F393038

General Info

Members Datasets Scaffolds Average Seq Length
296 182 592 304

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100021750|Ga0070674_1000217506
Length 347
Sequence MNPAAAVLASGRRGGVNVAPVLRSVCRMRLSRPIIRRRPPRAASGTAESATVANVRISHPGRLIFPDLGVTKVDLARYLERIADWILPHVAGRPLTLVHCPAGLAAPCNYLRHAKAWGPNALRRVRIQERTKVGEYLVADSIEAVVSLAQMGVVEIHTWNSIAEHVDRPNRLVWDLDPGPDVAWPQVVTAAKLVRDVLATLGLTSWVKTTGGRGLHVVVPLAPHRSVKACLDFSRAVAGAIEQTDSDAYTTAFPKAGRESKILIDYLRNNRTNTSVCAFSPRARPGAYVSMPLDWSELRDPPSRFTVVTAPRRLARLSRDPWKEYWTTEQELSDASIRAARAAGRAR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
122 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
162 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
163 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
166 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 3.38
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 15.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100021750 3300005356 Bacteria 4125
2 MBSR1b_contig_13734037 2162886012 Bacteria 1849
3 MBSR1b_contig_5185934 2162886012 Bacteria 1851
4 Ga0065715_10125574 3300005293 Bacteria 2127
5 Ga0070676_10095535 3300005328 Bacteria 1828
6 Ga0070683_100003650 3300005329 Bacteria 12541
7 Ga0070683_100258016 3300005329 Bacteria 1658
8 Ga0070670_100021473 3300005331 Bacteria 5553
9 Ga0070670_100049609 3300005331 Bacteria 3609
10 Ga0070677_10055988 3300005333 Bacteria 1611
11 Ga0068869_100102984 3300005334 Bacteria 2162
12 Ga0070666_10030052 3300005335 Bacteria 3577
13 Ga0070666_10279396 3300005335 Bacteria 1187
14 Ga0070680_100045400 3300005336 Bacteria 3572
15 Ga0068868_100057678 3300005338 Bacteria 3068
16 Ga0070660_100053138 3300005339 Bacteria 3124
17 Ga0070660_100204562 3300005339 Bacteria 1602
18 Ga0070689_100167796 3300005340 Bacteria 1777
19 Ga0070689_100313493 3300005340 Bacteria 1308
20 Ga0070691_10011441 3300005341 Bacteria 4052
21 Ga0070687_100002717 3300005343 Bacteria 6701
22 Ga0070687_100236688 3300005343 Bacteria 1127
23 Ga0070675_100107932 3300005354 Unclassified 2351
24 Ga0070671_100053423 3300005355 Bacteria 3359
25 Ga0070671_100057931 3300005355 Unclassified 3225
26 Ga0070671_100092137 3300005355 Bacteria 2539
27 Ga0070673_100002679 3300005364 Bacteria 10902
28 Ga0070673_100003589 3300005364 Bacteria 9693
29 Ga0070673_100062282 3300005364 Bacteria 2963
30 Ga0070673_100062892 3300005364 Bacteria 2951
31 Ga0070659_100096051 3300005366 Bacteria 2381
32 Ga0070667_100123930 3300005367 Bacteria 2251
33 Ga0070700_100116288 3300005441 Bacteria 1785
34 Ga0070662_100076859 3300005457 Unclassified 2476
35 Ga0070681_10058808 3300005458 Bacteria 3823
36 Ga0070681_10105241 3300005458 Bacteria 2764
37 Ga0070681_10424813 3300005458 Bacteria 1241
38 Ga0070707_100245117 3300005468 Bacteria 1744
39 Ga0070679_100002716 3300005530 Bacteria 16114
40 Ga0070679_100176875 3300005530 Bacteria 2107
41 Ga0070679_100372292 3300005530 Bacteria 1375
42 Ga0070679_100420596 3300005530 Bacteria 1282
43 Ga0070684_100001965 3300005535 Bacteria 15101
44 Ga0070684_100002933 3300005535 Bacteria 12682
45 Ga0070697_100194345 3300005536 Bacteria 1723
46 Ga0068853_100303719 3300005539 Bacteria 1476
47 Ga0070672_100043922 3300005543 Bacteria 3450
48 Ga0070672_100075188 3300005543 Bacteria 2696
49 Ga0070686_100000977 3300005544 Bacteria 16467
50 Ga0070686_100323051 3300005544 Bacteria 1151
51 Ga0070693_100079042 3300005547 Bacteria 1956
52 Ga0070665_100323698 3300005548 Bacteria 1546
53 Ga0070665_100383202 3300005548 Bacteria 1413
54 Ga0068855_100052774 3300005563 Bacteria 4785
55 Ga0068855_100144646 3300005563 Bacteria 2708
56 Ga0070664_100002291 3300005564 Bacteria 15388
57 Ga0070664_100013568 3300005564 Bacteria 6638
58 Ga0070664_100112070 3300005564 Unclassified 2382
59 Ga0068854_100005596 3300005578 Bacteria 7940
60 Ga0068854_100278418 3300005578 Bacteria 1346
61 Ga0070702_100037969 3300005615 Bacteria 2678
62 Ga0070702_100064892 3300005615 Bacteria 2137
63 Ga0070702_100268425 3300005615 Bacteria 1165
64 Ga0068859_100143278 3300005617 Bacteria 2463
65 Ga0068859_100207285 3300005617 Bacteria 2046
66 Ga0068859_100366041 3300005617 Bacteria 1537
67 Ga0068864_100035933 3300005618 Bacteria 4220
68 Ga0068864_100303499 3300005618 Bacteria 1495
69 Ga0068864_100581693 3300005618 Unclassified 1085
70 Ga0068861_100276654 3300005719 Bacteria 1444
71 Ga0068870_10123161 3300005840 Unclassified 1496
72 Ga0068863_100445134 3300005841 Unclassified 1271
73 Ga0068858_100011226 3300005842 Bacteria 8463
74 Ga0068858_100400022 3300005842 Bacteria 1319
75 Ga0068860_100122157 3300005843 Bacteria 2495
76 Ga0075365_10179323 3300006038 Bacteria 1481
77 Ga0075363_100004817 3300006048 Bacteria 5955
78 Ga0075364_10042672 3300006051 Bacteria 2947
79 Ga0075367_10007870 3300006178 Bacteria 5487
80 Ga0075367_10054286 3300006178 Bacteria 2376
81 Ga0068871_100080277 3300006358 Bacteria 2701
82 Ga0075428_100003525 3300006844 Bacteria 17140
83 Ga0075430_100035425 3300006846 Unclassified 4234
84 Ga0075430_100103151 3300006846 Bacteria 2381
85 Ga0075431_100093556 3300006847 Bacteria 3102
86 Ga0075433_10000267 3300006852 Bacteria 30611
87 Ga0075434_100000239 3300006871 Bacteria 38163
88 Ga0075434_100000928 3300006871 Bacteria 23534
89 Ga0075434_100004381 3300006871 Bacteria 12718
90 Ga0075434_100077549 3300006871 Unclassified 3318
91 Ga0075434_100097485 3300006871 Bacteria 2945
92 Ga0075434_100189146 3300006871 Bacteria 2079
93 Ga0075434_100264865 3300006871 Bacteria 1738
94 Ga0075434_100267098 3300006871 Bacteria 1730
95 Ga0075434_100508718 3300006871 Bacteria 1225
96 Ga0075434_100596098 3300006871 Unclassified 1124
97 Ga0075429_100031102 3300006880 Bacteria 4640
98 Ga0068865_100104296 3300006881 Bacteria 2081
99 Ga0075436_100004736 3300006914 Bacteria 9333
100 Ga0097620_100143279 3300006931 Bacteria 2463
101 Ga0097620_100207287 3300006931 Bacteria 2046
102 Ga0097620_100366048 3300006931 Bacteria 1537
103 Ga0075435_100000013 3300007076 Bacteria 106345
104 Ga0075435_100002637 3300007076 Bacteria 11948
105 Ga0075435_100022270 3300007076 Bacteria 4887
106 Ga0075435_100024652 3300007076 Bacteria 4671
107 Ga0075435_100060457 3300007076 Bacteria 3072
108 Ga0111539_10023035 3300009094 Bacteria 7649
109 Ga0111539_10034404 3300009094 Bacteria 6143
110 Ga0105245_10029439 3300009098 Bacteria 4852
111 Ga0105245_10461958 3300009098 Bacteria 1280
112 Ga0105247_10014860 3300009101 Unclassified 4667
113 Ga0114129_10024923 3300009147 Bacteria 8482
114 Ga0114129_10025512 3300009147 Bacteria 8375
115 Ga0114129_10150942 3300009147 Bacteria 3180
116 Ga0105243_10183050 3300009148 Bacteria 1824
117 Ga0105241_10034292 3300009174 Bacteria 3813
118 Ga0105248_10040804 3300009177 Bacteria 5203
119 Ga0105248_10049888 3300009177 Bacteria 4693
120 Ga0105248_10060708 3300009177 Bacteria 4245
121 Ga0105248_10192322 3300009177 Bacteria 2299
122 Ga0105238_10001197 3300009551 Bacteria 26159
123 Ga0105239_10121038 3300010375 Bacteria 2907
124 Ga0157378_10384899 3300013297 Bacteria 1378
125 Ga0157375_10159793 3300013308 Bacteria 2395
126 Ga0157375_10243594 3300013308 Bacteria 1958
127 Ga0157375_10614003 3300013308 Unclassified 1246
128 Ga0163163_10016168 3300014325 Bacteria 6927
129 Ga0163163_10051338 3300014325 Bacteria 4066
130 Ga0163163_10067487 3300014325 Unclassified 3556
131 Ga0163163_10094275 3300014325 Unclassified 3011
132 Ga0163163_10587007 3300014325 Unclassified 1177
133 Ga0157377_10011269 3300014745 Bacteria 4457
134 Ga0157379_10134157 3300014968 Bacteria 2230
135 Ga0157379_10239755 3300014968 Bacteria 1645
136 Ga0207697_10014634 3300025315 Bacteria 3252
137 Ga0207682_10039232 3300025893 Bacteria 1924
138 Ga0207642_10052881 3300025899 Bacteria 1845
139 Ga0207688_10079070 3300025901 Bacteria 1875
140 Ga0207688_10101187 3300025901 Bacteria 1664
141 Ga0207680_10006599 3300025903 Bacteria 5625
142 Ga0207680_10111062 3300025903 Bacteria 1778
143 Ga0207680_10199079 3300025903 Bacteria 1364
144 Ga0207645_10010811 3300025907 Bacteria 6254
145 Ga0207645_10103321 3300025907 Bacteria 1840
146 Ga0207707_10345911 3300025912 Bacteria 1282
147 Ga0207660_10046123 3300025917 Bacteria 3074
148 Ga0207662_10007722 3300025918 Bacteria 5861
149 Ga0207657_10016876 3300025919 Bacteria 7026
150 Ga0207652_10087847 3300025921 Bacteria 2726
151 Ga0207652_10284858 3300025921 Bacteria 1491
152 Ga0207652_10324975 3300025921 Bacteria 1389
153 Ga0207681_10170435 3300025923 Unclassified 1649
154 Ga0207681_10308739 3300025923 Bacteria 1254
155 Ga0207650_10022980 3300025925 Unclassified 4418
156 Ga0207650_10043820 3300025925 Bacteria 3286
157 Ga0207650_10143794 3300025925 Unclassified 1877
158 Ga0207650_10384495 3300025925 Unclassified 1159
159 Ga0207659_10011789 3300025926 Bacteria 5533
160 Ga0207659_10039221 3300025926 Bacteria 3301
161 Ga0207659_10083008 3300025926 Unclassified 2374
162 Ga0207659_10155933 3300025926 Bacteria 1788
163 Ga0207644_10025276 3300025931 Bacteria 4083
164 Ga0207644_10203456 3300025931 Bacteria 1562
165 Ga0207690_10310435 3300025932 Bacteria 1237
166 Ga0207706_10047730 3300025933 Bacteria 3788
167 Ga0207706_10138655 3300025933 Bacteria 2139
168 Ga0207670_10029646 3300025936 Bacteria 3488
169 Ga0207670_10048466 3300025936 Bacteria 2835
170 Ga0207669_10043321 3300025937 Bacteria 2635
171 Ga0207669_10249926 3300025937 Bacteria 1320
172 Ga0207691_10061413 3300025940 Bacteria 3414
173 Ga0207691_10099466 3300025940 Bacteria 2597
174 Ga0207711_10030540 3300025941 Bacteria 4545
175 Ga0207711_10062069 3300025941 Bacteria 3223
176 Ga0207711_10097764 3300025941 Bacteria 2592
177 Ga0207689_10082224 3300025942 Bacteria 2648
178 Ga0207661_10006787 3300025944 Bacteria 8109
179 Ga0207661_10013379 3300025944 Bacteria 5993
180 Ga0207679_10007076 3300025945 Bacteria 7113
181 Ga0207679_10044222 3300025945 Bacteria 3212
182 Ga0207667_10312669 3300025949 Bacteria 1604
183 Ga0207651_10002425 3300025960 Bacteria 8911
184 Ga0207651_10004777 3300025960 Bacteria 6889
185 Ga0207651_10165884 3300025960 Bacteria 1736
186 Ga0207640_10018070 3300025981 Bacteria 4137
187 Ga0207640_10038252 3300025981 Bacteria 3026
188 Ga0207640_10040213 3300025981 Bacteria 2964
189 Ga0207640_10286994 3300025981 Bacteria 1296
190 Ga0207658_10077531 3300025986 Unclassified 2536
191 Ga0207703_10125720 3300026035 Bacteria 2207
192 Ga0207703_10169288 3300026035 Bacteria 1920
193 Ga0207639_10170546 3300026041 Bacteria 1842
194 Ga0207678_10058701 3300026067 Bacteria 3311
195 Ga0207708_10033901 3300026075 Bacteria 3882
196 Ga0207676_10164105 3300026095 Unclassified 1928
197 Ga0207675_100043323 3300026118 Bacteria 4203
198 Ga0207675_100122835 3300026118 Bacteria 2458
199 Ga0207675_100220312 3300026118 Unclassified 1828
200 Ga0207675_100233171 3300026118 Bacteria 1776
201 Ga0209974_10030978 3300027876 Bacteria 1771
202 Ga0207428_10059218 3300027907 Bacteria 3037
203 Ga0268266_10350293 3300028379 Bacteria 1388
204 Ga0307408_100068536 3300031548 Unclassified 2613
205 Ga0307413_10061128 3300031824 Unclassified 2323
206 Ga0307410_10179370 3300031852 Unclassified 1602
207 Ga0307406_10023081 3300031901 Unclassified 3699
208 Ga0307407_10085965 3300031903 Unclassified 1915
209 Ga0307407_10303200 3300031903 Bacteria 1115
210 Ga0307412_10173049 3300031911 Bacteria 1616
211 Ga0307412_10219756 3300031911 Bacteria 1456
212 Ga0307409_100020138 3300031995 Bacteria 4539
213 Ga0307409_100085484 3300031995 Unclassified 2564
214 Ga0307416_100013146 3300032002 Bacteria 5615
215 Ga0307416_100300815 3300032002 Unclassified 1594
216 Ga0307416_100341993 3300032002 Unclassified 1509
217 Ga0307416_100542553 3300032002 Unclassified 1235
218 Ga0307414_10077802 3300032004 Unclassified 2416
219 Ga0307415_100038804 3300032126 Bacteria 3142
220 Ga0307415_100226667 3300032126 Bacteria 1502
221 Ga0373948_0001194 3300034817 Bacteria 3534
222 Ga0373958_0002508 3300034819 Bacteria 2583
223 Ga0373938_0000165 3300034957 Bacteria 9614
224 Ga0373928_0000193 3300035084 Bacteria 11706
225 Ga0373929_0000350 3300035085 Bacteria 8597
226 Ga0373940_0051839 3300035088 Bacteria 1155
227 Ga0373949_0002871 3300035090 Bacteria 4254
228 Ga0373951_0001039 3300035091 Bacteria 7465
229 Ga0373952_0001393 3300035092 Bacteria 4419
230 Ga0373936_0074904 3300035113 Bacteria 1401
231 Ga0373939_0001936 3300035114 Bacteria 4951
232 Ga0373941_0000980 3300035115 Bacteria 5915
233 Ga0373960_0000066 3300035121 Bacteria 14802
234 Ga0373942_0001218 3300035207 Bacteria 6773
235 Ga0373961_0007105 3300035241 Bacteria 2699
236 Ga0373962_0002845 3300035242 Bacteria 4141
237 Ga0373931_0000370 3300035691 Bacteria 18463
238 Ga0451853_1348633 3300041512 Unclassified 1675
239 Ga0439449_0125102 3300042007 Unclassified 955
240 Ga0439435_0034252 3300042436 Bacteria 1395
241 Ga0439444_0001631 3300042437 Bacteria 2957
242 Ga0439460_0067175 3300042461 Bacteria 1104
243 Ga0466957_0405266 3300044842 Bacteria 933
244 Ga0451576_0017531 3300045051 Bacteria 7872
245 Ga0495592_0105431 3300046454 Bacteria 2003
246 Ga0495590_0022732 3300046457 Unclassified 2217
247 Ga0495638_0126837 3300046460 Bacteria 1503
248 Ga0495651_0069191 3300046462 Bacteria 2689
249 Ga0495659_0012977 3300046664 Bacteria 2708
250 Ga0496102_0099910 3300048905 Bacteria 2694
251 Ga0496103_0163808 3300048906 Bacteria 1427
252 Ga0496104_0000830 3300048907 Bacteria 26651
253 Ga0496106_0085895 3300048909 Bacteria 2423
254 Ga0496108_0001041 3300048911 Bacteria 21629
255 Ga0496109_0004852 3300048912 Bacteria 11224
256 Ga0496110_0002605 3300048913 Bacteria 13566
257 Ga0496111_0274907 3300048914 Bacteria 1249
258 Ga0496112_0000626 3300048915 Bacteria 24545
259 Ga0496113_0098651 3300048916 Bacteria 2262
260 Ga0501070_0426418 3300049586 Bacteria 1071
261 Ga0501077_0037184 3300049593 Bacteria 3102
262 Ga0501201_008556 3300049651 Unclassified 990
263 Ga0501202_000705 3300049652 Unclassified 4984
264 Ga0501216_002787 3300049660 Unclassified 2508
265 Ga0501224_003391 3300049664 Unclassified 2220
266 Ga0501247_000736 3300049677 Unclassified 2807
267 Ga0501259_005315 3300049688 Unclassified 2037
268 Ga0501225_0004257 3300049705 Unclassified 4276
269 Ga0501080_0039258 3300049742 Bacteria 4419
270 Ga0501268_001188 3300049765 Unclassified 3165
271 Ga0501045_0138893 3300049824 Bacteria 1807
272 nmdc:mga0yw44_271512_c1 3300050492 Bacteria 1132
273 nmdc:mga0k408_31983_c1 3300050493 Bacteria 3006
274 nmdc:mga06z11_37481_c1 3300050494 Bacteria 2401
275 nmdc:mga05p37_152507_c1 3300050507 Bacteria 2825
276 nmdc:mga0qj67_108441_c1 3300050509 Bacteria 2240
277 nmdc:mga0qj67_215117_c1 3300050509 Unclassified 1560
278 nmdc:mga06r32_18696_c1 3300050510 Bacteria 6349
279 nmdc:mga08y16_104726_c1 3300050511 Bacteria 2945
280 nmdc:mga08y16_73796_c1 3300050511 Bacteria 3554
281 nmdc:mga0n895_255512_c1 3300050512 Bacteria 1778
282 nmdc:mga0n895_347646_c1 3300050512 Bacteria 1502
283 nmdc:mga0n895_72_c1 3300050512 Bacteria 58012
284 nmdc:mga0n895_74446_c1 3300050512 Bacteria 3373
285 nmdc:mga0rr50_13184_c1 3300050513 Bacteria 5373
286 nmdc:mga0rr50_20442_c1 3300050513 Bacteria 4497
287 nmdc:mga0rr50_207764_c1 3300050513 Bacteria 1612
288 nmdc:mga0rr50_57686_c1 3300050513 Bacteria 2906
289 nmdc:mga0rr50_96754_c1 3300050513 Bacteria 2310
290 nmdc:mga0rr50_99689_c1 3300050513 Bacteria 2280
291 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
292 nmdc:mga08x19_34744_c1 3300050514 Bacteria 3187
293 nmdc:mga08x19_3526_c1 3300050514 Bacteria 9309
294 nmdc:mga0a205_127377_c1 3300050515 Bacteria 2446
295 nmdc:mga0a205_3733_c1 3300050515 Bacteria 13636
296 Ga0501084_0017354 3300054114 Bacteria 5982
297 Ga0070674_100021750
298 MBSR1b_contig_13734037
299 MBSR1b_contig_5185934
300 Ga0065715_10125574
301 Ga0070676_10095535
302 Ga0070683_100003650
303 Ga0070683_100258016
304 Ga0070670_100021473
305 Ga0070670_100049609
306 Ga0070677_10055988
307 Ga0068869_100102984
308 Ga0070666_10030052
309 Ga0070666_10279396
310 Ga0070680_100045400
311 Ga0068868_100057678
312 Ga0070660_100053138
313 Ga0070660_100204562
314 Ga0070689_100167796
315 Ga0070689_100313493
316 Ga0070691_10011441
317 Ga0070687_100002717
318 Ga0070687_100236688
319 Ga0070675_100107932
320 Ga0070671_100053423
321 Ga0070671_100057931
322 Ga0070671_100092137
323 Ga0070673_100002679
324 Ga0070673_100003589
325 Ga0070673_100062282
326 Ga0070673_100062892
327 Ga0070659_100096051
328 Ga0070667_100123930
329 Ga0070700_100116288
330 Ga0070662_100076859
331 Ga0070681_10058808
332 Ga0070681_10105241
333 Ga0070681_10424813
334 Ga0070707_100245117
335 Ga0070679_100002716
336 Ga0070679_100176875
337 Ga0070679_100372292
338 Ga0070679_100420596
339 Ga0070684_100001965
340 Ga0070684_100002933
341 Ga0070697_100194345
342 Ga0068853_100303719
343 Ga0070672_100043922
344 Ga0070672_100075188
345 Ga0070686_100000977
346 Ga0070686_100323051
347 Ga0070693_100079042
348 Ga0070665_100323698
349 Ga0070665_100383202
350 Ga0068855_100052774
351 Ga0068855_100144646
352 Ga0070664_100002291
353 Ga0070664_100013568
354 Ga0070664_100112070
355 Ga0068854_100005596
356 Ga0068854_100278418
357 Ga0070702_100037969
358 Ga0070702_100064892
359 Ga0070702_100268425
360 Ga0068859_100143278
361 Ga0068859_100207285
362 Ga0068859_100366041
363 Ga0068864_100035933
364 Ga0068864_100303499
365 Ga0068864_100581693
366 Ga0068861_100276654
367 Ga0068870_10123161
368 Ga0068863_100445134
369 Ga0068858_100011226
370 Ga0068858_100400022
371 Ga0068860_100122157
372 Ga0075365_10179323
373 Ga0075363_100004817
374 Ga0075364_10042672
375 Ga0075367_10007870
376 Ga0075367_10054286
377 Ga0068871_100080277
378 Ga0075428_100003525
379 Ga0075430_100035425
380 Ga0075430_100103151
381 Ga0075431_100093556
382 Ga0075433_10000267
383 Ga0075434_100000239
384 Ga0075434_100000928
385 Ga0075434_100004381
386 Ga0075434_100077549
387 Ga0075434_100097485
388 Ga0075434_100189146
389 Ga0075434_100264865
390 Ga0075434_100267098
391 Ga0075434_100508718
392 Ga0075434_100596098
393 Ga0075429_100031102
394 Ga0068865_100104296
395 Ga0075436_100004736
396 Ga0097620_100143279
397 Ga0097620_100207287
398 Ga0097620_100366048
399 Ga0075435_100000013
400 Ga0075435_100002637
401 Ga0075435_100022270
402 Ga0075435_100024652
403 Ga0075435_100060457
404 Ga0111539_10023035
405 Ga0111539_10034404
406 Ga0105245_10029439
407 Ga0105245_10461958
408 Ga0105247_10014860
409 Ga0114129_10024923
410 Ga0114129_10025512
411 Ga0114129_10150942
412 Ga0105243_10183050
413 Ga0105241_10034292
414 Ga0105248_10040804
415 Ga0105248_10049888
416 Ga0105248_10060708
417 Ga0105248_10192322
418 Ga0105238_10001197
419 Ga0105239_10121038
420 Ga0157378_10384899
421 Ga0157375_10159793
422 Ga0157375_10243594
423 Ga0157375_10614003
424 Ga0163163_10016168
425 Ga0163163_10051338
426 Ga0163163_10067487
427 Ga0163163_10094275
428 Ga0163163_10587007
429 Ga0157377_10011269
430 Ga0157379_10134157
431 Ga0157379_10239755
432 Ga0207697_10014634
433 Ga0207682_10039232
434 Ga0207642_10052881
435 Ga0207688_10079070
436 Ga0207688_10101187
437 Ga0207680_10006599
438 Ga0207680_10111062
439 Ga0207680_10199079
440 Ga0207645_10010811
441 Ga0207645_10103321
442 Ga0207707_10345911
443 Ga0207660_10046123
444 Ga0207662_10007722
445 Ga0207657_10016876
446 Ga0207652_10087847
447 Ga0207652_10284858
448 Ga0207652_10324975
449 Ga0207681_10170435
450 Ga0207681_10308739
451 Ga0207650_10022980
452 Ga0207650_10043820
453 Ga0207650_10143794
454 Ga0207650_10384495
455 Ga0207659_10011789
456 Ga0207659_10039221
457 Ga0207659_10083008
458 Ga0207659_10155933
459 Ga0207644_10025276
460 Ga0207644_10203456
461 Ga0207690_10310435
462 Ga0207706_10047730
463 Ga0207706_10138655
464 Ga0207670_10029646
465 Ga0207670_10048466
466 Ga0207669_10043321
467 Ga0207669_10249926
468 Ga0207691_10061413
469 Ga0207691_10099466
470 Ga0207711_10030540
471 Ga0207711_10062069
472 Ga0207711_10097764
473 Ga0207689_10082224
474 Ga0207661_10006787
475 Ga0207661_10013379
476 Ga0207679_10007076
477 Ga0207679_10044222
478 Ga0207667_10312669
479 Ga0207651_10002425
480 Ga0207651_10004777
481 Ga0207651_10165884
482 Ga0207640_10018070
483 Ga0207640_10038252
484 Ga0207640_10040213
485 Ga0207640_10286994
486 Ga0207658_10077531
487 Ga0207703_10125720
488 Ga0207703_10169288
489 Ga0207639_10170546
490 Ga0207678_10058701
491 Ga0207708_10033901
492 Ga0207676_10164105
493 Ga0207675_100043323
494 Ga0207675_100122835
495 Ga0207675_100220312
496 Ga0207675_100233171
497 Ga0209974_10030978
498 Ga0207428_10059218
499 Ga0268266_10350293
500 Ga0307408_100068536
501 Ga0307413_10061128
502 Ga0307410_10179370
503 Ga0307406_10023081
504 Ga0307407_10085965
505 Ga0307407_10303200
506 Ga0307412_10173049
507 Ga0307412_10219756
508 Ga0307409_100020138
509 Ga0307409_100085484
510 Ga0307416_100013146
511 Ga0307416_100300815
512 Ga0307416_100341993
513 Ga0307416_100542553
514 Ga0307414_10077802
515 Ga0307415_100038804
516 Ga0307415_100226667
517 Ga0373948_0001194
518 Ga0373958_0002508
519 Ga0373938_0000165
520 Ga0373928_0000193
521 Ga0373929_0000350
522 Ga0373940_0051839
523 Ga0373949_0002871
524 Ga0373951_0001039
525 Ga0373952_0001393
526 Ga0373936_0074904
527 Ga0373939_0001936
528 Ga0373941_0000980
529 Ga0373960_0000066
530 Ga0373942_0001218
531 Ga0373961_0007105
532 Ga0373962_0002845
533 Ga0373931_0000370
534 Ga0451853_1348633
535 Ga0439449_0125102
536 Ga0439435_0034252
537 Ga0439444_0001631
538 Ga0439460_0067175
539 Ga0466957_0405266
540 Ga0451576_0017531
541 Ga0495592_0105431
542 Ga0495590_0022732
543 Ga0495638_0126837
544 Ga0495651_0069191
545 Ga0495659_0012977
546 Ga0496102_0099910
547 Ga0496103_0163808
548 Ga0496104_0000830
549 Ga0496106_0085895
550 Ga0496108_0001041
551 Ga0496109_0004852
552 Ga0496110_0002605
553 Ga0496111_0274907
554 Ga0496112_0000626
555 Ga0496113_0098651
556 Ga0501070_0426418
557 Ga0501077_0037184
558 Ga0501201_008556
559 Ga0501202_000705
560 Ga0501216_002787
561 Ga0501224_003391
562 Ga0501247_000736
563 Ga0501259_005315
564 Ga0501225_0004257
565 Ga0501080_0039258
566 Ga0501268_001188
567 Ga0501045_0138893
568 nmdc:mga0yw44_271512_c1
569 nmdc:mga0k408_31983_c1
570 nmdc:mga06z11_37481_c1
571 nmdc:mga05p37_152507_c1
572 nmdc:mga0qj67_108441_c1
573 nmdc:mga0qj67_215117_c1
574 nmdc:mga06r32_18696_c1
575 nmdc:mga08y16_104726_c1
576 nmdc:mga08y16_73796_c1
577 nmdc:mga0n895_255512_c1
578 nmdc:mga0n895_347646_c1
579 nmdc:mga0n895_72_c1
580 nmdc:mga0n895_74446_c1
581 nmdc:mga0rr50_13184_c1
582 nmdc:mga0rr50_20442_c1
583 nmdc:mga0rr50_207764_c1
584 nmdc:mga0rr50_57686_c1
585 nmdc:mga0rr50_96754_c1
586 nmdc:mga0rr50_99689_c1
587 nmdc:mga0rr50_9_c1
588 nmdc:mga08x19_34744_c1
589 nmdc:mga08x19_3526_c1
590 nmdc:mga0a205_127377_c1
591 nmdc:mga0a205_3733_c1
592 Ga0501084_0017354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

71

322

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.9327 2 289
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9152 3 284
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9105 2 295
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.9084 2 289
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9018 2 295
ID Description Score Start End Superfamily
2faqB01 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9229 12 289 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9217 12 290 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9139 12 288 3.90.920.10
2faqB01 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9073 12 289 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9062 12 290 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A150RA43-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.975 13 290 GO:0005524
GO:0046872
AF-A0A534RFW5-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) 0.9739 1 292 GO:0003677
GO:0003887
GO:0003910
GO:0004527
GO:0005524
GO:0006281
GO:0006310
GO:0046872
AF-A0A534PWY6-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) 0.9739 1 221 GO:0003677
GO:0003887
GO:0003910
GO:0004527
GO:0005524
GO:0006281
GO:0006310
GO:0046872
AF-A0A177QYJ5-F1-model_v4 deleted 0.9725 5 294
AF-A0A850BKU3-F1-model_v4 DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) 0.9718 1 290 GO:0003677
GO:0003887
GO:0003910
GO:0004527
GO:0005524
GO:0006281
GO:0006310
GO:0046872

Map