 97 |
| 99 | 3300005719 | Ga0068861_100889060 | Ga0068861_1008890602 | 97 |
| 100 | 3300005834 | Ga0068851_11077071 | Ga0068851_110770712 | 97 |
| 101 | 3300005840 | Ga0068870_11390908 | Ga0068870_113909081 | 97 |
| 102 | 3300005937 | Ga0081455_10010429 | Ga0081455_100104298 | 97 |
| 103 | 3300005937 | Ga0081455_10812319 | Ga0081455_108123191 | 97 |
| 104 | 3300006028 | Ga0070717_10590591 | Ga0070717_105905912 | 97 |
| 105 | 3300006051 | Ga0075364_10042050 | Ga0075364_100420503 | 97 |
| 106 | 3300006051 | Ga0075364_10156936 | Ga0075364_101569362 | 97 |
| 107 | 3300006051 | Ga0075364_10560752 | Ga0075364_105607522 | 97 |
| 108 | 3300006173 | Ga0070716_100186237 | Ga0070716_1001862372 | 97 |
| 109 | 3300006173 | Ga0070716_101793662 | Ga0070716_1017936621 | 97 |
| 110 | 3300006237 | Ga0097621_101173208 | Ga0097621_1011732082 | 97 |
| 111 | 3300006852 | Ga0075433_10230350 | Ga0075433_102303502 | 97 |
| 112 | 3300006852 | Ga0075433_10307715 | Ga0075433_103077152 | 97 |
| 113 | 3300006852 | Ga0075433_11765786 | Ga0075433_117657861 | 97 |
| 114 | 3300006871 | Ga0075434_100006734 | Ga0075434_1000067345 | 97 |
| 115 | 3300006871 | Ga0075434_100012672 | Ga0075434_1000126725 | 97 |
| 116 | 3300006871 | Ga0075434_100188270 | Ga0075434_1001882702 | 97 |
| 117 | 3300006881 | Ga0068865_100296597 | Ga0068865_1002965971 | 97 |
| 118 | 3300006914 | Ga0075436_100030388 | Ga0075436_1000303884 | 97 |
| 119 | 3300006931 | Ga0097620_101858277 | Ga0097620_1018582771 | 97 |
| 120 | 3300007076 | Ga0075435_100006758 | Ga0075435_1000067586 | 97 |
| 121 | 3300007076 | Ga0075435_100085231 | Ga0075435_1000852313 | 97 |
| 122 | 3300007076 | Ga0075435_100678314 | Ga0075435_1006783141 | 97 |
| 123 | 3300009098 | Ga0105245_10013977 | Ga0105245_100139774 | 97 |
| 124 | 3300009098 | Ga0105245_10138680 | Ga0105245_101386802 | 97 |
| 125 | 3300009098 | Ga0105245_10861820 | Ga0105245_108618201 | 97 |
| 126 | 3300009101 | Ga0105247_10118525 | Ga0105247_101185253 | 97 |
| 127 | 3300009147 | Ga0114129_11272132 | Ga0114129_112721322 | 97 |
| 128 | 3300009148 | Ga0105243_10099366 | Ga0105243_100993664 | 97 |
| 129 | 3300009148 | Ga0105243_12086036 | Ga0105243_120860362 | 97 |
| 130 | 3300009176 | Ga0105242_10136277 | Ga0105242_101362772 | 97 |
| 131 | 3300009177 | Ga0105248_11038555 | Ga0105248_110385552 | 97 |
| 132 | 3300009177 | Ga0105248_12049504 | Ga0105248_120495041 | 97 |
| 133 | 3300009545 | Ga0105237_10392636 | Ga0105237_103926363 | 97 |
| 134 | 3300009551 | Ga0105238_11049083 | Ga0105238_110490832 | 97 |
| 135 | 3300009551 | Ga0105238_12922549 | Ga0105238_129225491 | 97 |
| 136 | 3300010375 | Ga0105239_11546570 | Ga0105239_115465702 | 97 |
| 137 | 3300011119 | Ga0105246_10640570 | Ga0105246_106405702 | 97 |
| 138 | 3300011119 | Ga0105246_10900758 | Ga0105246_109007582 | 97 |
| 139 | 3300012491 | Ga0157329_1045224 | Ga0157329_10452241 | 97 |
| 140 | 3300013100 | Ga0157373_11088334 | Ga0157373_110883342 | 97 |
| 141 | 3300013104 | Ga0157370_11199762 | Ga0157370_111997622 | 97 |
| 142 | 3300013105 | Ga0157369_10013363 | Ga0157369_100133635 | 97 |
| 143 | 3300013296 | Ga0157374_11216118 | Ga0157374_112161182 | 97 |
| 144 | 3300013297 | Ga0157378_12502858 | Ga0157378_125028582 | 97 |
| 145 | 3300013306 | Ga0163162_10399888 | Ga0163162_103998883 | 97 |
| 146 | 3300013306 | Ga0163162_10603104 | Ga0163162_106031042 | 97 |
| 147 | 3300013307 | Ga0157372_10618259 | Ga0157372_106182592 | 97 |
| 148 | 3300013307 | Ga0157372_10833289 | Ga0157372_108332892 | 97 |
| 149 | 3300013307 | Ga0157372_12432313 | Ga0157372_124323132 | 97 |
| 150 | 3300013307 | Ga0157372_13436489 | Ga0157372_134364892 | 97 |
| 151 | 3300013308 | Ga0157375_10191986 | Ga0157375_101919861 | 97 |
| 152 | 3300014325 | Ga0163163_10419072 | Ga0163163_104190722 | 97 |
| 153 | 3300014325 | Ga0163163_10545202 | Ga0163163_105452022 | 97 |
| 154 | 3300014745 | Ga0157377_10599229 | Ga0157377_105992291 | 97 |
| 155 | 3300014968 | Ga0157379_10092012 | Ga0157379_100920122 | 97 |
| 156 | 3300014969 | Ga0157376_11352889 | Ga0157376_113528891 | 97 |
| 157 | 3300014969 | Ga0157376_11661620 | Ga0157376_116616202 | 97 |
| 158 | 3300020081 | Ga0206354_11272189 | Ga0206354_112721892 | 97 |
| 159 | 3300020082 | Ga0206353_11122745 | Ga0206353_111227452 | 97 |
| 160 | 3300020082 | Ga0206353_11644368 | Ga0206353_116443682 | 97 |
| 161 | 3300025898 | Ga0207692_10172966 | Ga0207692_101729662 | 97 |
| 162 | 3300025898 | Ga0207692_10777476 | Ga0207692_107774761 | 97 |
| 163 | 3300025899 | Ga0207642_10133396 | Ga0207642_101333962 | 97 |
| 164 | 3300025899 | Ga0207642_10403801 | Ga0207642_104038012 | 97 |
| 165 | 3300025901 | Ga0207688_10498703 | Ga0207688_104987031 | 97 |
| 166 | 3300025908 | Ga0207643_10342075 | Ga0207643_103420752 | 97 |
| 167 | 3300025911 | Ga0207654_10263000 | Ga0207654_102630002 | 97 |
| 168 | 3300025916 | Ga0207663_11396182 | Ga0207663_113961822 | 97 |
| 169 | 3300025919 | Ga0207657_10822102 | Ga0207657_108221022 | 97 |
| 170 | 3300025919 | Ga0207657_11197360 | Ga0207657_111973601 | 97 |
| 171 | 3300025921 | Ga0207652_10738607 | Ga0207652_107386072 | 97 |
| 172 | 3300025922 | Ga0207646_10474038 | Ga0207646_104740382 | 97 |
| 173 | 3300025924 | Ga0207694_10851310 | Ga0207694_108513102 | 97 |
| 174 | 3300025924 | Ga0207694_11214351 | Ga0207694_112143512 | 97 |
| 175 | 3300025927 | Ga0207687_10042574 | Ga0207687_100425744 | 97 |
| 176 | 3300025928 | Ga0207700_11407095 | Ga0207700_114070952 | 97 |
| 177 | 3300025931 | Ga0207644_10127500 | Ga0207644_101275002 | 97 |
| 178 | 3300025932 | Ga0207690_10865800 | Ga0207690_108658001 | 97 |
| 179 | 3300025933 | Ga0207706_10187823 | Ga0207706_101878233 | 97 |
| 180 | 3300025935 | Ga0207709_10095879 | Ga0207709_100958791 | 97 |
| 181 | 3300025935 | Ga0207709_11221814 | Ga0207709_112218141 | 97 |
| 182 | 3300025937 | Ga0207669_10816756 | Ga0207669_108167561 | 97 |
| 183 | 3300025939 | Ga0207665_10153339 | Ga0207665_101533392 | 97 |
| 184 | 3300025939 | Ga0207665_10362718 | Ga0207665_103627182 | 97 |
| 185 | 3300025941 | Ga0207711_10579350 | Ga0207711_105793502 | 97 |
| 186 | 3300025942 | Ga0207689_10293261 | Ga0207689_102932612 | 97 |
| 187 | 3300025942 | Ga0207689_10818655 | Ga0207689_108186552 | 97 |
| 188 | 3300025944 | Ga0207661_10080419 | Ga0207661_100804194 | 97 |
| 189 | 3300025944 | Ga0207661_10147654 | Ga0207661_101476543 | 97 |
| 190 | 3300025944 | Ga0207661_10380161 | Ga0207661_103801613 | 97 |
| 191 | 3300025945 | Ga0207679_10088963 | Ga0207679_100889632 | 97 |
| 192 | 3300025945 | Ga0207679_11132800 | Ga0207679_111328002 | 97 |
| 193 | 3300025949 | Ga0207667_10313320 | Ga0207667_103133203 | 97 |
| 194 | 3300025961 | Ga0207712_10040164 | Ga0207712_100401644 | 97 |
| 195 | 3300025981 | Ga0207640_10570735 | Ga0207640_105707352 | 97 |
| 196 | 3300025986 | Ga0207658_10997079 | Ga0207658_109970791 | 97 |
| 197 | 3300026035 | Ga0207703_11091190 | Ga0207703_110911902 | 97 |
| 198 | 3300026035 | Ga0207703_11223307 | Ga0207703_112233072 | 97 |
| 199 | 3300026075 | Ga0207708_10270020 | Ga0207708_102700202 | 97 |
| 200 | 3300026078 | Ga0207702_10452215 | Ga0207702_104522153 | 97 |
| 201 | 3300026116 | Ga0207674_10040064 | Ga0207674_100400643 | 97 |
| 202 | 3300026116 | Ga0207674_10049306 | Ga0207674_100493064 | 97 |
| 203 | 3300026118 | Ga0207675_100308415 | Ga0207675_1003084152 | 97 |
| 204 | 3300026121 | Ga0207683_10962568 | Ga0207683_109625682 | 97 |
| 205 | 3300026142 | Ga0207698_10371610 | Ga0207698_103716101 | 97 |
| 206 | 3300026142 | Ga0207698_11411232 | Ga0207698_114112322 | 97 |
| 207 | 3300028379 | Ga0268266_10177577 | Ga0268266_101775773 | 97 |
| 208 | 3300028563 | Ga0265319_1247090 | Ga0265319_12470902 | 97 |
| 209 | 3300028577 | Ga0265318_10138196 | Ga0265318_101381962 | 97 |
| 210 | 3300031903 | Ga0307407_11470902 | Ga0307407_114709021 | 97 |
| 211 | 3300031995 | Ga0307409_100060829 | Ga0307409_1000608293 | 97 |
| 212 | 3300032005 | Ga0307411_11437992 | Ga0307411_114379922 | 97 |
| 213 | 3300035092 | Ga0373952_0017667 | Ga0373952_0017667_103_396 | 97 |
| 214 | 3300035724 | Ga0373933_0906391 | Ga0373933_0906391_132_428 | 97 |
| 215 | 3300037312 | Ga0395899_0008067 | Ga0395899_0008067_2184_2537 | 97 |
| 216 | 3300037466 | Ga0395898_1131715 | Ga0395898_1131715_172_471 | 97 |
| 217 | 3300037466 | Ga0395898_1555886 | Ga0395898_1555886_101_394 | 97 |
| 218 | 3300037466 | Ga0395898_1778814 | Ga0395898_1778814_59_358 | 97 |
| 219 | 3300038443 | Ga0395901_0651805 | Ga0395901_0651805_683_979 | 97 |
| 220 | 3300039437 | Ga0436365_1724499 | Ga0436365_1724499_174_470 | 97 |
| 221 | 3300039438 | Ga0436360_0064738 | Ga0436360_0064738_206_502 | 97 |
| 222 | 3300039453 | Ga0436362_1099967 | Ga0436362_1099967_1706_2002 | 97 |
| 223 | 3300044694 | Ga0466963_0006174 | Ga0466963_0006174_6740_7036 | 97 |
| 224 | 3300044694 | Ga0466963_0017150 | Ga0466963_0017150_2952_3245 | 97 |
| 225 | 3300044719 | Ga0466971_0155291 | Ga0466971_0155291_766_1059 | 97 |
| 226 | 3300044719 | Ga0466971_0277006 | Ga0466971_0277006_140_436 | 97 |
| 227 | 3300044901 | Ga0466960_0016443 | Ga0466960_0016443_21_317 | 97 |
| 228 | 3300045836 | Ga0466958_0028430 | Ga0466958_0028430_2657_2950 | 97 |
| 229 | 3300045836 | Ga0466958_0504284 | Ga0466958_0504284_320_616 | 97 |
| 230 | 3300045976 | Ga0466967_0004397 | Ga0466967_0004397_8016_8312 | 97 |
| 231 | 3300045976 | Ga0466967_0005692 | Ga0466967_0005692_3032_3328 | 97 |
| 232 | 3300045976 | Ga0466967_0061705 | Ga0466967_0061705_1464_1757 | 97 |
| 233 | 3300046454 | Ga0495592_0179981 | Ga0495592_0179981_92_388 | 97 |
| 234 | 3300046462 | Ga0495651_0278602 | Ga0495651_0278602_734_1030 | 97 |
| 235 | 3300046511 | Ga0495608_0616449 | Ga0495608_0616449_115_411 | 97 |
| 236 | 3300046516 | Ga0495628_0413326 | Ga0495628_0413326_499_795 | 97 |
| 237 | 3300046675 | Ga0495657_0033880 | Ga0495657_0033880_2178_2474 | 97 |
| 238 | 3300046678 | Ga0495599_0243179 | Ga0495599_0243179_554_850 | 97 |
| 239 | 3300046683 | Ga0495658_0357733 | Ga0495658_0357733_65_361 | 97 |
| 240 | 3300047319 | Ga0495674_0950907 | Ga0495674_0950907_173_466 | 97 |
| 241 | 3300048903 | Ga0496100_0050087 | Ga0496100_0050087_1826_2185 | 97 |
| 242 | 3300048904 | Ga0496101_0035060 | Ga0496101_0035060_390_749 | 97 |
| 243 | 3300048905 | Ga0496102_0001033 | Ga0496102_0001033_20411_20770 | 97 |
| 244 | 3300048905 | Ga0496102_0382533 | Ga0496102_0382533_905_1198 | 97 |
| 245 | 3300048905 | Ga0496102_1012649 | Ga0496102_1012649_90_386 | 97 |
| 246 | 3300048906 | Ga0496103_0048155 | Ga0496103_0048155_913_1206 | 97 |
| 247 | 3300048907 | Ga0496104_0058266 | Ga0496104_0058266_1964_2257 | 97 |
| 248 | 3300048907 | Ga0496104_0654372 | Ga0496104_0654372_237_533 | 97 |
| 249 | 3300048907 | Ga0496104_0889260 | Ga0496104_0889260_340_660 | 97 |
| 250 | 3300048908 | Ga0496105_0244951 | Ga0496105_0244951_734_1030 | 97 |
| 251 | 3300048908 | Ga0496105_0266701 | Ga0496105_0266701_900_1259 | 97 |
| 252 | 3300048909 | Ga0496106_0000412 | Ga0496106_0000412_25527_25886 | 97 |
| 253 | 3300048909 | Ga0496106_0041520 | Ga0496106_0041520_376_669 | 97 |
| 254 | 3300048910 | Ga0496107_0008993 | Ga0496107_0008993_5575_5934 | 97 |
| 255 | 3300048910 | Ga0496107_0041651 | Ga0496107_0041651_2217_2510 | 97 |
| 256 | 3300048911 | Ga0496108_1496636 | Ga0496108_1496636_190_483 | 97 |
| 257 | 3300048912 | Ga0496109_0095771 | Ga0496109_0095771_1784_2143 | 97 |
| 258 | 3300048912 | Ga0496109_1417050 | Ga0496109_1417050_180_500 | 97 |
| 259 | 3300048912 | Ga0496109_1581593 | Ga0496109_1581593_61_357 | 97 |
| 260 | 3300048913 | Ga0496110_0590902 | Ga0496110_0590902_102_398 | 97 |
| 261 | 3300048913 | Ga0496110_1541540 | Ga0496110_1541540_190_495 | 97 |
| 262 | 3300048915 | Ga0496112_1694570 | Ga0496112_1694570_58_351 | 97 |
| 263 | 3300048916 | Ga0496113_0781862 | Ga0496113_0781862_346_705 | 97 |
| 264 | 3300048917 | Ga0496114_0002993 | Ga0496114_0002993_9643_10002 | 97 |
| 265 | 3300048917 | Ga0496114_0178790 | Ga0496114_0178790_1227_1523 | 97 |
| 266 | 3300048917 | Ga0496114_0335769 | Ga0496114_0335769_792_1085 | 97 |
| 267 | 3300048918 | Ga0496115_0235190 | Ga0496115_0235190_225_518 | 97 |
| 268 | 3300049571 | Ga0501034_1286570 | Ga0501034_1286570_217_510 | 97 |
| 269 | 3300049572 | Ga0501036_0147656 | Ga0501036_0147656_1456_1782 | 97 |
| 270 | 3300049574 | Ga0501038_0614638 | Ga0501038_0614638_124_450 | 97 |
| 271 | 3300049578 | Ga0501042_0025280 | Ga0501042_0025280_1858_2184 | 97 |
| 272 | 3300049582 | Ga0501048_0359782 | Ga0501048_0359782_329_655 | 97 |
| 273 | 3300049583 | Ga0501067_0016792 | Ga0501067_0016792_573_869 | 97 |
| 274 | 3300049583 | Ga0501067_0026985 | Ga0501067_0026985_219_512 | 97 |
| 275 | 3300049585 | Ga0501069_0007146 | Ga0501069_0007146_454_747 | 97 |
| 276 | 3300049585 | Ga0501069_0655569 | Ga0501069_0655569_227_523 | 97 |
| 277 | 3300049585 | Ga0501069_0706363 | Ga0501069_0706363_147_443 | 97 |
| 278 | 3300049586 | Ga0501070_0285834 | Ga0501070_0285834_774_1067 | 97 |
| 279 | 3300049588 | Ga0501072_0254266 | Ga0501072_0254266_356_682 | 97 |
| 280 | 3300049591 | Ga0501075_0189256 | Ga0501075_0189256_429_755 | 97 |
| 281 | 3300050491 | nmdc:mga00v17_255235_c1 | nmdc:mga00v17_255235_c1_160_456 | 97 |
| 282 | 3300050491 | nmdc:mga00v17_257770_c1 | nmdc:mga00v17_257770_c1_166_462 | 97 |
| 283 | 3300050512 | nmdc:mga0n895_370369_c1 | nmdc:mga0n895_370369_c1_670_963 | 97 |
| 284 | 3300050512 | nmdc:mga0n895_6837_c1 | nmdc:mga0n895_6837_c1_4528_4821 | 97 |
| 285 | 3300050513 | nmdc:mga0rr50_1064944_c1 | nmdc:mga0rr50_1064944_c1_193_486 | 97 |
| 286 | 3300050513 | nmdc:mga0rr50_1428965_c1 | nmdc:mga0rr50_1428965_c1_33_329 | 97 |
| 287 | 3300050513 | nmdc:mga0rr50_1448055_c1 | nmdc:mga0rr50_1448055_c1_133_429 | 97 |
| 288 | 3300050513 | nmdc:mga0rr50_8401_c1 | nmdc:mga0rr50_8401_c1_2846_3139 | 97 |
| 289 | 3300050514 | nmdc:mga08x19_3341_c1 | nmdc:mga08x19_3341_c1_1112_1405 | 97 |
| 290 | 3300050514 | nmdc:mga08x19_898363_c1 | nmdc:mga08x19_898363_c1_307_603 | 97 |
| 291 | 3300050515 | nmdc:mga0a205_357822_c1 | nmdc:mga0a205_357822_c1_515_808 | 97 |
| 292 | 3300053084 | Ga0495595_0077486 | Ga0495595_0077486_1134_1430 | 97 |
| 293 | 3300060353 | Ga0501082_0158550 | Ga0501082_0158550_1300_1626 | 97 |
| 294 | 3300061734 | Ga0530510_0357500 | Ga0530510_0357500_49_375 | 97 |
| 295 | 3300061734 | Ga0530510_0528164 | Ga0530510_0528164_465_758 | 97 |
| 296 | 3300061734 | Ga0530510_0534051 | Ga0530510_0534051_93_389 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.8375 | 3 | 86 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.8189 | 3 | 86 |
| 3brb-assembly2.cif.gz_B | crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with adp | 0.71 | 3 | 57 |
| 3mwb-assembly1.cif.gz_B | the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a | 0.6998 | 2 | 72 |
| 6dzs-assembly1.cif.gz_B | mycobacterial homoserine dehydrogenase thra in complex with nadp | 0.6847 | 2 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8191 | 4 | 86 | 3.30.70.3090 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8007 | 4 | 86 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7988 | 1 | 82 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7562 | 1 | 82 | 3.30.70.3090 |
| 3brbB01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.71 | 3 | 57 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7HQU9-F1-model_v4 | DUF4242 domain-containing protein | 0.9816 | 1 | 93 |
|
| AF-A0A369TIF7-F1-model_v4 | DUF4242 domain-containing protein | 0.9804 | 1 | 93 |
|
| AF-A0A238XM26-F1-model_v4 | DUF4242 domain-containing protein | 0.9727 | 1 | 95 |
|
| AF-B1ZTA8-F1-model_v4 | DUF4242 domain-containing protein | 0.9662 | 1 | 95 |
|
| AF-A0A7Y2XFY1-F1-model_v4 | DUF4242 domain-containing protein | 0.9648 | 1 | 92 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar