F392730

General Info

Members Datasets Scaffolds Average Seq Length
295 164 590 243

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100252648|Ga0307409_1002526481
Length 266
Sequence LAFVNGSGCPQPIPGFGPSLALMEPIQLAVIAAIFVVAVLYSSVGHGGASGYLAVMAFWAVAPEVTRPTALVLNLFVASIATWQFWRSGHFSWRLFWPFAVTSIPFAFIGGMIKLPTHVYKIVLGLVLLFAAFRLAWSFAQEVPEVRRPAIWMALLIGAGIGLLSGLVGVGGGIFLTPVLLLMNWSETKTAAGVSALFIFVNSAAGLAGNYAQVSILPASSVAWITAAIAGGALGSLLGAKKFRSLMLRRVLAAVLLMAAVKLIFV

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
152 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
156 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 1.69
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100252648 3300031995 Bacteria 1613
2 LJQas_1000080 3300000549 Bacteria 16081
3 rootH1_10004529 3300003323 Bacteria 5233
4 rootH1_10230873 3300003323 Unclassified 2032
5 JGI25160J50197_1015224 3300003354 Unclassified 2534
6 Ga0065704_10096455 3300005289 Bacteria 2440
7 Ga0065715_10019927 3300005293 Bacteria 1884
8 Ga0070676_10316423 3300005328 Bacteria 1063
9 Ga0070677_10000162 3300005333 Bacteria 22856
10 Ga0070677_10017991 3300005333 Bacteria 2540
11 Ga0068869_100002047 3300005334 Bacteria 12111
12 Ga0068869_100234294 3300005334 Bacteria 1460
13 Ga0070666_10023860 3300005335 Bacteria 3982
14 Ga0068868_100000094 3300005338 Bacteria 54756
15 Ga0068868_100016640 3300005338 Bacteria 5468
16 Ga0068868_100027049 3300005338 Bacteria 4374
17 Ga0070660_100000131 3300005339 Bacteria 47332
18 Ga0070692_10000049 3300005345 Bacteria 22402
19 Ga0070675_100004552 3300005354 Bacteria 10586
20 Ga0070675_100059025 3300005354 Unclassified 3164
21 Ga0070671_100021340 3300005355 Bacteria 5290
22 Ga0070671_100550009 3300005355 Bacteria 995
23 Ga0070671_100785080 3300005355 Unclassified 829
24 Ga0070671_101224430 3300005355 Bacteria 661
25 Ga0070674_100284525 3300005356 Bacteria 1312
26 Ga0070673_100211484 3300005364 Bacteria 1675
27 Ga0070659_100000010 3300005366 Bacteria 188277
28 Ga0070659_100587221 3300005366 Bacteria 956
29 Ga0070667_100017300 3300005367 Bacteria 5974
30 Ga0070708_100001993 3300005445 Bacteria 15723
31 Ga0070708_100140337 3300005445 Bacteria 2240
32 Ga0070663_100263802 3300005455 Unclassified 1367
33 Ga0070681_10521884 3300005458 Unclassified 1101
34 Ga0068867_100003479 3300005459 Bacteria 11069
35 Ga0070685_10030264 3300005466 Bacteria 3015
36 Ga0070685_10312844 3300005466 Bacteria 1062
37 Ga0070706_100018802 3300005467 Bacteria 6371
38 Ga0070707_100049498 3300005468 Bacteria 4028
39 Ga0070698_100003079 3300005471 Bacteria 18384
40 Ga0070699_100004639 3300005518 Bacteria 12162
41 Ga0068853_100001859 3300005539 Bacteria 15511
42 Ga0070672_100186763 3300005543 Bacteria 1729
43 Ga0070696_100149676 3300005546 Bacteria 1712
44 Ga0070693_100478568 3300005547 Bacteria 879
45 Ga0070704_100272897 3300005549 Unclassified 1398
46 Ga0070664_100435789 3300005564 Bacteria 1202
47 Ga0070664_100680783 3300005564 Bacteria 957
48 Ga0068852_100373391 3300005616 Bacteria 1397
49 Ga0068859_100007923 3300005617 Bacteria 10774
50 Ga0068859_100030389 3300005617 Bacteria 5421
51 Ga0068859_100452878 3300005617 Unclassified 1379
52 Ga0068859_100559284 3300005617 Bacteria 1238
53 Ga0068864_100020711 3300005618 Bacteria 5504
54 Ga0068861_100055500 3300005719 Bacteria 3021
55 Ga0068861_100116293 3300005719 Unclassified 2150
56 Ga0068861_100629900 3300005719 Bacteria 988
57 Ga0068851_10000441 3300005834 Bacteria 18529
58 Ga0068870_10096889 3300005840 Bacteria 1659
59 Ga0068863_100277413 3300005841 Bacteria 1623
60 Ga0068863_100380087 3300005841 Unclassified 1379
61 Ga0068863_100510547 3300005841 Unclassified 1184
62 Ga0068858_100466336 3300005842 Unclassified 1218
63 Ga0068860_100003179 3300005843 Bacteria 16941
64 Ga0068860_100008300 3300005843 Bacteria 10335
65 Ga0068860_100036896 3300005843 Bacteria 4680
66 Ga0068860_100053871 3300005843 Bacteria 3824
67 Ga0068862_100103572 3300005844 Bacteria 2492
68 Ga0068862_100158864 3300005844 Bacteria 2016
69 Ga0097621_100005762 3300006237 Bacteria 8744
70 Ga0097621_100217159 3300006237 Unclassified 1665
71 Ga0097621_100303200 3300006237 Bacteria 1411
72 Ga0068871_100000595 3300006358 Bacteria 24865
73 Ga0068871_100047845 3300006358 Bacteria 3450
74 Ga0075428_100170294 3300006844 Bacteria 2361
75 Ga0075433_10017345 3300006852 Bacteria 5962
76 Ga0075434_100022334 3300006871 Bacteria 6163
77 Ga0068865_100002044 3300006881 Bacteria 11915
78 Ga0068865_100036437 3300006881 Bacteria 3317
79 Ga0097620_100007924 3300006931 Bacteria 10774
80 Ga0097620_100030392 3300006931 Bacteria 5421
81 Ga0097620_100452871 3300006931 Unclassified 1379
82 Ga0097620_100559257 3300006931 Bacteria 1238
83 Ga0111539_10051247 3300009094 Bacteria 4916
84 Ga0105245_10186955 3300009098 Bacteria 1982
85 Ga0105245_10559603 3300009098 Bacteria 1166
86 Ga0114129_10030303 3300009147 Bacteria 7657
87 Ga0105242_10004228 3300009176 Bacteria 11195
88 Ga0105248_10638510 3300009177 Bacteria 1201
89 Ga0105237_10012410 3300009545 Bacteria 8981
90 Ga0105237_10057615 3300009545 Bacteria 3887
91 Ga0105249_10006415 3300009553 Bacteria 10230
92 Ga0105249_10021568 3300009553 Bacteria 5768
93 Ga0105249_10090392 3300009553 Bacteria 2863
94 Ga0105249_10454870 3300009553 Unclassified 1319
95 Ga0105239_10019676 3300010375 Bacteria 7451
96 Ga0105239_10037118 3300010375 Bacteria 5345
97 Ga0157373_10065138 3300013100 Bacteria 2579
98 Ga0157373_10226124 3300013100 Bacteria 1321
99 Ga0157371_10004349 3300013102 Bacteria 12407
100 Ga0157370_10028501 3300013104 Bacteria 5491
101 Ga0157369_10306035 3300013105 Bacteria 1653
102 Ga0157378_10005475 3300013297 Bacteria 11124
103 Ga0157378_10659278 3300013297 Bacteria 1063
104 Ga0163162_10237452 3300013306 Bacteria 1953
105 Ga0163162_10303061 3300013306 Bacteria 1730
106 Ga0157372_10098084 3300013307 Bacteria 3343
107 Ga0157372_10601958 3300013307 Bacteria 1281
108 Ga0157375_10000094 3300013308 Bacteria 88991
109 Ga0157375_10024933 3300013308 Bacteria 5545
110 Ga0157375_10167931 3300013308 Bacteria 2340
111 Ga0157375_10227933 3300013308 Bacteria 2022
112 Ga0163163_10069588 3300014325 Bacteria 3504
113 Ga0163163_10160333 3300014325 Bacteria 2295
114 Ga0157380_10113974 3300014326 Unclassified 2277
115 Ga0157379_10180533 3300014968 Bacteria 1907
116 Ga0157376_10666055 3300014969 Bacteria 1043
117 Ga0182005_1086326 3300015265 Bacteria 870
118 Ga0163161_10028250 3300017792 Bacteria 3982
119 Ga0213876_10001100 3300021384 Bacteria 17303
120 Ga0207426_1000030 3300025302 Bacteria 461478
121 Ga0207656_10000252 3300025321 Bacteria 18555
122 Ga0207682_10001303 3300025893 Bacteria 11447
123 Ga0207682_10023460 3300025893 Bacteria 2437
124 Ga0207680_10008676 3300025903 Bacteria 5003
125 Ga0207643_10077341 3300025908 Unclassified 1924
126 Ga0207643_10159693 3300025908 Bacteria 1356
127 Ga0207684_10022290 3300025910 Bacteria 5407
128 Ga0207707_10505708 3300025912 Unclassified 1030
129 Ga0207657_10000451 3300025919 Bacteria 43679
130 Ga0207649_10075279 3300025920 Bacteria 2169
131 Ga0207646_10108436 3300025922 Bacteria 2491
132 Ga0207650_10017917 3300025925 Bacteria 4963
133 Ga0207650_10020809 3300025925 Unclassified 4632
134 Ga0207650_10137611 3300025925 Bacteria 1917
135 Ga0207659_10000998 3300025926 Bacteria 16820
136 Ga0207687_10070563 3300025927 Bacteria 2494
137 Ga0207687_10216552 3300025927 Unclassified 1505
138 Ga0207644_10170489 3300025931 Unclassified 1699
139 Ga0207644_10566489 3300025931 Bacteria 941
140 Ga0207690_10000227 3300025932 Bacteria 42282
141 Ga0207686_10108757 3300025934 Bacteria 1866
142 Ga0207670_10019952 3300025936 Bacteria 4107
143 Ga0207669_10246163 3300025937 Bacteria 1328
144 Ga0207704_10024656 3300025938 Bacteria 3267
145 Ga0207691_10105137 3300025940 Bacteria 2515
146 Ga0207711_10002511 3300025941 Bacteria 16351
147 Ga0207689_10004858 3300025942 Bacteria 12111
148 Ga0207689_10086402 3300025942 Bacteria 2578
149 Ga0207679_10253846 3300025945 Bacteria 1496
150 Ga0207667_10205835 3300025949 Bacteria 2017
151 Ga0207651_10639657 3300025960 Unclassified 933
152 Ga0207712_10020117 3300025961 Bacteria 4369
153 Ga0207712_10160063 3300025961 Bacteria 1749
154 Ga0207658_10169634 3300025986 Bacteria 1797
155 Ga0207658_10286459 3300025986 Bacteria 1414
156 Ga0207677_10000088 3300026023 Bacteria 76235
157 Ga0207677_10000131 3300026023 Bacteria 61645
158 Ga0207677_10000552 3300026023 Bacteria 23659
159 Ga0207677_10058688 3300026023 Bacteria 2651
160 Ga0207703_10059221 3300026035 Bacteria 3128
161 Ga0207703_10114724 3300026035 Bacteria 2304
162 Ga0207641_10058346 3300026088 Bacteria 3284
163 Ga0207648_10004944 3300026089 Bacteria 13561
164 Ga0207676_10014023 3300026095 Bacteria 5754
165 Ga0207675_100105274 3300026118 Bacteria 2659
166 Ga0207698_10078697 3300026142 Bacteria 2648
167 Ga0207698_10106985 3300026142 Bacteria 2334
168 Ga0209967_1005458 3300027364 Bacteria 1706
169 Ga0209995_1005488 3300027471 Bacteria 2035
170 Ga0209999_1003428 3300027543 Bacteria 2834
171 Ga0209970_1011812 3300027614 Unclassified 1440
172 Ga0209971_1004336 3300027682 Bacteria 3368
173 Ga0268265_10099830 3300028380 Bacteria 2341
174 Ga0268265_10231569 3300028380 Bacteria 1624
175 Ga0268265_10502286 3300028380 Unclassified 1143
176 Ga0268264_10005228 3300028381 Bacteria 10989
177 Ga0268264_10049811 3300028381 Bacteria 3486
178 Ga0268264_10089102 3300028381 Bacteria 2656
179 Ga0268264_10598874 3300028381 Unclassified 1086
180 Ga0265338_10057374 3300028800 Bacteria 3445
181 Ga0265327_10000037 3300031251 Bacteria 293502
182 Ga0307408_100000007 3300031548 Bacteria 463086
183 Ga0307408_100058815 3300031548 Unclassified 2796
184 Ga0307408_100110219 3300031548 Bacteria 2113
185 Ga0307408_100148046 3300031548 Bacteria 1851
186 Ga0307408_100237768 3300031548 Unclassified 1495
187 Ga0316579_10023594 3300031691 Bacteria 2763
188 Ga0316576_10411687 3300031727 Bacteria 1001
189 Ga0316578_10000060 3300031728 Bacteria 23565
190 Ga0307405_10016993 3300031731 Bacteria 3983
191 Ga0307405_10040978 3300031731 Bacteria 2808
192 Ga0307405_10156771 3300031731 Bacteria 1608
193 Ga0307405_10344231 3300031731 Unclassified 1147
194 Ga0307405_10445873 3300031731 Unclassified 1025
195 Ga0316577_10000556 3300031733 Bacteria 15190
196 Ga0316577_10001980 3300031733 Bacteria 9968
197 Ga0307413_10008802 3300031824 Bacteria 4791
198 Ga0307413_10042316 3300031824 Bacteria 2676
199 Ga0307413_10196311 3300031824 Bacteria 1453
200 Ga0307413_10236530 3300031824 Bacteria 1345
201 Ga0307413_10367917 3300031824 Unclassified 1115
202 Ga0307413_10527422 3300031824 Bacteria 953
203 Ga0307410_10000001 3300031852 Bacteria 162839
204 Ga0307410_10013777 3300031852 Bacteria 4731
205 Ga0307410_10018390 3300031852 Bacteria 4223
206 Ga0307410_10043482 3300031852 Unclassified 2977
207 Ga0307410_10243597 3300031852 Bacteria 1394
208 Ga0307410_10442392 3300031852 Unclassified 1059
209 Ga0307410_10459563 3300031852 Unclassified 1040
210 Ga0307406_10003114 3300031901 Bacteria 9015
211 Ga0307406_10061138 3300031901 Bacteria 2432
212 Ga0307406_10061436 3300031901 Bacteria 2426
213 Ga0307407_10001569 3300031903 Bacteria 8403
214 Ga0307407_10001590 3300031903 Bacteria 8372
215 Ga0307407_10012059 3300031903 Unclassified 4142
216 Ga0307407_10017336 3300031903 Bacteria 3610
217 Ga0307407_10068578 3300031903 Bacteria 2101
218 Ga0307407_10336505 3300031903 Unclassified 1064
219 Ga0307407_10409034 3300031903 Unclassified 975
220 Ga0307412_10022274 3300031911 Bacteria 3882
221 Ga0307412_10035147 3300031911 Bacteria 3199
222 Ga0307412_10036809 3300031911 Bacteria 3139
223 Ga0307412_10223297 3300031911 Bacteria 1445
224 Ga0307412_10236762 3300031911 Bacteria 1409
225 Ga0307412_10351257 3300031911 Bacteria 1184
226 Ga0307412_10360595 3300031911 Bacteria 1170
227 Ga0307409_100000134 3300031995 Bacteria 27864
228 Ga0307409_100017033 3300031995 Bacteria 4829
229 Ga0307409_100027392 3300031995 Bacteria 4037
230 Ga0307409_100185306 3300031995 Bacteria 1847
231 Ga0307409_100253712 3300031995 Bacteria 1610
232 Ga0307409_101016778 3300031995 Bacteria 847
233 Ga0307416_100000651 3300032002 Bacteria 17946
234 Ga0307416_100007186 3300032002 Bacteria 7050
235 Ga0307416_100007447 3300032002 Bacteria 6963
236 Ga0307416_100024731 3300032002 Bacteria 4390
237 Ga0307416_100030103 3300032002 Bacteria 4069
238 Ga0307416_100171001 3300032002 Bacteria 2023
239 Ga0307416_100533742 3300032002 Bacteria 1244
240 Ga0307416_100819369 3300032002 Unclassified 1027
241 Ga0307414_10031007 3300032004 Bacteria 3500
242 Ga0307414_10047505 3300032004 Bacteria 2954
243 Ga0307414_10109985 3300032004 Bacteria 2095
244 Ga0307414_10302271 3300032004 Bacteria 1354
245 Ga0307411_10005656 3300032005 Bacteria 6167
246 Ga0307411_10008383 3300032005 Bacteria 5349
247 Ga0307411_10075629 3300032005 Bacteria 2299
248 Ga0307411_10129741 3300032005 Bacteria 1840
249 Ga0307411_10187341 3300032005 Bacteria 1576
250 Ga0307411_10331707 3300032005 Unclassified 1233
251 Ga0307415_100001081 3300032126 Bacteria 12667
252 Ga0307415_100037932 3300032126 Bacteria 3171
253 Ga0307415_100043854 3300032126 Unclassified 2987
254 Ga0307415_100097177 3300032126 Bacteria 2149
255 Ga0307415_100325090 3300032126 Bacteria 1284
256 Ga0307415_100353221 3300032126 Bacteria 1238
257 Ga0316574_0051776 3300035398 Bacteria 2559
258 Ga0395900_0545220 3300037418 Bacteria 1105
259 Ga0436365_0794411 3300039437 Bacteria 78184
260 Ga0451577_0022679 3300042876 Bacteria 5732
261 Ga0451577_0285803 3300042876 Bacteria 1494
262 Ga0451577_0430943 3300042876 Unclassified 1197
263 Ga0453684_0001632 3300044712 Bacteria 61056
264 Ga0453684_0002149 3300044712 Bacteria 49413
265 Ga0453684_0015574 3300044712 Bacteria 12004
266 Ga0453684_0056800 3300044712 Bacteria 5074
267 Ga0453684_0529974 3300044712 Bacteria 1300
268 Ga0451576_1011622 3300045051 Bacteria 871
269 Ga0495598_0004251 3300046537 Bacteria 3092
270 Ga0495668_0000832 3300046616 Bacteria 35100
271 Ga0495588_0340874 3300046674 Bacteria 788
272 Ga0495636_0000031 3300047318 Bacteria 59312
273 Ga0496101_0166097 3300048904 Bacteria 1695
274 Ga0496104_0709171 3300048907 Bacteria 914
275 Ga0496105_0060129 3300048908 Bacteria 3135
276 Ga0496108_0125208 3300048911 Bacteria 2206
277 Ga0496109_0011334 3300048912 Bacteria 7660
278 Ga0496125_0302360 3300048928 Unclassified 979
279 Ga0501298_061037 3300049521 Unclassified 799
280 Ga0501072_0007379 3300049588 Bacteria 8341
281 Ga0501217_060845 3300049661 Bacteria 1008
282 Ga0501227_068605 3300049665 Bacteria 918
283 Ga0501225_0024441 3300049705 Unclassified 1664
284 Ga0501225_0027416 3300049705 Bacteria 1566
285 Ga0501081_0551597 3300049743 Bacteria 861
286 Ga0501268_006961 3300049765 Bacteria 1677
287 Ga0501273_036930 3300049770 Bacteria 712
288 nmdc:mga05p37_118380_c1 3300050507 Bacteria 3255
289 nmdc:mga08y16_82283_c1 3300050511 Bacteria 3356
290 nmdc:mga0n895_48608_c1 3300050512 Bacteria 4153
291 nmdc:mga0a205_27673_c1 3300050515 Bacteria 5415
292 nmdc:mga0sz30_78996_c1 3300050516 Bacteria 1422
293 Ga0495601_0429378 3300053077 Bacteria 855
294 Ga0501084_0432162 3300054114 Bacteria 1113
295 2772607339 2772190705 Bacteria 4666226
296 Ga0307409_100252648
297 LJQas_1000080
298 rootH1_10004529
299 rootH1_10230873
300 JGI25160J50197_1015224
301 Ga0065704_10096455
302 Ga0065715_10019927
303 Ga0070676_10316423
304 Ga0070677_10000162
305 Ga0070677_10017991
306 Ga0068869_100002047
307 Ga0068869_100234294
308 Ga0070666_10023860
309 Ga0068868_100000094
310 Ga0068868_100016640
311 Ga0068868_100027049
312 Ga0070660_100000131
313 Ga0070692_10000049
314 Ga0070675_100004552
315 Ga0070675_100059025
316 Ga0070671_100021340
317 Ga0070671_100550009
318 Ga0070671_100785080
319 Ga0070671_101224430
320 Ga0070674_100284525
321 Ga0070673_100211484
322 Ga0070659_100000010
323 Ga0070659_100587221
324 Ga0070667_100017300
325 Ga0070708_100001993
326 Ga0070708_100140337
327 Ga0070663_100263802
328 Ga0070681_10521884
329 Ga0068867_100003479
330 Ga0070685_10030264
331 Ga0070685_10312844
332 Ga0070706_100018802
333 Ga0070707_100049498
334 Ga0070698_100003079
335 Ga0070699_100004639
336 Ga0068853_100001859
337 Ga0070672_100186763
338 Ga0070696_100149676
339 Ga0070693_100478568
340 Ga0070704_100272897
341 Ga0070664_100435789
342 Ga0070664_100680783
343 Ga0068852_100373391
344 Ga0068859_100007923
345 Ga0068859_100030389
346 Ga0068859_100452878
347 Ga0068859_100559284
348 Ga0068864_100020711
349 Ga0068861_100055500
350 Ga0068861_100116293
351 Ga0068861_100629900
352 Ga0068851_10000441
353 Ga0068870_10096889
354 Ga0068863_100277413
355 Ga0068863_100380087
356 Ga0068863_100510547
357 Ga0068858_100466336
358 Ga0068860_100003179
359 Ga0068860_100008300
360 Ga0068860_100036896
361 Ga0068860_100053871
362 Ga0068862_100103572
363 Ga0068862_100158864
364 Ga0097621_100005762
365 Ga0097621_100217159
366 Ga0097621_100303200
367 Ga0068871_100000595
368 Ga0068871_100047845
369 Ga0075428_100170294
370 Ga0075433_10017345
371 Ga0075434_100022334
372 Ga0068865_100002044
373 Ga0068865_100036437
374 Ga0097620_100007924
375 Ga0097620_100030392
376 Ga0097620_100452871
377 Ga0097620_100559257
378 Ga0111539_10051247
379 Ga0105245_10186955
380 Ga0105245_10559603
381 Ga0114129_10030303
382 Ga0105242_10004228
383 Ga0105248_10638510
384 Ga0105237_10012410
385 Ga0105237_10057615
386 Ga0105249_10006415
387 Ga0105249_10021568
388 Ga0105249_10090392
389 Ga0105249_10454870
390 Ga0105239_10019676
391 Ga0105239_10037118
392 Ga0157373_10065138
393 Ga0157373_10226124
394 Ga0157371_10004349
395 Ga0157370_10028501
396 Ga0157369_10306035
397 Ga0157378_10005475
398 Ga0157378_10659278
399 Ga0163162_10237452
400 Ga0163162_10303061
401 Ga0157372_10098084
402 Ga0157372_10601958
403 Ga0157375_10000094
404 Ga0157375_10024933
405 Ga0157375_10167931
406 Ga0157375_10227933
407 Ga0163163_10069588
408 Ga0163163_10160333
409 Ga0157380_10113974
410 Ga0157379_10180533
411 Ga0157376_10666055
412 Ga0182005_1086326
413 Ga0163161_10028250
414 Ga0213876_10001100
415 Ga0207426_1000030
416 Ga0207656_10000252
417 Ga0207682_10001303
418 Ga0207682_10023460
419 Ga0207680_10008676
420 Ga0207643_10077341
421 Ga0207643_10159693
422 Ga0207684_10022290
423 Ga0207707_10505708
424 Ga0207657_10000451
425 Ga0207649_10075279
426 Ga0207646_10108436
427 Ga0207650_10017917
428 Ga0207650_10020809
429 Ga0207650_10137611
430 Ga0207659_10000998
431 Ga0207687_10070563
432 Ga0207687_10216552
433 Ga0207644_10170489
434 Ga0207644_10566489
435 Ga0207690_10000227
436 Ga0207686_10108757
437 Ga0207670_10019952
438 Ga0207669_10246163
439 Ga0207704_10024656
440 Ga0207691_10105137
441 Ga0207711_10002511
442 Ga0207689_10004858
443 Ga0207689_10086402
444 Ga0207679_10253846
445 Ga0207667_10205835
446 Ga0207651_10639657
447 Ga0207712_10020117
448 Ga0207712_10160063
449 Ga0207658_10169634
450 Ga0207658_10286459
451 Ga0207677_10000088
452 Ga0207677_10000131
453 Ga0207677_10000552
454 Ga0207677_10058688
455 Ga0207703_10059221
456 Ga0207703_10114724
457 Ga0207641_10058346
458 Ga0207648_10004944
459 Ga0207676_10014023
460 Ga0207675_100105274
461 Ga0207698_10078697
462 Ga0207698_10106985
463 Ga0209967_1005458
464 Ga0209995_1005488
465 Ga0209999_1003428
466 Ga0209970_1011812
467 Ga0209971_1004336
468 Ga0268265_10099830
469 Ga0268265_10231569
470 Ga0268265_10502286
471 Ga0268264_10005228
472 Ga0268264_10049811
473 Ga0268264_10089102
474 Ga0268264_10598874
475 Ga0265338_10057374
476 Ga0265327_10000037
477 Ga0307408_100000007
478 Ga0307408_100058815
479 Ga0307408_100110219
480 Ga0307408_100148046
481 Ga0307408_100237768
482 Ga0316579_10023594
483 Ga0316576_10411687
484 Ga0316578_10000060
485 Ga0307405_10016993
486 Ga0307405_10040978
487 Ga0307405_10156771
488 Ga0307405_10344231
489 Ga0307405_10445873
490 Ga0316577_10000556
491 Ga0316577_10001980
492 Ga0307413_10008802
493 Ga0307413_10042316
494 Ga0307413_10196311
495 Ga0307413_10236530
496 Ga0307413_10367917
497 Ga0307413_10527422
498 Ga0307410_10000001
499 Ga0307410_10013777
500 Ga0307410_10018390
501 Ga0307410_10043482
502 Ga0307410_10243597
503 Ga0307410_10442392
504 Ga0307410_10459563
505 Ga0307406_10003114
506 Ga0307406_10061138
507 Ga0307406_10061436
508 Ga0307407_10001569
509 Ga0307407_10001590
510 Ga0307407_10012059
511 Ga0307407_10017336
512 Ga0307407_10068578
513 Ga0307407_10336505
514 Ga0307407_10409034
515 Ga0307412_10022274
516 Ga0307412_10035147
517 Ga0307412_10036809
518 Ga0307412_10223297
519 Ga0307412_10236762
520 Ga0307412_10351257
521 Ga0307412_10360595
522 Ga0307409_100000134
523 Ga0307409_100017033
524 Ga0307409_100027392
525 Ga0307409_100185306
526 Ga0307409_100253712
527 Ga0307409_101016778
528 Ga0307416_100000651
529 Ga0307416_100007186
530 Ga0307416_100007447
531 Ga0307416_100024731
532 Ga0307416_100030103
533 Ga0307416_100171001
534 Ga0307416_100533742
535 Ga0307416_100819369
536 Ga0307414_10031007
537 Ga0307414_10047505
538 Ga0307414_10109985
539 Ga0307414_10302271
540 Ga0307411_10005656
541 Ga0307411_10008383
542 Ga0307411_10075629
543 Ga0307411_10129741
544 Ga0307411_10187341
545 Ga0307411_10331707
546 Ga0307415_100001081
547 Ga0307415_100037932
548 Ga0307415_100043854
549 Ga0307415_100097177
550 Ga0307415_100325090
551 Ga0307415_100353221
552 Ga0316574_0051776
553 Ga0395900_0545220
554 Ga0436365_0794411
555 Ga0451577_0022679
556 Ga0451577_0285803
557 Ga0451577_0430943
558 Ga0453684_0001632
559 Ga0453684_0002149
560 Ga0453684_0015574
561 Ga0453684_0056800
562 Ga0453684_0529974
563 Ga0451576_1011622
564 Ga0495598_0004251
565 Ga0495668_0000832
566 Ga0495588_0340874
567 Ga0495636_0000031
568 Ga0496101_0166097
569 Ga0496104_0709171
570 Ga0496105_0060129
571 Ga0496108_0125208
572 Ga0496109_0011334
573 Ga0496125_0302360
574 Ga0501298_061037
575 Ga0501072_0007379
576 Ga0501217_060845
577 Ga0501227_068605
578 Ga0501225_0024441
579 Ga0501225_0027416
580 Ga0501081_0551597
581 Ga0501268_006961
582 Ga0501273_036930
583 nmdc:mga05p37_118380_c1
584 nmdc:mga08y16_82283_c1
585 nmdc:mga0n895_48608_c1
586 nmdc:mga0a205_27673_c1
587 nmdc:mga0sz30_78996_c1
588 Ga0495601_0429378
589 Ga0501084_0432162
590 2772607339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

30

263

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4713 8 249
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4607 8 249
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.4003 37 248
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.3976 8 242
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.3824 8 242
ID Description Score Start End Superfamily
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4219 54 248 1.20.1250.20
af_A4HYA9_67_263_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4054 12 248 1.20.1250.20
af_A4IC33_47_249_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3965 11 248 1.20.1250.20
af_Q4D8Q4_1_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3961 12 248 1.20.1250.20
af_M0RA42_232_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3927 31 245 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Y7U0G1-F1-model_v4 Probable membrane transporter protein 0.9793 8 249 GO:0005886
AF-A0A6G1X400-F1-model_v4 Probable membrane transporter protein 0.9775 6 249 GO:0005886
AF-A0A7C2UIJ8-F1-model_v4 Probable membrane transporter protein 0.9774 7 249 GO:0005886
AF-A0A2M7J933-F1-model_v4 Probable membrane transporter protein 0.9714 6 246 GO:0005886
AF-A0A2T1GDW9-F1-model_v4 Probable membrane transporter protein 0.971 7 249 GO:0005886

Map