F393160

General Info

Members Datasets Scaffolds Average Seq Length
296 194 296 99

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11038555|Ga0105248_110385552
Length 119
Sequence MRAFGARSYPRSRQLEPEGALMDTYVILRRDGWRSAADLEAAAARSTAEGERMPDDIRWIRSYVLAEPANGGLGTVCIYQASSPEAIRRHAAAAELPVDEIVQVADTVLVRPDPVPAGA

Samples

Sample ID Description Type Environment
1 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 10.14
Rhizosphere 86.82
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007409J51694_1159594 3300003575 Unclassified 517
2 Ga0058860_12198514 3300004801 Unclassified 509
3 Ga0070683_100075871 3300005329 Bacteria 3142
4 Ga0070683_100516737 3300005329 Bacteria 1141
5 Ga0070683_100543706 3300005329 Bacteria 1110
6 Ga0070683_101552881 3300005329 Unclassified 636
7 Ga0070690_100192802 3300005330 Bacteria 1414
8 Ga0068869_100855287 3300005334 Bacteria 785
9 Ga0070660_100985075 3300005339 Bacteria 712
10 Ga0070689_102143174 3300005340 Bacteria 512
11 Ga0070687_100500188 3300005343 Bacteria 818
12 Ga0070661_100325455 3300005344 Bacteria 1201
13 Ga0070671_100168331 3300005355 Bacteria 1853
14 Ga0070671_101522733 3300005355 Bacteria 592
15 Ga0070674_100100028 3300005356 Bacteria 2110
16 Ga0070674_100639515 3300005356 Unclassified 903
17 Ga0070674_102086636 3300005356 Bacteria 517
18 Ga0070673_100117636 3300005364 Bacteria 2212
19 Ga0070673_101066057 3300005364 Bacteria 754
20 Ga0070659_100286094 3300005366 Bacteria 1372
21 Ga0070713_100405709 3300005436 Bacteria 1273
22 Ga0070710_10455584 3300005437 Bacteria 868
23 Ga0070710_11149338 3300005437 Bacteria 572
24 Ga0070711_100908474 3300005439 Bacteria 752
25 Ga0070711_100998506 3300005439 Bacteria 718
26 Ga0070705_100199954 3300005440 Bacteria 1369
27 Ga0070708_101106452 3300005445 Bacteria 742
28 Ga0070663_102043056 3300005455 Bacteria 516
29 Ga0070678_101156505 3300005456 Bacteria 716
30 Ga0070662_100226250 3300005457 Bacteria 1495
31 Ga0068867_100386984 3300005459 Unclassified 1176
32 Ga0070685_11240658 3300005466 Bacteria 568
33 Ga0070685_11339707 3300005466 Bacteria 548
34 Ga0070699_100471437 3300005518 Bacteria 1139
35 Ga0070684_100040878 3300005535 Bacteria 3995
36 Ga0070684_100194178 3300005535 Bacteria 1848
37 Ga0070684_100374262 3300005535 Bacteria 1311
38 Ga0070684_100908309 3300005535 Bacteria 825
39 Ga0068853_100851190 3300005539 Bacteria 875
40 Ga0068853_102226173 3300005539 Unclassified 531
41 Ga0070686_100068172 3300005544 Bacteria 2320
42 Ga0070693_100173809 3300005547 Bacteria 1382
43 Ga0070693_101295867 3300005547 Bacteria 563
44 Ga0070665_100321089 3300005548 Bacteria 1553
45 Ga0068855_100257070 3300005563 Bacteria 1947
46 Ga0068855_101219485 3300005563 Unclassified 782
47 Ga0070664_101830960 3300005564 Bacteria 576
48 Ga0068857_100735849 3300005577 Bacteria 939
49 Ga0068854_100880074 3300005578 Bacteria 786
50 Ga0070702_100204384 3300005615 Bacteria 1310
51 Ga0070702_100216052 3300005615 Bacteria 1279
52 Ga0068852_100465635 3300005616 Bacteria 1254
53 Ga0068859_101858384 3300005617 Bacteria 665
54 Ga0068866_10072263 3300005718 Bacteria 1827
55 Ga0068866_10616470 3300005718 Bacteria 735
56 Ga0068861_100889060 3300005719 Bacteria 843
57 Ga0068851_11077071 3300005834 Bacteria 509
58 Ga0068870_10291312 3300005840 Bacteria 1027
59 Ga0068870_11390908 3300005840 Bacteria 514
60 Ga0081455_10010429 3300005937 Bacteria 9433
61 Ga0081455_10812319 3300005937 Unclassified 586
62 Ga0070717_10590591 3300006028 Bacteria 1007
63 Ga0075364_10042050 3300006051 Bacteria 2969
64 Ga0075364_10156936 3300006051 Bacteria 1535
65 Ga0075364_10560752 3300006051 Bacteria 781
66 Ga0070716_100186237 3300006173 Bacteria 1368
67 Ga0070716_101793662 3300006173 Bacteria 508
68 Ga0097621_101173208 3300006237 Bacteria 723
69 Ga0075433_10230350 3300006852 Bacteria 1645
70 Ga0075433_10307715 3300006852 Bacteria 1403
71 Ga0075433_11765786 3300006852 Archaea 532
72 Ga0075434_100006734 3300006871 Bacteria 10559
73 Ga0075434_100012672 3300006871 Bacteria 7996
74 Ga0075434_100188270 3300006871 Bacteria 2084
75 Ga0068865_100296597 3300006881 Bacteria 1292
76 Ga0075436_100030388 3300006914 Bacteria 3718
77 Ga0097620_101858277 3300006931 Bacteria 665
78 Ga0075435_100006758 3300007076 Bacteria 8137
79 Ga0075435_100085231 3300007076 Bacteria 2600
80 Ga0075435_100678314 3300007076 Bacteria 895
81 Ga0105245_10013977 3300009098 Bacteria 6992
82 Ga0105245_10138680 3300009098 Bacteria 2288
83 Ga0105245_10861820 3300009098 Bacteria 946
84 Ga0105247_10118525 3300009101 Bacteria 1712
85 Ga0114129_11272132 3300009147 Bacteria 913
86 Ga0105243_10099366 3300009148 Bacteria 2412
87 Ga0105243_12086036 3300009148 Bacteria 602
88 Ga0105242_10136277 3300009176 Bacteria 2125
89 Ga0105248_11038555 3300009177 Bacteria 926
90 Ga0105248_12049504 3300009177 Bacteria 650
91 Ga0105237_10392636 3300009545 Bacteria 1392
92 Ga0105238_11049083 3300009551 Bacteria 837
93 Ga0105238_12922549 3300009551 Bacteria 514
94 Ga0105239_10911220 3300010375 Bacteria 1009
95 Ga0105239_11546570 3300010375 Bacteria 767
96 Ga0105246_10640570 3300011119 Bacteria 924
97 Ga0105246_10900758 3300011119 Bacteria 793
98 Ga0157329_1045224 3300012491 Unclassified 506
99 Ga0157373_11088334 3300013100 Bacteria 599
100 Ga0157370_11199762 3300013104 Bacteria 685
101 Ga0157369_10013363 3300013105 Bacteria 9288
102 Ga0157374_11216118 3300013296 Bacteria 775
103 Ga0157378_12502858 3300013297 Bacteria 568
104 Ga0163162_10399888 3300013306 Bacteria 1506
105 Ga0163162_10603104 3300013306 Bacteria 1224
106 Ga0163162_12392280 3300013306 Bacteria 607
107 Ga0157372_10618259 3300013307 Bacteria 1262
108 Ga0157372_10833289 3300013307 Bacteria 1071
109 Ga0157372_12432313 3300013307 Bacteria 601
110 Ga0157372_13436489 3300013307 Bacteria 504
111 Ga0157375_10191986 3300013308 Bacteria 2197
112 Ga0163163_10419072 3300014325 Bacteria 1398
113 Ga0163163_10545202 3300014325 Bacteria 1222
114 Ga0157377_10599229 3300014745 Bacteria 786
115 Ga0157379_10092012 3300014968 Bacteria 2721
116 Ga0157376_11352889 3300014969 Bacteria 743
117 Ga0157376_11661620 3300014969 Bacteria 673
118 Ga0206354_11272189 3300020081 Bacteria 1700
119 Ga0206353_11122745 3300020082 Bacteria 530
120 Ga0206353_11644368 3300020082 Bacteria 1785
121 Ga0207692_10172966 3300025898 Bacteria 1253
122 Ga0207692_10777476 3300025898 Bacteria 625
123 Ga0207642_10133396 3300025899 Bacteria 1299
124 Ga0207642_10403801 3300025899 Bacteria 818
125 Ga0207688_10498703 3300025901 Bacteria 762
126 Ga0207643_10342075 3300025908 Bacteria 938
127 Ga0207654_10263000 3300025911 Unclassified 1161
128 Ga0207663_11396182 3300025916 Bacteria 564
129 Ga0207657_10822102 3300025919 Bacteria 718
130 Ga0207657_11197360 3300025919 Bacteria 577
131 Ga0207652_10738607 3300025921 Bacteria 877
132 Ga0207646_10474038 3300025922 Bacteria 1129
133 Ga0207694_10851310 3300025924 Bacteria 771
134 Ga0207694_11214351 3300025924 Bacteria 638
135 Ga0207687_10042574 3300025927 Bacteria 3125
136 Ga0207700_11407095 3300025928 Bacteria 620
137 Ga0207644_10127500 3300025931 Bacteria 1944
138 Ga0207690_10865800 3300025932 Bacteria 748
139 Ga0207706_10187823 3300025933 Bacteria 1814
140 Ga0207709_10095879 3300025935 Bacteria 1950
141 Ga0207709_11221814 3300025935 Bacteria 620
142 Ga0207669_10816756 3300025937 Bacteria 774
143 Ga0207665_10153339 3300025939 Bacteria 1652
144 Ga0207665_10362718 3300025939 Bacteria 1096
145 Ga0207711_10579350 3300025941 Bacteria 1047
146 Ga0207689_10293261 3300025942 Unclassified 1347
147 Ga0207689_10818655 3300025942 Bacteria 786
148 Ga0207661_10080419 3300025944 Bacteria 2689
149 Ga0207661_10147654 3300025944 Bacteria 2030
150 Ga0207661_10380161 3300025944 Bacteria 1278
151 Ga0207679_10088963 3300025945 Bacteria 2382
152 Ga0207679_11132800 3300025945 Bacteria 718
153 Ga0207667_10313320 3300025949 Bacteria 1603
154 Ga0207712_10040164 3300025961 Bacteria 3209
155 Ga0207640_10570735 3300025981 Unclassified 953
156 Ga0207658_10997079 3300025986 Bacteria 764
157 Ga0207703_11091190 3300026035 Bacteria 767
158 Ga0207703_11223307 3300026035 Bacteria 722
159 Ga0207708_10270020 3300026075 Bacteria 1375
160 Ga0207702_10452215 3300026078 Bacteria 1246
161 Ga0207674_10040064 3300026116 Bacteria 4855
162 Ga0207674_10049306 3300026116 Bacteria 4307
163 Ga0207675_100308415 3300026118 Bacteria 1543
164 Ga0207683_10962568 3300026121 Bacteria 793
165 Ga0207698_10371610 3300026142 Bacteria 1357
166 Ga0207698_11411232 3300026142 Bacteria 711
167 Ga0268266_10177577 3300028379 Bacteria 1937
168 Ga0265319_1247090 3300028563 Unclassified 544
169 Ga0265318_10138196 3300028577 Unclassified 895
170 Ga0307407_11470902 3300031903 Unclassified 538
171 Ga0307409_100060829 3300031995 Bacteria 2948
172 Ga0307411_11437992 3300032005 Unclassified 632
173 Ga0373952_0017667 3300035092 Bacteria 1466
174 Ga0373933_0906391 3300035724 Unclassified 580
175 Ga0395899_0008067 3300037312 Bacteria 8108
176 Ga0395898_1131715 3300037466 Bacteria 715
177 Ga0395898_1555886 3300037466 Unclassified 586
178 Ga0395898_1778814 3300037466 Archaea 538
179 Ga0395901_0505273 3300038443 Bacteria 1230
180 Ga0395901_0651805 3300038443 Bacteria 1056
181 Ga0436365_1724499 3300039437 Bacteria 597
182 Ga0436360_0064738 3300039438 Unclassified 559
183 Ga0436363_0616967 3300039450 Bacteria 722
184 Ga0436362_1099967 3300039453 Bacteria 3389
185 Ga0466963_0006174 3300044694 Bacteria 7072
186 Ga0466963_0017150 3300044694 Bacteria 4510
187 Ga0466971_0155291 3300044719 Bacteria 1070
188 Ga0466971_0277006 3300044719 Bacteria 802
189 Ga0466960_0016443 3300044901 Bacteria 3210
190 Ga0466958_0028430 3300045836 Bacteria 3315
191 Ga0466958_0504284 3300045836 Bacteria 785
192 Ga0466967_0004397 3300045976 Bacteria 9492
193 Ga0466967_0005692 3300045976 Bacteria 8688
194 Ga0466967_0061705 3300045976 Bacteria 3326
195 Ga0495592_0179981 3300046454 Bacteria 1441
196 Ga0495651_0278602 3300046462 Unclassified 1131
197 Ga0495608_0616449 3300046511 Unclassified 650
198 Ga0495628_0413326 3300046516 Unclassified 984
199 Ga0495634_0000840 3300046642 Bacteria 29619
200 Ga0495657_0033880 3300046675 Unclassified 3552
201 Ga0495599_0243179 3300046678 Bacteria 1097
202 Ga0495658_0357733 3300046683 Unclassified 928
203 Ga0495674_0950907 3300047319 Unclassified 661
204 Ga0496100_0050087 3300048903 Bacteria 2704
205 Ga0496101_0035060 3300048904 Bacteria 3548
206 Ga0496102_0001033 3300048905 Bacteria 25892
207 Ga0496102_0025176 3300048905 Bacteria 5294
208 Ga0496102_0382533 3300048905 Bacteria 1324
209 Ga0496102_1012649 3300048905 Bacteria 751
210 Ga0496103_0048155 3300048906 Bacteria 2634
211 Ga0496104_0058266 3300048907 Bacteria 3656
212 Ga0496104_0654372 3300048907 Unclassified 960
213 Ga0496104_0889260 3300048907 Bacteria 796
214 Ga0496105_0244951 3300048908 Unclassified 1454
215 Ga0496105_0266701 3300048908 Bacteria 1384
216 Ga0496106_0000412 3300048909 Bacteria 30346
217 Ga0496106_0041520 3300048909 Bacteria 3447
218 Ga0496107_0008993 3300048910 Bacteria 6923
219 Ga0496107_0041651 3300048910 Bacteria 3298
220 Ga0496108_1496636 3300048911 Bacteria 562
221 Ga0496109_0095771 3300048912 Bacteria 2749
222 Ga0496109_1417050 3300048912 Bacteria 630
223 Ga0496109_1581593 3300048912 Bacteria 590
224 Ga0496110_0590902 3300048913 Bacteria 1008
225 Ga0496110_1541540 3300048913 Bacteria 574
226 Ga0496112_0004963 3300048915 Bacteria 11401
227 Ga0496112_1694570 3300048915 Bacteria 545
228 Ga0496113_0781862 3300048916 Bacteria 759
229 Ga0496114_0002993 3300048917 Bacteria 12954
230 Ga0496114_0178790 3300048917 Bacteria 1852
231 Ga0496114_0335769 3300048917 Bacteria 1336
232 Ga0496115_0000005 3300048918 Bacteria 290756
233 Ga0496115_0235190 3300048918 Unclassified 1510
234 Ga0496121_0194389 3300048924 Bacteria 1452
235 Ga0501031_0086785 3300049568 Bacteria 2040
236 Ga0501032_0253369 3300049569 Bacteria 1142
237 Ga0501034_1286570 3300049571 Bacteria 608
238 Ga0501036_0005850 3300049572 Bacteria 9959
239 Ga0501036_0147656 3300049572 Bacteria 1984
240 Ga0501037_0154935 3300049573 Bacteria 1636
241 Ga0501038_0069587 3300049574 Bacteria 2989
242 Ga0501038_0614638 3300049574 Bacteria 821
243 Ga0501039_0228918 3300049575 Bacteria 1461
244 Ga0501040_0005733 3300049576 Bacteria 8032
245 Ga0501041_0019558 3300049577 Bacteria 4044
246 Ga0501042_0025280 3300049578 Bacteria 4170
247 Ga0501042_0032340 3300049578 Bacteria 3704
248 Ga0501043_0442937 3300049579 Bacteria 977
249 Ga0501046_0048345 3300049580 Bacteria 3369
250 Ga0501048_0001135 3300049582 Bacteria 19978
251 Ga0501048_0359782 3300049582 Bacteria 1038
252 Ga0501067_0016792 3300049583 Bacteria 4045
253 Ga0501067_0026985 3300049583 Bacteria 3180
254 Ga0501069_0007146 3300049585 Bacteria 5852
255 Ga0501069_0266949 3300049585 Bacteria 1000
256 Ga0501069_0655569 3300049585 Unclassified 632
257 Ga0501069_0706363 3300049585 Bacteria 608
258 Ga0501070_0285834 3300049586 Bacteria 1345
259 Ga0501071_0001408 3300049587 Bacteria 13820
260 Ga0501072_0108810 3300049588 Bacteria 2205
261 Ga0501072_0254266 3300049588 Bacteria 1399
262 Ga0501073_0130903 3300049589 Bacteria 1739
263 Ga0501074_0027875 3300049590 Bacteria 4094
264 Ga0501074_0595532 3300049590 Bacteria 782
265 Ga0501075_0005620 3300049591 Bacteria 8575
266 Ga0501075_0189256 3300049591 Bacteria 1570
267 Ga0501076_0000793 3300049592 Bacteria 20434
268 Ga0501077_0035110 3300049593 Bacteria 3192
269 Ga0501079_0106727 3300049741 Bacteria 2173
270 Ga0501080_0025529 3300049742 Bacteria 5485
271 Ga0501081_0001673 3300049743 Bacteria 13715
272 Ga0501083_0135132 3300049744 Bacteria 1616
273 Ga0501035_0017297 3300049822 Bacteria 6648
274 Ga0501044_0602073 3300049823 Bacteria 992
275 Ga0501045_0001734 3300049824 Bacteria 14688
276 nmdc:mga00v17_255235_c1 3300050491 Bacteria 1137
277 nmdc:mga00v17_257770_c1 3300050491 Bacteria 1131
278 nmdc:mga0n895_370369_c1 3300050512 Bacteria 1450
279 nmdc:mga0n895_6837_c1 3300050512 Bacteria 9741
280 nmdc:mga0rr50_1064944_c1 3300050513 Bacteria 688
281 nmdc:mga0rr50_1428965_c1 3300050513 Bacteria 585
282 nmdc:mga0rr50_1448055_c1 3300050513 Bacteria 581
283 nmdc:mga0rr50_8401_c1 3300050513 Bacteria 6426
284 nmdc:mga08x19_3341_c1 3300050514 Bacteria 9600
285 nmdc:mga08x19_898363_c1 3300050514 Bacteria 629
286 nmdc:mga0a205_357822_c1 3300050515 Bacteria 1326
287 Ga0495601_0563897 3300053077 Bacteria 732
288 Ga0495595_0077486 3300053084 Unclassified 1579
289 Ga0495595_0568845 3300053084 Bacteria 579
290 Ga0501084_0581938 3300054114 Bacteria 946
291 Ga0501082_0002809 3300060353 Bacteria 15201
292 Ga0501082_0158550 3300060353 Bacteria 1966
293 Ga0530510_0012679 3300061734 Bacteria 5926
294 Ga0530510_0357500 3300061734 Bacteria 1097
295 Ga0530510_0528164 3300061734 Bacteria 895
296 Ga0530510_0534051 3300061734 Bacteria 890

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100374262 Ga0070684_1003742623 93
2 3300010375 Ga0105239_10911220 Ga0105239_109112201 93
3 3300046642 Ga0495634_0000840 Ga0495634_0000840_6170_6454 93
4 3300048915 Ga0496112_0004963 Ga0496112_0004963_3939_4226 93
5 3300048918 Ga0496115_0000005 Ga0496115_0000005_235880_236182 93
6 3300049590 Ga0501074_0595532 Ga0501074_0595532_462_743 93
7 3300053077 Ga0495601_0563897 Ga0495601_0563897_214_498 93
8 3300053084 Ga0495595_0568845 Ga0495595_0568845_257_547 95
9 3300054114 Ga0501084_0581938 Ga0501084_0581938_479_769 95
10 3300005518 Ga0070699_100471437 Ga0070699_1004714372 96
11 3300005840 Ga0068870_10291312 Ga0068870_102913122 96
12 3300013306 Ga0163162_12392280 Ga0163162_123922802 96
13 3300038443 Ga0395901_0505273 Ga0395901_0505273_914_1207 96
14 3300039450 Ga0436363_0616967 Ga0436363_0616967_343_636 96
15 3300048905 Ga0496102_0025176 Ga0496102_0025176_1697_2032 96
16 3300048924 Ga0496121_0194389 Ga0496121_0194389_446_781 96
17 3300049568 Ga0501031_0086785 Ga0501031_0086785_545_835 96
18 3300049569 Ga0501032_0253369 Ga0501032_0253369_337_627 96
19 3300049572 Ga0501036_0005850 Ga0501036_0005850_8403_8693 96
20 3300049573 Ga0501037_0154935 Ga0501037_0154935_52_342 96
21 3300049574 Ga0501038_0069587 Ga0501038_0069587_837_1127 96
22 3300049575 Ga0501039_0228918 Ga0501039_0228918_81_371 96
23 3300049576 Ga0501040_0005733 Ga0501040_0005733_350_640 96
24 3300049577 Ga0501041_0019558 Ga0501041_0019558_1705_1995 96
25 3300049578 Ga0501042_0032340 Ga0501042_0032340_606_896 96
26 3300049579 Ga0501043_0442937 Ga0501043_0442937_498_788 96
27 3300049580 Ga0501046_0048345 Ga0501046_0048345_1887_2177 96
28 3300049582 Ga0501048_0001135 Ga0501048_0001135_10661_10951 96
29 3300049585 Ga0501069_0266949 Ga0501069_0266949_31_321 96
30 3300049587 Ga0501071_0001408 Ga0501071_0001408_8166_8456 96
31 3300049588 Ga0501072_0108810 Ga0501072_0108810_672_962 96
32 3300049589 Ga0501073_0130903 Ga0501073_0130903_599_889 96
33 3300049590 Ga0501074_0027875 Ga0501074_0027875_1509_1799 96
34 3300049591 Ga0501075_0005620 Ga0501075_0005620_5497_5787 96
35 3300049592 Ga0501076_0000793 Ga0501076_0000793_5554_5844 96
36 3300049593 Ga0501077_0035110 Ga0501077_0035110_2190_2480 96
37 3300049741 Ga0501079_0106727 Ga0501079_0106727_920_1210 96
38 3300049742 Ga0501080_0025529 Ga0501080_0025529_2736_3026 96
39 3300049743 Ga0501081_0001673 Ga0501081_0001673_5671_5961 96
40 3300049744 Ga0501083_0135132 Ga0501083_0135132_95_385 96
41 3300049822 Ga0501035_0017297 Ga0501035_0017297_6042_6332 96
42 3300049823 Ga0501044_0602073 Ga0501044_0602073_99_389 96
43 3300049824 Ga0501045_0001734 Ga0501045_0001734_12094_12384 96
44 3300060353 Ga0501082_0002809 Ga0501082_0002809_9118_9408 96
45 3300061734 Ga0530510_0012679 Ga0530510_0012679_754_1044 96
46 3300003575 Ga0007409J51694_1159594 Ga0007409J51694_11595941 97
47 3300004801 Ga0058860_12198514 Ga0058860_121985142 97
48 3300005329 Ga0070683_100075871 Ga0070683_1000758712 97
49 3300005329 Ga0070683_100516737 Ga0070683_1005167372 97
50 3300005329 Ga0070683_100543706 Ga0070683_1005437062 97
51 3300005329 Ga0070683_101552881 Ga0070683_1015528811 97
52 3300005330 Ga0070690_100192802 Ga0070690_1001928021 97
53 3300005334 Ga0068869_100855287 Ga0068869_1008552872 97
54 3300005339 Ga0070660_100985075 Ga0070660_1009850751 97
55 3300005340 Ga0070689_102143174 Ga0070689_1021431741 97
56 3300005343 Ga0070687_100500188 Ga0070687_1005001881 97
57 3300005344 Ga0070661_100325455 Ga0070661_1003254551 97
58 3300005355 Ga0070671_100168331 Ga0070671_1001683312 97
59 3300005355 Ga0070671_101522733 Ga0070671_1015227331 97
60 3300005356 Ga0070674_100100028 Ga0070674_1001000282 97
61 3300005356 Ga0070674_100639515 Ga0070674_1006395152 97
62 3300005356 Ga0070674_102086636 Ga0070674_1020866362 97
63 3300005364 Ga0070673_100117636 Ga0070673_1001176362 97
64 3300005364 Ga0070673_101066057 Ga0070673_1010660572 97
65 3300005366 Ga0070659_100286094 Ga0070659_1002860942 97
66 3300005436 Ga0070713_100405709 Ga0070713_1004057092 97
67 3300005437 Ga0070710_10455584 Ga0070710_104555842 97
68 3300005437 Ga0070710_11149338 Ga0070710_111493381 97
69 3300005439 Ga0070711_100908474 Ga0070711_1009084741 97
70 3300005439 Ga0070711_100998506 Ga0070711_1009985062 97
71 3300005440 Ga0070705_100199954 Ga0070705_1001999541 97
72 3300005445 Ga0070708_101106452 Ga0070708_1011064522 97
73 3300005455 Ga0070663_102043056 Ga0070663_1020430561 97
74 3300005456 Ga0070678_101156505 Ga0070678_1011565052 97
75 3300005457 Ga0070662_100226250 Ga0070662_1002262503 97
76 3300005459 Ga0068867_100386984 Ga0068867_1003869842 97
77 3300005466 Ga0070685_11240658 Ga0070685_112406581 97
78 3300005466 Ga0070685_11339707 Ga0070685_113397072 97
79 3300005535 Ga0070684_100040878 Ga0070684_1000408783 97
80 3300005535 Ga0070684_100194178 Ga0070684_1001941783 97
81 3300005535 Ga0070684_100908309 Ga0070684_1009083092 97
82 3300005539 Ga0068853_100851190 Ga0068853_1008511902 97
83 3300005539 Ga0068853_102226173 Ga0068853_1022261731 97
84 3300005544 Ga0070686_100068172 Ga0070686_1000681722 97
85 3300005547 Ga0070693_100173809 Ga0070693_1001738091 97
86 3300005547 Ga0070693_101295867 Ga0070693_1012958671 97
87 3300005548 Ga0070665_100321089 Ga0070665_1003210893 97
88 3300005563 Ga0068855_100257070 Ga0068855_1002570703 97
89 3300005563 Ga0068855_101219485 Ga0068855_1012194852 97
90 3300005564 Ga0070664_101830960 Ga0070664_1018309601 97
91 3300005577 Ga0068857_100735849 Ga0068857_1007358493 97
92 3300005578 Ga0068854_100880074 Ga0068854_1008800742 97
93 3300005615 Ga0070702_100204384 Ga0070702_1002043842 97
94 3300005615 Ga0070702_100216052 Ga0070702_1002160522 97
95 3300005616 Ga0068852_100465635 Ga0068852_1004656353 97
96 3300005617 Ga0068859_101858384 Ga0068859_1018583842 97
97 3300005718 Ga0068866_10072263 Ga0068866_100722633 97
98 3300005718 Ga0068866_10616470 Ga0068866_106164702 97
99 3300005719 Ga0068861_100889060 Ga0068861_1008890602 97
100 3300005834 Ga0068851_11077071 Ga0068851_110770712 97
101 3300005840 Ga0068870_11390908 Ga0068870_113909081 97
102 3300005937 Ga0081455_10010429 Ga0081455_100104298 97
103 3300005937 Ga0081455_10812319 Ga0081455_108123191 97
104 3300006028 Ga0070717_10590591 Ga0070717_105905912 97
105 3300006051 Ga0075364_10042050 Ga0075364_100420503 97
106 3300006051 Ga0075364_10156936 Ga0075364_101569362 97
107 3300006051 Ga0075364_10560752 Ga0075364_105607522 97
108 3300006173 Ga0070716_100186237 Ga0070716_1001862372 97
109 3300006173 Ga0070716_101793662 Ga0070716_1017936621 97
110 3300006237 Ga0097621_101173208 Ga0097621_1011732082 97
111 3300006852 Ga0075433_10230350 Ga0075433_102303502 97
112 3300006852 Ga0075433_10307715 Ga0075433_103077152 97
113 3300006852 Ga0075433_11765786 Ga0075433_117657861 97
114 3300006871 Ga0075434_100006734 Ga0075434_1000067345 97
115 3300006871 Ga0075434_100012672 Ga0075434_1000126725 97
116 3300006871 Ga0075434_100188270 Ga0075434_1001882702 97
117 3300006881 Ga0068865_100296597 Ga0068865_1002965971 97
118 3300006914 Ga0075436_100030388 Ga0075436_1000303884 97
119 3300006931 Ga0097620_101858277 Ga0097620_1018582771 97
120 3300007076 Ga0075435_100006758 Ga0075435_1000067586 97
121 3300007076 Ga0075435_100085231 Ga0075435_1000852313 97
122 3300007076 Ga0075435_100678314 Ga0075435_1006783141 97
123 3300009098 Ga0105245_10013977 Ga0105245_100139774 97
124 3300009098 Ga0105245_10138680 Ga0105245_101386802 97
125 3300009098 Ga0105245_10861820 Ga0105245_108618201 97
126 3300009101 Ga0105247_10118525 Ga0105247_101185253 97
127 3300009147 Ga0114129_11272132 Ga0114129_112721322 97
128 3300009148 Ga0105243_10099366 Ga0105243_100993664 97
129 3300009148 Ga0105243_12086036 Ga0105243_120860362 97
130 3300009176 Ga0105242_10136277 Ga0105242_101362772 97
131 3300009177 Ga0105248_11038555 Ga0105248_110385552 97
132 3300009177 Ga0105248_12049504 Ga0105248_120495041 97
133 3300009545 Ga0105237_10392636 Ga0105237_103926363 97
134 3300009551 Ga0105238_11049083 Ga0105238_110490832 97
135 3300009551 Ga0105238_12922549 Ga0105238_129225491 97
136 3300010375 Ga0105239_11546570 Ga0105239_115465702 97
137 3300011119 Ga0105246_10640570 Ga0105246_106405702 97
138 3300011119 Ga0105246_10900758 Ga0105246_109007582 97
139 3300012491 Ga0157329_1045224 Ga0157329_10452241 97
140 3300013100 Ga0157373_11088334 Ga0157373_110883342 97
141 3300013104 Ga0157370_11199762 Ga0157370_111997622 97
142 3300013105 Ga0157369_10013363 Ga0157369_100133635 97
143 3300013296 Ga0157374_11216118 Ga0157374_112161182 97
144 3300013297 Ga0157378_12502858 Ga0157378_125028582 97
145 3300013306 Ga0163162_10399888 Ga0163162_103998883 97
146 3300013306 Ga0163162_10603104 Ga0163162_106031042 97
147 3300013307 Ga0157372_10618259 Ga0157372_106182592 97
148 3300013307 Ga0157372_10833289 Ga0157372_108332892 97
149 3300013307 Ga0157372_12432313 Ga0157372_124323132 97
150 3300013307 Ga0157372_13436489 Ga0157372_134364892 97
151 3300013308 Ga0157375_10191986 Ga0157375_101919861 97
152 3300014325 Ga0163163_10419072 Ga0163163_104190722 97
153 3300014325 Ga0163163_10545202 Ga0163163_105452022 97
154 3300014745 Ga0157377_10599229 Ga0157377_105992291 97
155 3300014968 Ga0157379_10092012 Ga0157379_100920122 97
156 3300014969 Ga0157376_11352889 Ga0157376_113528891 97
157 3300014969 Ga0157376_11661620 Ga0157376_116616202 97
158 3300020081 Ga0206354_11272189 Ga0206354_112721892 97
159 3300020082 Ga0206353_11122745 Ga0206353_111227452 97
160 3300020082 Ga0206353_11644368 Ga0206353_116443682 97
161 3300025898 Ga0207692_10172966 Ga0207692_101729662 97
162 3300025898 Ga0207692_10777476 Ga0207692_107774761 97
163 3300025899 Ga0207642_10133396 Ga0207642_101333962 97
164 3300025899 Ga0207642_10403801 Ga0207642_104038012 97
165 3300025901 Ga0207688_10498703 Ga0207688_104987031 97
166 3300025908 Ga0207643_10342075 Ga0207643_103420752 97
167 3300025911 Ga0207654_10263000 Ga0207654_102630002 97
168 3300025916 Ga0207663_11396182 Ga0207663_113961822 97
169 3300025919 Ga0207657_10822102 Ga0207657_108221022 97
170 3300025919 Ga0207657_11197360 Ga0207657_111973601 97
171 3300025921 Ga0207652_10738607 Ga0207652_107386072 97
172 3300025922 Ga0207646_10474038 Ga0207646_104740382 97
173 3300025924 Ga0207694_10851310 Ga0207694_108513102 97
174 3300025924 Ga0207694_11214351 Ga0207694_112143512 97
175 3300025927 Ga0207687_10042574 Ga0207687_100425744 97
176 3300025928 Ga0207700_11407095 Ga0207700_114070952 97
177 3300025931 Ga0207644_10127500 Ga0207644_101275002 97
178 3300025932 Ga0207690_10865800 Ga0207690_108658001 97
179 3300025933 Ga0207706_10187823 Ga0207706_101878233 97
180 3300025935 Ga0207709_10095879 Ga0207709_100958791 97
181 3300025935 Ga0207709_11221814 Ga0207709_112218141 97
182 3300025937 Ga0207669_10816756 Ga0207669_108167561 97
183 3300025939 Ga0207665_10153339 Ga0207665_101533392 97
184 3300025939 Ga0207665_10362718 Ga0207665_103627182 97
185 3300025941 Ga0207711_10579350 Ga0207711_105793502 97
186 3300025942 Ga0207689_10293261 Ga0207689_102932612 97
187 3300025942 Ga0207689_10818655 Ga0207689_108186552 97
188 3300025944 Ga0207661_10080419 Ga0207661_100804194 97
189 3300025944 Ga0207661_10147654 Ga0207661_101476543 97
190 3300025944 Ga0207661_10380161 Ga0207661_103801613 97
191 3300025945 Ga0207679_10088963 Ga0207679_100889632 97
192 3300025945 Ga0207679_11132800 Ga0207679_111328002 97
193 3300025949 Ga0207667_10313320 Ga0207667_103133203 97
194 3300025961 Ga0207712_10040164 Ga0207712_100401644 97
195 3300025981 Ga0207640_10570735 Ga0207640_105707352 97
196 3300025986 Ga0207658_10997079 Ga0207658_109970791 97
197 3300026035 Ga0207703_11091190 Ga0207703_110911902 97
198 3300026035 Ga0207703_11223307 Ga0207703_112233072 97
199 3300026075 Ga0207708_10270020 Ga0207708_102700202 97
200 3300026078 Ga0207702_10452215 Ga0207702_104522153 97
201 3300026116 Ga0207674_10040064 Ga0207674_100400643 97
202 3300026116 Ga0207674_10049306 Ga0207674_100493064 97
203 3300026118 Ga0207675_100308415 Ga0207675_1003084152 97
204 3300026121 Ga0207683_10962568 Ga0207683_109625682 97
205 3300026142 Ga0207698_10371610 Ga0207698_103716101 97
206 3300026142 Ga0207698_11411232 Ga0207698_114112322 97
207 3300028379 Ga0268266_10177577 Ga0268266_101775773 97
208 3300028563 Ga0265319_1247090 Ga0265319_12470902 97
209 3300028577 Ga0265318_10138196 Ga0265318_101381962 97
210 3300031903 Ga0307407_11470902 Ga0307407_114709021 97
211 3300031995 Ga0307409_100060829 Ga0307409_1000608293 97
212 3300032005 Ga0307411_11437992 Ga0307411_114379922 97
213 3300035092 Ga0373952_0017667 Ga0373952_0017667_103_396 97
214 3300035724 Ga0373933_0906391 Ga0373933_0906391_132_428 97
215 3300037312 Ga0395899_0008067 Ga0395899_0008067_2184_2537 97
216 3300037466 Ga0395898_1131715 Ga0395898_1131715_172_471 97
217 3300037466 Ga0395898_1555886 Ga0395898_1555886_101_394 97
218 3300037466 Ga0395898_1778814 Ga0395898_1778814_59_358 97
219 3300038443 Ga0395901_0651805 Ga0395901_0651805_683_979 97
220 3300039437 Ga0436365_1724499 Ga0436365_1724499_174_470 97
221 3300039438 Ga0436360_0064738 Ga0436360_0064738_206_502 97
222 3300039453 Ga0436362_1099967 Ga0436362_1099967_1706_2002 97
223 3300044694 Ga0466963_0006174 Ga0466963_0006174_6740_7036 97
224 3300044694 Ga0466963_0017150 Ga0466963_0017150_2952_3245 97
225 3300044719 Ga0466971_0155291 Ga0466971_0155291_766_1059 97
226 3300044719 Ga0466971_0277006 Ga0466971_0277006_140_436 97
227 3300044901 Ga0466960_0016443 Ga0466960_0016443_21_317 97
228 3300045836 Ga0466958_0028430 Ga0466958_0028430_2657_2950 97
229 3300045836 Ga0466958_0504284 Ga0466958_0504284_320_616 97
230 3300045976 Ga0466967_0004397 Ga0466967_0004397_8016_8312 97
231 3300045976 Ga0466967_0005692 Ga0466967_0005692_3032_3328 97
232 3300045976 Ga0466967_0061705 Ga0466967_0061705_1464_1757 97
233 3300046454 Ga0495592_0179981 Ga0495592_0179981_92_388 97
234 3300046462 Ga0495651_0278602 Ga0495651_0278602_734_1030 97
235 3300046511 Ga0495608_0616449 Ga0495608_0616449_115_411 97
236 3300046516 Ga0495628_0413326 Ga0495628_0413326_499_795 97
237 3300046675 Ga0495657_0033880 Ga0495657_0033880_2178_2474 97
238 3300046678 Ga0495599_0243179 Ga0495599_0243179_554_850 97
239 3300046683 Ga0495658_0357733 Ga0495658_0357733_65_361 97
240 3300047319 Ga0495674_0950907 Ga0495674_0950907_173_466 97
241 3300048903 Ga0496100_0050087 Ga0496100_0050087_1826_2185 97
242 3300048904 Ga0496101_0035060 Ga0496101_0035060_390_749 97
243 3300048905 Ga0496102_0001033 Ga0496102_0001033_20411_20770 97
244 3300048905 Ga0496102_0382533 Ga0496102_0382533_905_1198 97
245 3300048905 Ga0496102_1012649 Ga0496102_1012649_90_386 97
246 3300048906 Ga0496103_0048155 Ga0496103_0048155_913_1206 97
247 3300048907 Ga0496104_0058266 Ga0496104_0058266_1964_2257 97
248 3300048907 Ga0496104_0654372 Ga0496104_0654372_237_533 97
249 3300048907 Ga0496104_0889260 Ga0496104_0889260_340_660 97
250 3300048908 Ga0496105_0244951 Ga0496105_0244951_734_1030 97
251 3300048908 Ga0496105_0266701 Ga0496105_0266701_900_1259 97
252 3300048909 Ga0496106_0000412 Ga0496106_0000412_25527_25886 97
253 3300048909 Ga0496106_0041520 Ga0496106_0041520_376_669 97
254 3300048910 Ga0496107_0008993 Ga0496107_0008993_5575_5934 97
255 3300048910 Ga0496107_0041651 Ga0496107_0041651_2217_2510 97
256 3300048911 Ga0496108_1496636 Ga0496108_1496636_190_483 97
257 3300048912 Ga0496109_0095771 Ga0496109_0095771_1784_2143 97
258 3300048912 Ga0496109_1417050 Ga0496109_1417050_180_500 97
259 3300048912 Ga0496109_1581593 Ga0496109_1581593_61_357 97
260 3300048913 Ga0496110_0590902 Ga0496110_0590902_102_398 97
261 3300048913 Ga0496110_1541540 Ga0496110_1541540_190_495 97
262 3300048915 Ga0496112_1694570 Ga0496112_1694570_58_351 97
263 3300048916 Ga0496113_0781862 Ga0496113_0781862_346_705 97
264 3300048917 Ga0496114_0002993 Ga0496114_0002993_9643_10002 97
265 3300048917 Ga0496114_0178790 Ga0496114_0178790_1227_1523 97
266 3300048917 Ga0496114_0335769 Ga0496114_0335769_792_1085 97
267 3300048918 Ga0496115_0235190 Ga0496115_0235190_225_518 97
268 3300049571 Ga0501034_1286570 Ga0501034_1286570_217_510 97
269 3300049572 Ga0501036_0147656 Ga0501036_0147656_1456_1782 97
270 3300049574 Ga0501038_0614638 Ga0501038_0614638_124_450 97
271 3300049578 Ga0501042_0025280 Ga0501042_0025280_1858_2184 97
272 3300049582 Ga0501048_0359782 Ga0501048_0359782_329_655 97
273 3300049583 Ga0501067_0016792 Ga0501067_0016792_573_869 97
274 3300049583 Ga0501067_0026985 Ga0501067_0026985_219_512 97
275 3300049585 Ga0501069_0007146 Ga0501069_0007146_454_747 97
276 3300049585 Ga0501069_0655569 Ga0501069_0655569_227_523 97
277 3300049585 Ga0501069_0706363 Ga0501069_0706363_147_443 97
278 3300049586 Ga0501070_0285834 Ga0501070_0285834_774_1067 97
279 3300049588 Ga0501072_0254266 Ga0501072_0254266_356_682 97
280 3300049591 Ga0501075_0189256 Ga0501075_0189256_429_755 97
281 3300050491 nmdc:mga00v17_255235_c1 nmdc:mga00v17_255235_c1_160_456 97
282 3300050491 nmdc:mga00v17_257770_c1 nmdc:mga00v17_257770_c1_166_462 97
283 3300050512 nmdc:mga0n895_370369_c1 nmdc:mga0n895_370369_c1_670_963 97
284 3300050512 nmdc:mga0n895_6837_c1 nmdc:mga0n895_6837_c1_4528_4821 97
285 3300050513 nmdc:mga0rr50_1064944_c1 nmdc:mga0rr50_1064944_c1_193_486 97
286 3300050513 nmdc:mga0rr50_1428965_c1 nmdc:mga0rr50_1428965_c1_33_329 97
287 3300050513 nmdc:mga0rr50_1448055_c1 nmdc:mga0rr50_1448055_c1_133_429 97
288 3300050513 nmdc:mga0rr50_8401_c1 nmdc:mga0rr50_8401_c1_2846_3139 97
289 3300050514 nmdc:mga08x19_3341_c1 nmdc:mga08x19_3341_c1_1112_1405 97
290 3300050514 nmdc:mga08x19_898363_c1 nmdc:mga08x19_898363_c1_307_603 97
291 3300050515 nmdc:mga0a205_357822_c1 nmdc:mga0a205_357822_c1_515_808 97
292 3300053084 Ga0495595_0077486 Ga0495595_0077486_1134_1430 97
293 3300060353 Ga0501082_0158550 Ga0501082_0158550_1300_1626 97
294 3300061734 Ga0530510_0357500 Ga0530510_0357500_49_375 97
295 3300061734 Ga0530510_0528164 Ga0530510_0528164_465_758 97
296 3300061734 Ga0530510_0534051 Ga0530510_0534051_93_389 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

25

104

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8375 3 86
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8189 3 86
3brb-assembly2.cif.gz_B crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with adp 0.71 3 57
3mwb-assembly1.cif.gz_B the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.6998 2 72
6dzs-assembly1.cif.gz_B mycobacterial homoserine dehydrogenase thra in complex with nadp 0.6847 2 85
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8191 4 86 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8007 4 86 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7988 1 82 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7562 1 82 3.30.70.3090
3brbB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.71 3 57 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1G7HQU9-F1-model_v4 DUF4242 domain-containing protein 0.9816 1 93
AF-A0A369TIF7-F1-model_v4 DUF4242 domain-containing protein 0.9804 1 93
AF-A0A238XM26-F1-model_v4 DUF4242 domain-containing protein 0.9727 1 95
AF-B1ZTA8-F1-model_v4 DUF4242 domain-containing protein 0.9662 1 95
AF-A0A7Y2XFY1-F1-model_v4 DUF4242 domain-containing protein 0.9648 1 92

Feature Viewer

pLDDT pTM Quality
93.54 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map