F392696

General Info

Members Datasets Scaffolds Average Seq Length
295 183 590 343

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10215512|Ga0207708_102155122
Length 385
Sequence MPLRAVARVNVGAVERNCTVLVRAAASALGPAPPAFKMAPDSTSVRPMSNPDAQPLTARSKSIQERAAAFRKSDAGRATWQMLNTLVPLAASFALMFWGFSNAWWLTILLLPLTALLFVRTFIIMHDCSHGSFTNSKRANEIIGFLTGVLTLTPFAQWRRDHALHHASSGDLDRRGHGDIDTLTVDEYRALSKWERFKYRFYRNAFVMLVIGPLYLMVHYRRPAPSTTTRAAKASSVHYTNLVILVMLTGLTWLVGWKAMLLVYFPVVYIASLTGIWLFYVQHQHDHAXWDHHEEWDYVTAAMHGSSFYRLPRVLEWFTGSIGRHHVHHVDPRIPNYRLRDAHESVPEFRSAPQLTFWKSLHTTSLKLWDPEQRRLVGFDALRHN

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.66
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10215512 3300026075 Bacteria 1536
2 Ga0070676_10174757 3300005328 Bacteria 1392
3 Ga0070683_100025425 3300005329 Bacteria 5318
4 Ga0070683_100217852 3300005329 Bacteria 1814
5 Ga0070683_100253968 3300005329 Bacteria 1672
6 Ga0070690_100010387 3300005330 Bacteria 5418
7 Ga0070670_100001709 3300005331 Bacteria 17886
8 Ga0070670_100045598 3300005331 Bacteria 3769
9 Ga0070677_10059799 3300005333 Bacteria 1568
10 Ga0070680_100081864 3300005336 Bacteria 2663
11 Ga0070660_100186405 3300005339 Bacteria 1680
12 Ga0070689_100002163 3300005340 Bacteria 12740
13 Ga0070691_10008754 3300005341 Bacteria 4632
14 Ga0070668_100114639 3300005347 Bacteria 2147
15 Ga0070668_100130285 3300005347 Bacteria 2018
16 Ga0070669_100003938 3300005353 Bacteria 10741
17 Ga0070669_100116834 3300005353 Bacteria 2031
18 Ga0070669_100204946 3300005353 Bacteria 1553
19 Ga0070675_100029831 3300005354 Bacteria 4400
20 Ga0070674_100228239 3300005356 Bacteria 1452
21 Ga0070673_100005680 3300005364 Bacteria 8017
22 Ga0070673_100066920 3300005364 Bacteria 2871
23 Ga0070688_100002888 3300005365 Bacteria 8760
24 Ga0070714_100018804 3300005435 Bacteria 5619
25 Ga0070713_100009041 3300005436 Bacteria 7104
26 Ga0070701_10133913 3300005438 Bacteria 1410
27 Ga0070700_100072650 3300005441 Bacteria 2200
28 Ga0070700_100107774 3300005441 Bacteria 1847
29 Ga0070694_100078567 3300005444 Bacteria 2289
30 Ga0070662_100252217 3300005457 Bacteria 1419
31 Ga0070681_10149746 3300005458 Bacteria 2261
32 Ga0070698_100000367 3300005471 Bacteria 46915
33 Ga0070698_100177993 3300005471 Bacteria 2065
34 Ga0070679_100030447 3300005530 Bacteria 5328
35 Ga0070679_100105482 3300005530 Bacteria 2804
36 Ga0070679_100190613 3300005530 Bacteria 2019
37 Ga0070684_100004040 3300005535 Bacteria 11104
38 Ga0070672_100066576 3300005543 Bacteria 2853
39 Ga0070672_100072332 3300005543 Bacteria 2745
40 Ga0070686_100101476 3300005544 Bacteria 1945
41 Ga0070686_100185477 3300005544 Bacteria 1481
42 Ga0070665_100179382 3300005548 Bacteria 2119
43 Ga0068855_100013195 3300005563 Bacteria 9966
44 Ga0068855_100241742 3300005563 Bacteria 2017
45 Ga0070664_100028637 3300005564 Bacteria 4636
46 Ga0070664_100037930 3300005564 Bacteria 4053
47 Ga0070664_100179582 3300005564 Bacteria 1881
48 Ga0068857_100030506 3300005577 Bacteria 4761
49 Ga0068857_100031667 3300005577 Bacteria 4674
50 Ga0068857_100047522 3300005577 Bacteria 3810
51 Ga0068856_100081772 3300005614 Bacteria 3205
52 Ga0068852_100131001 3300005616 Bacteria 2309
53 Ga0068859_100020925 3300005617 Bacteria 6566
54 Ga0068859_100055043 3300005617 Bacteria 4003
55 Ga0068864_100085002 3300005618 Bacteria 2781
56 Ga0068864_100306030 3300005618 Bacteria 1489
57 Ga0068861_100045808 3300005719 Bacteria 3295
58 Ga0068851_10043588 3300005834 Bacteria 2262
59 Ga0068870_10005199 3300005840 Bacteria 5668
60 Ga0068870_10010835 3300005840 Bacteria 4204
61 Ga0068870_10081077 3300005840 Bacteria 1794
62 Ga0068863_100081273 3300005841 Bacteria 3070
63 Ga0068862_100009563 3300005844 Bacteria 8016
64 Ga0068862_100053992 3300005844 Bacteria 3440
65 Ga0068862_100064067 3300005844 Bacteria 3164
66 Ga0070717_10076978 3300006028 Unclassified 2793
67 Ga0070717_10430687 3300006028 Bacteria 1187
68 Ga0097621_100059199 3300006237 Bacteria 3135
69 Ga0075428_100305282 3300006844 Bacteria 1711
70 Ga0075428_100419984 3300006844 Bacteria 1433
71 Ga0075430_100012038 3300006846 Bacteria 7363
72 Ga0075430_100090381 3300006846 Bacteria 2561
73 Ga0075431_100008876 3300006847 Bacteria 10072
74 Ga0075431_100092226 3300006847 Bacteria 3126
75 Ga0075433_10097352 3300006852 Bacteria 2604
76 Ga0075429_100218639 3300006880 Bacteria 1669
77 Ga0075429_100291448 3300006880 Bacteria 1429
78 Ga0068865_100321023 3300006881 Bacteria 1246
79 Ga0097620_100020926 3300006931 Bacteria 6566
80 Ga0097620_100055044 3300006931 Bacteria 4003
81 Ga0105240_10255625 3300009093 Bacteria 2023
82 Ga0111539_10003004 3300009094 Bacteria 22363
83 Ga0111539_10249492 3300009094 Bacteria 2067
84 Ga0105247_10060581 3300009101 Bacteria 2346
85 Ga0105243_10066548 3300009148 Bacteria 2898
86 Ga0105241_10037179 3300009174 Bacteria 3667
87 Ga0105242_10184069 3300009176 Bacteria 1845
88 Ga0105237_10037967 3300009545 Bacteria 4865
89 Ga0105238_10010203 3300009551 Bacteria 9418
90 Ga0105238_10190145 3300009551 Bacteria 2029
91 Ga0105249_10000423 3300009553 Bacteria 40301
92 Ga0105249_10051246 3300009553 Bacteria 3765
93 Ga0105249_10136466 3300009553 Bacteria 2348
94 Ga0105239_10015805 3300010375 Bacteria 8352
95 Ga0157370_10001778 3300013104 Bacteria 26589
96 Ga0157370_10124118 3300013104 Bacteria 2411
97 Ga0157378_10066179 3300013297 Bacteria 3236
98 Ga0163162_10031890 3300013306 Bacteria 5229
99 Ga0163162_10057459 3300013306 Bacteria 3919
100 Ga0163162_10243919 3300013306 Bacteria 1928
101 Ga0157372_10007298 3300013307 Bacteria 11768
102 Ga0157372_10008880 3300013307 Bacteria 10673
103 Ga0157372_10247101 3300013307 Bacteria 2071
104 Ga0157372_10375139 3300013307 Bacteria 1658
105 Ga0157375_10030966 3300013308 Bacteria 5051
106 Ga0157375_10042164 3300013308 Bacteria 4415
107 Ga0157375_10074755 3300013308 Bacteria 3410
108 Ga0163163_10026048 3300014325 Bacteria 5584
109 Ga0163163_10154803 3300014325 Bacteria 2336
110 Ga0163163_10186214 3300014325 Bacteria 2124
111 Ga0157380_10074642 3300014326 Bacteria 2753
112 Ga0157380_10103726 3300014326 Bacteria 2373
113 Ga0157377_10046685 3300014745 Bacteria 2424
114 Ga0207682_10017323 3300025893 Bacteria 2814
115 Ga0207643_10001027 3300025908 Bacteria 16559
116 Ga0207643_10002130 3300025908 Bacteria 10884
117 Ga0207643_10020845 3300025908 Bacteria 3598
118 Ga0207654_10084905 3300025911 Bacteria 1915
119 Ga0207695_10067366 3300025913 Bacteria 3673
120 Ga0207660_10012842 3300025917 Bacteria 5483
121 Ga0207662_10007020 3300025918 Bacteria 6116
122 Ga0207657_10075485 3300025919 Bacteria 2845
123 Ga0207646_10135658 3300025922 Bacteria 2216
124 Ga0207681_10009501 3300025923 Bacteria 5943
125 Ga0207681_10034506 3300025923 Bacteria 3327
126 Ga0207681_10065067 3300025923 Bacteria 2519
127 Ga0207681_10345326 3300025923 Bacteria 1190
128 Ga0207694_10231198 3300025924 Bacteria 1510
129 Ga0207650_10004632 3300025925 Bacteria 9405
130 Ga0207659_10007749 3300025926 Bacteria 6630
131 Ga0207687_10068459 3300025927 Bacteria 2529
132 Ga0207700_10010415 3300025928 Bacteria 5866
133 Ga0207644_10055376 3300025931 Bacteria 2858
134 Ga0207706_10037926 3300025933 Bacteria 4276
135 Ga0207706_10225683 3300025933 Bacteria 1639
136 Ga0207686_10156196 3300025934 Bacteria 1594
137 Ga0207670_10003230 3300025936 Bacteria 8637
138 Ga0207669_10243616 3300025937 Bacteria 1334
139 Ga0207691_10002420 3300025940 Bacteria 18265
140 Ga0207691_10041217 3300025940 Bacteria 4264
141 Ga0207691_10046484 3300025940 Bacteria 3989
142 Ga0207691_10061011 3300025940 Bacteria 3426
143 Ga0207711_10099332 3300025941 Bacteria 2573
144 Ga0207711_10110700 3300025941 Bacteria 2442
145 Ga0207689_10069513 3300025942 Bacteria 2893
146 Ga0207661_10091561 3300025944 Bacteria 2533
147 Ga0207661_10169906 3300025944 Bacteria 1897
148 Ga0207661_10295014 3300025944 Bacteria 1452
149 Ga0207679_10038835 3300025945 Bacteria 3396
150 Ga0207679_10163215 3300025945 Bacteria 1826
151 Ga0207651_10052801 3300025960 Bacteria 2774
152 Ga0207712_10002846 3300025961 Bacteria 11080
153 Ga0207712_10254389 3300025961 Bacteria 1421
154 Ga0207678_10220233 3300026067 Bacteria 1624
155 Ga0207708_10059844 3300026075 Bacteria 2908
156 Ga0207708_10109698 3300026075 Bacteria 2141
157 Ga0207702_10007860 3300026078 Bacteria 9045
158 Ga0207702_10420763 3300026078 Bacteria 1292
159 Ga0207648_10055678 3300026089 Bacteria 3452
160 Ga0207648_10297744 3300026089 Bacteria 1446
161 Ga0207676_10256284 3300026095 Bacteria 1577
162 Ga0207674_10003605 3300026116 Bacteria 18878
163 Ga0207674_10057259 3300026116 Bacteria 3951
164 Ga0207675_100005738 3300026118 Bacteria 11878
165 Ga0207675_100282281 3300026118 Bacteria 1614
166 Ga0207428_10007515 3300027907 Bacteria 9928
167 Ga0268266_10065969 3300028379 Bacteria 3130
168 Ga0268265_10012225 3300028380 Bacteria 5813
169 Ga0268265_10026329 3300028380 Bacteria 4138
170 Ga0268265_10047586 3300028380 Bacteria 3214
171 Ga0265332_10012682 3300031238 Bacteria 3738
172 Ga0265340_10035541 3300031247 Bacteria 2474
173 Ga0265327_10011743 3300031251 Bacteria 5994
174 Ga0307408_100028797 3300031548 Bacteria 3842
175 Ga0265314_10008192 3300031711 Bacteria 8986
176 Ga0265342_10057930 3300031712 Bacteria 2291
177 Ga0307413_10094621 3300031824 Bacteria 1956
178 Ga0307410_10169346 3300031852 Bacteria 1644
179 Ga0307410_10272168 3300031852 Bacteria 1325
180 Ga0307406_10230386 3300031901 Bacteria 1383
181 Ga0307407_10015441 3300031903 Bacteria 3775
182 Ga0307407_10094804 3300031903 Bacteria 1838
183 Ga0307407_10123857 3300031903 Bacteria 1643
184 Ga0307407_10248629 3300031903 Bacteria 1217
185 Ga0307416_100011615 3300032002 Bacteria 5886
186 Ga0307414_10000081 3300032004 Bacteria 87893
187 Ga0307414_10139625 3300032004 Bacteria 1895
188 Ga0307411_10316031 3300032005 Bacteria 1259
189 Ga0373934_0002756 3300035086 Bacteria 6445
190 Ga0373934_0005008 3300035086 Bacteria 4912
191 Ga0373923_0037582 3300035111 Bacteria 1981
192 Ga0373953_0004990 3300035117 Bacteria 4274
193 Ga0373956_0001078 3300035119 Bacteria 11209
194 Ga0373956_0003435 3300035119 Bacteria 6378
195 Ga0373957_0013659 3300035120 Bacteria 2760
196 Ga0373955_0005829 3300035172 Bacteria 5563
197 Ga0373924_0016062 3300035410 Bacteria 2854
198 Ga0373935_0038006 3300035692 Bacteria 3013
199 Ga0373933_0000677 3300035724 Bacteria 21015
200 Ga0373933_0009562 3300035724 Bacteria 5293
201 Ga0373947_0064924 3300035725 Bacteria 2226
202 Ga0373937_0001840 3300036401 Bacteria 17825
203 Ga0373937_0013647 3300036401 Bacteria 7158
204 Ga0436365_1464804 3300039437 Bacteria 3378
205 Ga0439462_0048835 3300042015 Bacteria 1135
206 Ga0439434_0013436 3300042435 Bacteria 2432
207 Ga0451577_0012825 3300042876 Bacteria 7867
208 Ga0451576_0090594 3300045051 Bacteria 3181
209 Ga0495592_0001522 3300046454 Bacteria 16156
210 Ga0495592_0019205 3300046454 Bacteria 5199
211 Ga0495629_0069056 3300046459 Bacteria 2466
212 Ga0495651_0012991 3300046462 Bacteria 6434
213 Ga0495651_0043480 3300046462 Bacteria 3485
214 Ga0495653_0003277 3300046463 Bacteria 12993
215 Ga0495653_0003859 3300046463 Bacteria 12121
216 Ga0495664_0019565 3300046477 Bacteria 3895
217 Ga0495608_0001616 3300046511 Bacteria 16156
218 Ga0495608_0038178 3300046511 Bacteria 3226
219 Ga0495628_0001564 3300046516 Bacteria 20953
220 Ga0495628_0002358 3300046516 Bacteria 17044
221 Ga0495630_0005184 3300046517 Bacteria 9185
222 Ga0495630_0008905 3300046517 Bacteria 7206
223 Ga0495652_0002997 3300046529 Bacteria 16948
224 Ga0495652_0031427 3300046529 Bacteria 4650
225 Ga0495586_0013578 3300046535 Bacteria 4320
226 Ga0495586_0019104 3300046535 Bacteria 3646
227 Ga0495587_0000128 3300046536 Bacteria 57292
228 Ga0495587_0004359 3300046536 Bacteria 9340
229 Ga0495645_0002331 3300046543 Bacteria 12885
230 Ga0495645_0002536 3300046543 Bacteria 12393
231 Ga0495667_0000351 3300046559 Bacteria 29155
232 Ga0495667_0016420 3300046559 Bacteria 5003
233 Ga0495635_0000302 3300046663 Bacteria 31833
234 Ga0495635_0000657 3300046663 Bacteria 22156
235 Ga0495657_0000670 3300046675 Bacteria 30989
236 Ga0495657_0018604 3300046675 Bacteria 5022
237 Ga0495599_0007165 3300046678 Bacteria 6750
238 Ga0495599_0071690 3300046678 Bacteria 2162
239 Ga0495623_0000010 3300046679 Bacteria 121464
240 Ga0495646_0001154 3300046680 Bacteria 15436
241 Ga0495646_0017361 3300046680 Bacteria 4565
242 Ga0495613_0034172 3300046689 Unclassified 3777
243 Ga0495613_0189995 3300046689 Bacteria 1452
244 Ga0495600_0000511 3300046809 Bacteria 20131
245 Ga0495600_0018360 3300046809 Bacteria 4456
246 Ga0495581_0162879 3300047315 Bacteria 1304
247 Ga0495604_0001166 3300047317 Bacteria 21714
248 Ga0495604_0024742 3300047317 Bacteria 4790
249 Ga0495674_0004193 3300047319 Bacteria 13902
250 Ga0495674_0020462 3300047319 Bacteria 6124
251 Ga0495680_0015122 3300047322 Bacteria 6664
252 Ga0495680_0031480 3300047322 Bacteria 4317
253 Ga0495675_0001547 3300047444 Bacteria 13896
254 Ga0495675_0023848 3300047444 Bacteria 3899
255 Ga0495684_0000207 3300047471 Bacteria 45417
256 Ga0495684_0001927 3300047471 Bacteria 16636
257 Ga0495602_0000693 3300048088 Bacteria 31634
258 Ga0495602_0018922 3300048088 Bacteria 6856
259 Ga0501040_0009899 3300049576 Bacteria 6223
260 Ga0501040_0014900 3300049576 Bacteria 5133
261 Ga0501042_0164381 3300049578 Bacteria 1601
262 Ga0501046_0064101 3300049580 Bacteria 2869
263 Ga0501047_0250680 3300049581 Bacteria 1619
264 Ga0501075_0100867 3300049591 Bacteria 2192
265 Ga0501076_0309004 3300049592 Bacteria 1296
266 Ga0501202_013885 3300049652 Bacteria 1537
267 Ga0501217_034451 3300049661 Bacteria 1263
268 Ga0501235_037659 3300049669 Bacteria 1101
269 Ga0501079_0115506 3300049741 Bacteria 2086
270 Ga0501079_0307420 3300049741 Bacteria 1240
271 Ga0501080_0169553 3300049742 Bacteria 2014
272 Ga0501081_0071406 3300049743 Bacteria 2420
273 Ga0501045_0105023 3300049824 Bacteria 2093
274 Ga0501045_0131213 3300049824 Bacteria 1862
275 nmdc:mga09592_172872_c1 3300050508 Bacteria 1868
276 nmdc:mga09592_178449_c1 3300050508 Bacteria 1837
277 nmdc:mga09592_258346_c1 3300050508 Bacteria 1510
278 nmdc:mga0qj67_133915_c1 3300050509 Bacteria 2008
279 nmdc:mga0qj67_183285_c1 3300050509 Bacteria 1701
280 nmdc:mga0qj67_33887_c1 3300050509 Bacteria 3987
281 nmdc:mga06r32_40119_c1 3300050510 Bacteria 4444
282 nmdc:mga08y16_288157_c1 3300050511 Bacteria 1693
283 nmdc:mga08y16_4529_c1 3300050511 Bacteria 14495
284 nmdc:mga0a205_190495_c1 3300050515 Bacteria 1943
285 Ga0495601_0002881 3300053077 Bacteria 9793
286 Ga0495601_0011930 3300053077 Bacteria 5209
287 Ga0495612_0000446 3300053078 Bacteria 16510
288 Ga0495612_0005711 3300053078 Bacteria 5139
289 Ga0495595_0014535 3300053084 Bacteria 3343
290 Ga0495595_0026643 3300053084 Bacteria 2570
291 Ga0495619_0000323 3300053085 Bacteria 33441
292 Ga0495619_0024748 3300053085 Bacteria 3851
293 Ga0501084_0133493 3300054114 Bacteria 2090
294 Ga0501082_0166891 3300060353 Bacteria 1913
295 Ga0501082_0384625 3300060353 Bacteria 1224
296 Ga0207708_10215512
297 Ga0070676_10174757
298 Ga0070683_100025425
299 Ga0070683_100217852
300 Ga0070683_100253968
301 Ga0070690_100010387
302 Ga0070670_100001709
303 Ga0070670_100045598
304 Ga0070677_10059799
305 Ga0070680_100081864
306 Ga0070660_100186405
307 Ga0070689_100002163
308 Ga0070691_10008754
309 Ga0070668_100114639
310 Ga0070668_100130285
311 Ga0070669_100003938
312 Ga0070669_100116834
313 Ga0070669_100204946
314 Ga0070675_100029831
315 Ga0070674_100228239
316 Ga0070673_100005680
317 Ga0070673_100066920
318 Ga0070688_100002888
319 Ga0070714_100018804
320 Ga0070713_100009041
321 Ga0070701_10133913
322 Ga0070700_100072650
323 Ga0070700_100107774
324 Ga0070694_100078567
325 Ga0070662_100252217
326 Ga0070681_10149746
327 Ga0070698_100000367
328 Ga0070698_100177993
329 Ga0070679_100030447
330 Ga0070679_100105482
331 Ga0070679_100190613
332 Ga0070684_100004040
333 Ga0070672_100066576
334 Ga0070672_100072332
335 Ga0070686_100101476
336 Ga0070686_100185477
337 Ga0070665_100179382
338 Ga0068855_100013195
339 Ga0068855_100241742
340 Ga0070664_100028637
341 Ga0070664_100037930
342 Ga0070664_100179582
343 Ga0068857_100030506
344 Ga0068857_100031667
345 Ga0068857_100047522
346 Ga0068856_100081772
347 Ga0068852_100131001
348 Ga0068859_100020925
349 Ga0068859_100055043
350 Ga0068864_100085002
351 Ga0068864_100306030
352 Ga0068861_100045808
353 Ga0068851_10043588
354 Ga0068870_10005199
355 Ga0068870_10010835
356 Ga0068870_10081077
357 Ga0068863_100081273
358 Ga0068862_100009563
359 Ga0068862_100053992
360 Ga0068862_100064067
361 Ga0070717_10076978
362 Ga0070717_10430687
363 Ga0097621_100059199
364 Ga0075428_100305282
365 Ga0075428_100419984
366 Ga0075430_100012038
367 Ga0075430_100090381
368 Ga0075431_100008876
369 Ga0075431_100092226
370 Ga0075433_10097352
371 Ga0075429_100218639
372 Ga0075429_100291448
373 Ga0068865_100321023
374 Ga0097620_100020926
375 Ga0097620_100055044
376 Ga0105240_10255625
377 Ga0111539_10003004
378 Ga0111539_10249492
379 Ga0105247_10060581
380 Ga0105243_10066548
381 Ga0105241_10037179
382 Ga0105242_10184069
383 Ga0105237_10037967
384 Ga0105238_10010203
385 Ga0105238_10190145
386 Ga0105249_10000423
387 Ga0105249_10051246
388 Ga0105249_10136466
389 Ga0105239_10015805
390 Ga0157370_10001778
391 Ga0157370_10124118
392 Ga0157378_10066179
393 Ga0163162_10031890
394 Ga0163162_10057459
395 Ga0163162_10243919
396 Ga0157372_10007298
397 Ga0157372_10008880
398 Ga0157372_10247101
399 Ga0157372_10375139
400 Ga0157375_10030966
401 Ga0157375_10042164
402 Ga0157375_10074755
403 Ga0163163_10026048
404 Ga0163163_10154803
405 Ga0163163_10186214
406 Ga0157380_10074642
407 Ga0157380_10103726
408 Ga0157377_10046685
409 Ga0207682_10017323
410 Ga0207643_10001027
411 Ga0207643_10002130
412 Ga0207643_10020845
413 Ga0207654_10084905
414 Ga0207695_10067366
415 Ga0207660_10012842
416 Ga0207662_10007020
417 Ga0207657_10075485
418 Ga0207646_10135658
419 Ga0207681_10009501
420 Ga0207681_10034506
421 Ga0207681_10065067
422 Ga0207681_10345326
423 Ga0207694_10231198
424 Ga0207650_10004632
425 Ga0207659_10007749
426 Ga0207687_10068459
427 Ga0207700_10010415
428 Ga0207644_10055376
429 Ga0207706_10037926
430 Ga0207706_10225683
431 Ga0207686_10156196
432 Ga0207670_10003230
433 Ga0207669_10243616
434 Ga0207691_10002420
435 Ga0207691_10041217
436 Ga0207691_10046484
437 Ga0207691_10061011
438 Ga0207711_10099332
439 Ga0207711_10110700
440 Ga0207689_10069513
441 Ga0207661_10091561
442 Ga0207661_10169906
443 Ga0207661_10295014
444 Ga0207679_10038835
445 Ga0207679_10163215
446 Ga0207651_10052801
447 Ga0207712_10002846
448 Ga0207712_10254389
449 Ga0207678_10220233
450 Ga0207708_10059844
451 Ga0207708_10109698
452 Ga0207702_10007860
453 Ga0207702_10420763
454 Ga0207648_10055678
455 Ga0207648_10297744
456 Ga0207676_10256284
457 Ga0207674_10003605
458 Ga0207674_10057259
459 Ga0207675_100005738
460 Ga0207675_100282281
461 Ga0207428_10007515
462 Ga0268266_10065969
463 Ga0268265_10012225
464 Ga0268265_10026329
465 Ga0268265_10047586
466 Ga0265332_10012682
467 Ga0265340_10035541
468 Ga0265327_10011743
469 Ga0307408_100028797
470 Ga0265314_10008192
471 Ga0265342_10057930
472 Ga0307413_10094621
473 Ga0307410_10169346
474 Ga0307410_10272168
475 Ga0307406_10230386
476 Ga0307407_10015441
477 Ga0307407_10094804
478 Ga0307407_10123857
479 Ga0307407_10248629
480 Ga0307416_100011615
481 Ga0307414_10000081
482 Ga0307414_10139625
483 Ga0307411_10316031
484 Ga0373934_0002756
485 Ga0373934_0005008
486 Ga0373923_0037582
487 Ga0373953_0004990
488 Ga0373956_0001078
489 Ga0373956_0003435
490 Ga0373957_0013659
491 Ga0373955_0005829
492 Ga0373924_0016062
493 Ga0373935_0038006
494 Ga0373933_0000677
495 Ga0373933_0009562
496 Ga0373947_0064924
497 Ga0373937_0001840
498 Ga0373937_0013647
499 Ga0436365_1464804
500 Ga0439462_0048835
501 Ga0439434_0013436
502 Ga0451577_0012825
503 Ga0451576_0090594
504 Ga0495592_0001522
505 Ga0495592_0019205
506 Ga0495629_0069056
507 Ga0495651_0012991
508 Ga0495651_0043480
509 Ga0495653_0003277
510 Ga0495653_0003859
511 Ga0495664_0019565
512 Ga0495608_0001616
513 Ga0495608_0038178
514 Ga0495628_0001564
515 Ga0495628_0002358
516 Ga0495630_0005184
517 Ga0495630_0008905
518 Ga0495652_0002997
519 Ga0495652_0031427
520 Ga0495586_0013578
521 Ga0495586_0019104
522 Ga0495587_0000128
523 Ga0495587_0004359
524 Ga0495645_0002331
525 Ga0495645_0002536
526 Ga0495667_0000351
527 Ga0495667_0016420
528 Ga0495635_0000302
529 Ga0495635_0000657
530 Ga0495657_0000670
531 Ga0495657_0018604
532 Ga0495599_0007165
533 Ga0495599_0071690
534 Ga0495623_0000010
535 Ga0495646_0001154
536 Ga0495646_0017361
537 Ga0495613_0034172
538 Ga0495613_0189995
539 Ga0495600_0000511
540 Ga0495600_0018360
541 Ga0495581_0162879
542 Ga0495604_0001166
543 Ga0495604_0024742
544 Ga0495674_0004193
545 Ga0495674_0020462
546 Ga0495680_0015122
547 Ga0495680_0031480
548 Ga0495675_0001547
549 Ga0495675_0023848
550 Ga0495684_0000207
551 Ga0495684_0001927
552 Ga0495602_0000693
553 Ga0495602_0018922
554 Ga0501040_0009899
555 Ga0501040_0014900
556 Ga0501042_0164381
557 Ga0501046_0064101
558 Ga0501047_0250680
559 Ga0501075_0100867
560 Ga0501076_0309004
561 Ga0501202_013885
562 Ga0501217_034451
563 Ga0501235_037659
564 Ga0501079_0115506
565 Ga0501079_0307420
566 Ga0501080_0169553
567 Ga0501081_0071406
568 Ga0501045_0105023
569 Ga0501045_0131213
570 nmdc:mga09592_172872_c1
571 nmdc:mga09592_178449_c1
572 nmdc:mga09592_258346_c1
573 nmdc:mga0qj67_133915_c1
574 nmdc:mga0qj67_183285_c1
575 nmdc:mga0qj67_33887_c1
576 nmdc:mga06r32_40119_c1
577 nmdc:mga08y16_288157_c1
578 nmdc:mga08y16_4529_c1
579 nmdc:mga0a205_190495_c1
580 Ga0495601_0002881
581 Ga0495601_0011930
582 Ga0495612_0000446
583 Ga0495612_0005711
584 Ga0495595_0014535
585 Ga0495595_0026643
586 Ga0495619_0000323
587 Ga0495619_0024748
588 Ga0501084_0133493
589 Ga0501082_0166891
590 Ga0501082_0384625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

102

360

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.6122 21 302
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.4652 21 302
1rtw-assembly1.cif.gz_D x-ray structure of pf1337, a tena homologue from pyrococcus furiosus. northeast structural genomics research consortium (nesg) target pfr34 0.2336 24 239
4k1c-assembly1.cif.gz_A vcx1 calcium/proton exchanger 0.2309 25 327
4k1c-assembly2.cif.gz_B vcx1 calcium/proton exchanger 0.2296 25 327
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7515 74 319 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6885 74 319 3.30.40.10
af_O45365_157_328_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.3115 132 239 1.10.565.10
af_Q9XXB5_130_329_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.3047 110 242 1.10.565.10
af_Q9M3B0_84_235_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.2918 73 237 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A3S0WLH4-F1-model_v4 Fatty acid desaturase 0.9569 24 345 GO:0006629
GO:0016020
GO:0016717
AF-A0A2H0QXJ0-F1-model_v4 Fatty acid desaturase 0.9482 21 347 GO:0006633
GO:0016020
GO:0016717
AF-A0A4P8XJQ0-F1-model_v4 Stearoyl-CoA 9-desaturase 0.9478 24 353 GO:0006629
GO:0016020
GO:0016717
AF-A0A401I928-F1-model_v4 Fatty acid desaturase 0.9473 24 353 GO:0006629
GO:0016020
GO:0016717
AF-A0A1Q7BRP1-F1-model_v4 Fatty acid desaturase 0.9471 27 349 GO:0006629
GO:0016020
GO:0016717

Map