F392627

General Info

Members Datasets Scaffolds Average Seq Length
295 191 291 141

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11217019|Ga0105239_112170192
Length 144
Sequence VTAMERKDPLRGFRYLVEIDGLVSGAFLRVKGISREVKHESYREGGVNDYEHKLLTQVTYSAVVFERGLVFDDLWNWALAAADGDARRRTVRVRLLDEGGSRAWAWEIKDALPVKWSSSDLDATASQVVMETLELAHHGLRKAT

Samples

Sample ID Description Type Environment
1 2904699407
2 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
3 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
88 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
89 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
90 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
184 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
185 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0.34
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 1.69
Rhizoplane 5.42
Rhizosphere 89.15
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000028 3300002459 Bacteria 94523
2 Ga0007416J51690_1014507 3300003577 Bacteria 8646
3 Ga0070683_100006107 3300005329 Bacteria 10098
4 Ga0070683_101098172 3300005329 Bacteria 764
5 Ga0070690_100019527 3300005330 Bacteria 4115
6 Ga0070670_100000093 3300005331 Bacteria 84800
7 Ga0068869_100002916 3300005334 Bacteria 10383
8 Ga0070666_10056864 3300005335 Bacteria 2643
9 Ga0070680_100141788 3300005336 Bacteria 2016
10 Ga0070682_100017298 3300005337 Bacteria 4202
11 Ga0068868_100040986 3300005338 Bacteria 3606
12 Ga0068868_100739008 3300005338 Bacteria 883
13 Ga0070660_100330708 3300005339 Bacteria 1253
14 Ga0070689_100033971 3300005340 Bacteria 3890
15 Ga0070689_100049952 3300005340 Bacteria 3230
16 Ga0070689_100284267 3300005340 Bacteria 1373
17 Ga0070691_10229491 3300005341 Bacteria 987
18 Ga0070687_100404732 3300005343 Bacteria 896
19 Ga0070687_100908151 3300005343 Unclassified 632
20 Ga0070661_100001294 3300005344 Bacteria 17558
21 Ga0070692_10037331 3300005345 Bacteria 2469
22 Ga0070668_100152427 3300005347 Bacteria 1870
23 Ga0070675_100206312 3300005354 Bacteria 1707
24 Ga0070675_101024391 3300005354 Bacteria 758
25 Ga0070671_101079056 3300005355 Unclassified 705
26 Ga0070674_100617139 3300005356 Bacteria 918
27 Ga0070673_100009318 3300005364 Bacteria 6587
28 Ga0070688_100204529 3300005365 Bacteria 1383
29 Ga0070659_100000484 3300005366 Bacteria 29211
30 Ga0070667_100001690 3300005367 Bacteria 19736
31 Ga0070667_100477551 3300005367 Bacteria 1141
32 Ga0070694_101172891 3300005444 Unclassified 643
33 Ga0070663_100448236 3300005455 Bacteria 1063
34 Ga0070662_100008355 3300005457 Bacteria 6746
35 Ga0070662_100931227 3300005457 Bacteria 742
36 Ga0070681_10003822 3300005458 Bacteria 14158
37 Ga0070681_10006958 3300005458 Bacteria 11006
38 Ga0068867_100645524 3300005459 Bacteria 928
39 Ga0070685_10066239 3300005466 Bacteria 2128
40 Ga0070706_100006360 3300005467 Bacteria 11156
41 Ga0070706_100070735 3300005467 Unclassified 3227
42 Ga0070707_100156060 3300005468 Unclassified 2223
43 Ga0070707_100347554 3300005468 Bacteria 1440
44 Ga0070698_100085494 3300005471 Unclassified 3141
45 Ga0070679_100180309 3300005530 Bacteria 2084
46 Ga0070697_100241597 3300005536 Unclassified 1542
47 Ga0068853_100007840 3300005539 Bacteria 8564
48 Ga0068853_100160911 3300005539 Bacteria 2026
49 Ga0068853_100193633 3300005539 Bacteria 1848
50 Ga0070686_100066795 3300005544 Bacteria 2341
51 Ga0070695_100000132 3300005545 Bacteria 34051
52 Ga0070695_100025817 3300005545 Bacteria 3630
53 Ga0070695_100100854 3300005545 Bacteria 1944
54 Ga0070695_100125865 3300005545 Bacteria 1759
55 Ga0070695_101047490 3300005545 Unclassified 665
56 Ga0070696_100101723 3300005546 Bacteria 2060
57 Ga0070696_100352218 3300005546 Bacteria 1140
58 Ga0070693_100017854 3300005547 Bacteria 3697
59 Ga0070693_100043145 3300005547 Bacteria 2546
60 Ga0070704_100252335 3300005549 Bacteria 1450
61 Ga0068855_100014323 3300005563 Bacteria 9549
62 Ga0070664_100000591 3300005564 Bacteria 27629
63 Ga0070664_100024412 3300005564 Bacteria 5000
64 Ga0070664_100105343 3300005564 Bacteria 2456
65 Ga0068857_100162411 3300005577 Bacteria 2027
66 Ga0068854_100143907 3300005578 Bacteria 1832
67 Ga0068856_100470557 3300005614 Unclassified 1277
68 Ga0070702_100003845 3300005615 Bacteria 6796
69 Ga0070702_100079277 3300005615 Bacteria 1962
70 Ga0068859_100000901 3300005617 Bacteria 30305
71 Ga0068859_100001569 3300005617 Bacteria 23304
72 Ga0068859_102376055 3300005617 Bacteria 584
73 Ga0068864_100000087 3300005618 Bacteria 98532
74 Ga0068864_100147223 3300005618 Bacteria 2130
75 Ga0068864_100163737 3300005618 Bacteria 2023
76 Ga0068866_11105390 3300005718 Bacteria 568
77 Ga0068861_100004444 3300005719 Bacteria 9409
78 Ga0068861_100004876 3300005719 Bacteria 9030
79 Ga0068861_100144059 3300005719 Bacteria 1948
80 Ga0068861_102246425 3300005719 Unclassified 547
81 Ga0068870_10072778 3300005840 Bacteria 1879
82 Ga0068870_10125825 3300005840 Bacteria 1482
83 Ga0068870_10174541 3300005840 Bacteria 1285
84 Ga0068863_100001792 3300005841 Bacteria 21314
85 Ga0068863_100146305 3300005841 Bacteria 2260
86 Ga0068863_100245366 3300005841 Bacteria 1729
87 Ga0068863_100577467 3300005841 Bacteria 1111
88 Ga0068858_100002332 3300005842 Bacteria 19193
89 Ga0068858_101211974 3300005842 Unclassified 742
90 Ga0068860_100006501 3300005843 Bacteria 11740
91 Ga0068862_100000534 3300005844 Bacteria 39782
92 Ga0097621_100030316 3300006237 Bacteria 4280
93 Ga0075428_101442157 3300006844 Bacteria 722
94 Ga0075428_101871349 3300006844 Bacteria 624
95 Ga0075431_100033343 3300006847 Bacteria 5308
96 Ga0097620_100000901 3300006931 Bacteria 30305
97 Ga0097620_100001569 3300006931 Bacteria 23304
98 Ga0097620_102376146 3300006931 Bacteria 584
99 Ga0105240_10466607 3300009093 Bacteria 1410
100 Ga0105240_11347004 3300009093 Archaea 752
101 Ga0105245_10003699 3300009098 Bacteria 13647
102 Ga0105245_10003839 3300009098 Bacteria 13369
103 Ga0105245_10095267 3300009098 Bacteria 2746
104 Ga0105245_10462956 3300009098 Bacteria 1278
105 Ga0105245_10705359 3300009098 Bacteria 1042
106 Ga0105245_12397036 3300009098 Unclassified 581
107 Ga0114129_10649491 3300009147 Bacteria 1362
108 Ga0105243_11075464 3300009148 Bacteria 811
109 Ga0105241_10012734 3300009174 Bacteria 6172
110 Ga0105241_10025138 3300009174 Bacteria 4426
111 Ga0105241_10070569 3300009174 Bacteria 2711
112 Ga0105241_11660406 3300009174 Unclassified 620
113 Ga0105242_10005795 3300009176 Bacteria 9515
114 Ga0105242_10075240 3300009176 Bacteria 2811
115 Ga0105242_13317079 3300009176 Unclassified 500
116 Ga0105248_10000703 3300009177 Bacteria 37833
117 Ga0105248_10003512 3300009177 Bacteria 17384
118 Ga0105248_10275351 3300009177 Bacteria 1895
119 Ga0105248_11723217 3300009177 Bacteria 710
120 Ga0105237_10723114 3300009545 Bacteria 1002
121 Ga0105238_10113728 3300009551 Bacteria 2686
122 Ga0105249_10172514 3300009553 Bacteria 2098
123 Ga0105249_13186979 3300009553 Unclassified 527
124 Ga0105239_10007911 3300010375 Bacteria 12154
125 Ga0105239_10721631 3300010375 Bacteria 1140
126 Ga0105239_11217019 3300010375 Bacteria 868
127 Ga0105246_10000492 3300011119 Bacteria 21438
128 Ga0105246_10128456 3300011119 Bacteria 1889
129 Ga0157373_10020765 3300013100 Bacteria 4769
130 Ga0157373_10125094 3300013100 Bacteria 1808
131 Ga0157369_10124752 3300013105 Bacteria 2731
132 Ga0157374_10023799 3300013296 Bacteria 5483
133 Ga0157378_10862282 3300013297 Bacteria 934
134 Ga0163162_10151649 3300013306 Bacteria 2436
135 Ga0163162_10804142 3300013306 Bacteria 1057
136 Ga0157372_10027689 3300013307 Bacteria 6176
137 Ga0157375_10000009 3300013308 Bacteria 366440
138 Ga0157375_12587475 3300013308 Bacteria 606
139 Ga0157375_13001235 3300013308 Unclassified 563
140 Ga0163163_10012245 3300014325 Bacteria 7809
141 Ga0163163_10060750 3300014325 Bacteria 3743
142 Ga0163163_10113617 3300014325 Bacteria 2738
143 Ga0157380_10000155 3300014326 Bacteria 39407
144 Ga0157380_10525051 3300014326 Bacteria 1155
145 Ga0157380_10916107 3300014326 Unclassified 904
146 Ga0157380_11379939 3300014326 Bacteria 754
147 Ga0157376_10001375 3300014969 Bacteria 16012
148 Ga0157376_10629293 3300014969 Bacteria 1071
149 Ga0163161_10027471 3300017792 Bacteria 4037
150 Ga0214544_1000256 3300021320 Bacteria 88722
151 Ga0214542_1000256 3300021321 Bacteria 88722
152 Ga0214545_1000137 3300021324 Bacteria 88722
153 Ga0214543_1000203 3300021327 Bacteria 88820
154 Ga0209676_1009115 3300025292 Bacteria 4325
155 Ga0209676_1036520 3300025292 Bacteria 1429
156 Ga0207682_10001024 3300025893 Bacteria 12934
157 Ga0207645_10347347 3300025907 Bacteria 992
158 Ga0207643_10276031 3300025908 Bacteria 1041
159 Ga0207643_10370535 3300025908 Bacteria 901
160 Ga0207684_10005957 3300025910 Bacteria 11159
161 Ga0207684_10047141 3300025910 Unclassified 3656
162 Ga0207654_10043838 3300025911 Bacteria 2537
163 Ga0207654_10298103 3300025911 Bacteria 1095
164 Ga0207654_10865826 3300025911 Unclassified 654
165 Ga0207707_10044064 3300025912 Bacteria 3890
166 Ga0207707_10293123 3300025912 Unclassified 1407
167 Ga0207695_10722525 3300025913 Bacteria 876
168 Ga0207660_10011476 3300025917 Bacteria 5769
169 Ga0207662_10305142 3300025918 Bacteria 1059
170 Ga0207662_10413278 3300025918 Bacteria 917
171 Ga0207657_10270376 3300025919 Bacteria 1351
172 Ga0207649_10007443 3300025920 Bacteria 5955
173 Ga0207649_10115036 3300025920 Bacteria 1804
174 Ga0207652_10015041 3300025921 Bacteria 6277
175 Ga0207681_10361917 3300025923 Unclassified 1164
176 Ga0207694_10458057 3300025924 Unclassified 1065
177 Ga0207650_10000004 3300025925 Bacteria 743372
178 Ga0207659_10014539 3300025926 Bacteria 5080
179 Ga0207659_11061692 3300025926 Bacteria 697
180 Ga0207687_10000588 3300025927 Bacteria 24580
181 Ga0207687_10002111 3300025927 Bacteria 13587
182 Ga0207644_10638229 3300025931 Bacteria 886
183 Ga0207690_10027784 3300025932 Bacteria 3578
184 Ga0207706_10019075 3300025933 Bacteria 6170
185 Ga0207686_10002732 3300025934 Bacteria 9562
186 Ga0207686_10046830 3300025934 Bacteria 2670
187 Ga0207686_11688163 3300025934 Unclassified 524
188 Ga0207670_10017537 3300025936 Bacteria 4329
189 Ga0207670_10059695 3300025936 Bacteria 2595
190 Ga0207670_10244517 3300025936 Bacteria 1384
191 Ga0207669_10956296 3300025937 Bacteria 718
192 Ga0207711_10000973 3300025941 Bacteria 27429
193 Ga0207711_10076817 3300025941 Bacteria 2909
194 Ga0207711_10192346 3300025941 Bacteria 1860
195 Ga0207689_10001863 3300025942 Bacteria 19958
196 Ga0207689_10060802 3300025942 Bacteria 3107
197 Ga0207689_10475968 3300025942 Bacteria 1045
198 Ga0207661_10000194 3300025944 Bacteria 39579
199 Ga0207661_11036933 3300025944 Bacteria 755
200 Ga0207661_11140232 3300025944 Bacteria 718
201 Ga0207679_10000255 3300025945 Bacteria 40708
202 Ga0207679_10018522 3300025945 Bacteria 4667
203 Ga0207679_10146993 3300025945 Bacteria 1913
204 Ga0207667_10674720 3300025949 Unclassified 1037
205 Ga0207712_10102096 3300025961 Bacteria 2134
206 Ga0207712_11567721 3300025961 Unclassified 590
207 Ga0207668_10040537 3300025972 Bacteria 3143
208 Ga0207640_10163742 3300025981 Bacteria 1649
209 Ga0207658_10001122 3300025986 Bacteria 21606
210 Ga0207658_10322274 3300025986 Bacteria 1338
211 Ga0207677_10047978 3300026023 Bacteria 2872
212 Ga0207703_10000601 3300026035 Bacteria 36559
213 Ga0207639_10000026 3300026041 Bacteria 205256
214 Ga0207639_10657969 3300026041 Unclassified 970
215 Ga0207678_10482253 3300026067 Bacteria 1080
216 Ga0207641_10178941 3300026088 Bacteria 1941
217 Ga0207641_10915269 3300026088 Bacteria 871
218 Ga0207676_10000143 3300026095 Bacteria 62176
219 Ga0207676_10347068 3300026095 Bacteria 1371
220 Ga0207674_10000570 3300026116 Bacteria 48354
221 Ga0207675_100010991 3300026118 Bacteria 8481
222 Ga0207675_100027936 3300026118 Bacteria 5254
223 Ga0207675_100291629 3300026118 Bacteria 1587
224 Ga0207675_100576006 3300026118 Bacteria 1127
225 Ga0207698_11163518 3300026142 Unclassified 785
226 Ga0268265_10000001 3300028380 Bacteria 1230727
227 Ga0268265_11046528 3300028380 Unclassified 808
228 Ga0268264_10007116 3300028381 Bacteria 9377
229 Ga0268264_10805664 3300028381 Unclassified 939
230 Ga0268264_11360426 3300028381 Bacteria 720
231 Ga0307517_10258476 3300028786 Bacteria 1014
232 Ga0307412_10002083 3300031911 Bacteria 11106
233 Ga0307416_102394241 3300032002 Unclassified 628
234 Ga0307411_10366435 3300032005 Unclassified 1180
235 Ga0373955_0098283 3300035172 Bacteria 1677
236 Ga0373937_0200129 3300036401 Bacteria 1878
237 Ga0395905_0494785 3300037471 Bacteria 1123
238 Ga0395905_0555302 3300037471 Bacteria 1049
239 Ga0451853_0598517 3300041512 Unclassified 606
240 Ga0439449_0164408 3300042007 Bacteria 829
241 Ga0495605_0130413 3300046474 Bacteria 1134
242 Ga0495584_0268199 3300046491 Bacteria 868
243 Ga0495583_0007506 3300046506 Bacteria 6830
244 Ga0495616_0000052 3300046513 Bacteria 105258
245 Ga0495620_0319791 3300046515 Bacteria 589
246 Ga0495630_0600192 3300046517 Bacteria 844
247 Ga0495643_0000079 3300046522 Bacteria 162735
248 Ga0495621_0245465 3300046539 Bacteria 730
249 Ga0495597_0031431 3300046542 Bacteria 2416
250 Ga0495656_0153137 3300046615 Bacteria 1115
251 Ga0495656_0435787 3300046615 Bacteria 689
252 Ga0495668_0091073 3300046616 Bacteria 1671
253 Ga0495625_0026470 3300046660 Bacteria 4383
254 Ga0495661_0034421 3300046665 Bacteria 3188
255 Ga0495670_0023487 3300046691 Bacteria 3043
256 Ga0495600_0634796 3300046809 Unclassified 647
257 Ga0495683_0032760 3300047323 Bacteria 2646
258 Ga0495687_000187 3300047443 Bacteria 90147
259 Ga0495679_008567 3300047446 Bacteria 4146
260 Ga0495686_0003318 3300047472 Bacteria 14055
261 Ga0496100_0019480 3300048903 Bacteria 4050
262 Ga0496101_0026284 3300048904 Bacteria 4047
263 Ga0496102_0004345 3300048905 Bacteria 11980
264 Ga0496104_0114200 3300048907 Bacteria 2590
265 Ga0496106_0010643 3300048909 Bacteria 6797
266 Ga0496106_0496681 3300048909 Bacteria 980
267 Ga0496107_0167305 3300048910 Bacteria 1630
268 Ga0496108_0002232 3300048911 Bacteria 15524
269 Ga0496109_0015121 3300048912 Bacteria 6717
270 Ga0496110_0005940 3300048913 Bacteria 9609
271 Ga0496111_0559459 3300048914 Bacteria 839
272 Ga0496111_0812225 3300048914 Bacteria 676
273 Ga0496112_0000842 3300048915 Bacteria 21887
274 Ga0496112_0219340 3300048915 Bacteria 1858
275 Ga0496113_0100198 3300048916 Bacteria 2244
276 Ga0496115_0011104 3300048918 Bacteria 6749
277 Ga0501292_022894 3300049515 Bacteria 1018
278 Ga0501071_0159605 3300049587 Bacteria 1685
279 Ga0501233_038491 3300049668 Bacteria 1114
280 Ga0501235_034101 3300049669 Bacteria 1154
281 Ga0501243_051239 3300049675 Unclassified 746
282 Ga0501257_048160 3300049686 Bacteria 1059
283 Ga0501221_008480 3300049704 Bacteria 1787
284 Ga0501234_020525 3300049707 Bacteria 1051
285 Ga0501265_075827 3300049762 Unclassified 576
286 Ga0501273_011983 3300049770 Bacteria 1087
287 nmdc:mga06r32_133702_c1 3300050510 Bacteria 2454
288 Ga0500583_0000473 3300053092 Bacteria 12551
289 Ga0500651_0032137 3300053093 Bacteria 3308
290 Ga0500642_0201141 3300053130 Unclassified 927
291 Ga0500568_0003238 3300053139 Bacteria 9207

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_11061692 Ga0207659_110616922 117
2 3300053092 Ga0500583_0000473 Ga0500583_0000473_6251_6634 127
3 3300009148 Ga0105243_11075464 Ga0105243_110754642 133
4 3300021320 Ga0214544_1000256 Ga0214544_100025676 133
5 3300021321 Ga0214542_1000256 Ga0214542_100025613 133
6 3300021324 Ga0214545_1000137 Ga0214545_100013713 133
7 3300021327 Ga0214543_1000203 Ga0214543_100020313 133
8 3300005545 Ga0070695_101047490 Ga0070695_1010474901 134
9 3300009147 Ga0114129_10649491 Ga0114129_106494913 134
10 3300005329 Ga0070683_101098172 Ga0070683_1010981721 136
11 3300025944 Ga0207661_11140232 Ga0207661_111402321 136
12 iso_pu_bacteria 2904699407 2904708345 137
13 iso_pu_bacteria 3005445848 3005452207 137
14 iso_pu_bacteria 637000159 637078507 137
15 iso_pu_bacteria 2932784394 2932792745 138
16 3300025893 Ga0207682_10001024 Ga0207682_1000102412 139
17 3300005340 Ga0070689_100033971 Ga0070689_1000339711 140
18 3300005343 Ga0070687_100404732 Ga0070687_1004047321 140
19 3300005466 Ga0070685_10066239 Ga0070685_100662392 140
20 3300005546 Ga0070696_100352218 Ga0070696_1003522182 140
21 3300005719 Ga0068861_102246425 Ga0068861_1022464252 140
22 3300005841 Ga0068863_100245366 Ga0068863_1002453663 140
23 3300006844 Ga0075428_101442157 Ga0075428_1014421572 140
24 3300009098 Ga0105245_10462956 Ga0105245_104629563 140
25 3300009177 Ga0105248_10275351 Ga0105248_102753512 140
26 3300014326 Ga0157380_10525051 Ga0157380_105250513 140
27 3300014969 Ga0157376_10629293 Ga0157376_106292932 140
28 3300025918 Ga0207662_10413278 Ga0207662_104132782 140
29 3300025941 Ga0207711_10192346 Ga0207711_101923462 140
30 3300026088 Ga0207641_10178941 Ga0207641_101789413 140
31 3300028381 Ga0268264_10805664 Ga0268264_108056641 140
32 3300002459 JGI24751J29686_10000028 JGI24751J29686_1000002858 141
33 3300003577 Ga0007416J51690_1014507 Ga0007416J51690_10145079 141
34 3300005329 Ga0070683_100006107 Ga0070683_1000061078 141
35 3300005330 Ga0070690_100019527 Ga0070690_1000195275 141
36 3300005331 Ga0070670_100000093 Ga0070670_10000009378 141
37 3300005334 Ga0068869_100002916 Ga0068869_1000029168 141
38 3300005335 Ga0070666_10056864 Ga0070666_100568642 141
39 3300005336 Ga0070680_100141788 Ga0070680_1001417885 141
40 3300005337 Ga0070682_100017298 Ga0070682_1000172984 141
41 3300005338 Ga0068868_100040986 Ga0068868_1000409865 141
42 3300005338 Ga0068868_100739008 Ga0068868_1007390081 141
43 3300005339 Ga0070660_100330708 Ga0070660_1003307083 141
44 3300005340 Ga0070689_100049952 Ga0070689_1000499525 141
45 3300005340 Ga0070689_100284267 Ga0070689_1002842672 141
46 3300005341 Ga0070691_10229491 Ga0070691_102294913 141
47 3300005343 Ga0070687_100908151 Ga0070687_1009081511 141
48 3300005344 Ga0070661_100001294 Ga0070661_1000012947 141
49 3300005345 Ga0070692_10037331 Ga0070692_100373313 141
50 3300005347 Ga0070668_100152427 Ga0070668_1001524275 141
51 3300005354 Ga0070675_100206312 Ga0070675_1002063123 141
52 3300005354 Ga0070675_101024391 Ga0070675_1010243912 141
53 3300005355 Ga0070671_101079056 Ga0070671_1010790561 141
54 3300005356 Ga0070674_100617139 Ga0070674_1006171391 141
55 3300005364 Ga0070673_100009318 Ga0070673_1000093182 141
56 3300005365 Ga0070688_100204529 Ga0070688_1002045292 141
57 3300005366 Ga0070659_100000484 Ga0070659_1000004845 141
58 3300005367 Ga0070667_100001690 Ga0070667_10000169013 141
59 3300005367 Ga0070667_100477551 Ga0070667_1004775513 141
60 3300005444 Ga0070694_101172891 Ga0070694_1011728911 141
61 3300005455 Ga0070663_100448236 Ga0070663_1004482362 141
62 3300005457 Ga0070662_100008355 Ga0070662_1000083558 141
63 3300005457 Ga0070662_100931227 Ga0070662_1009312272 141
64 3300005458 Ga0070681_10003822 Ga0070681_100038225 141
65 3300005458 Ga0070681_10006958 Ga0070681_100069588 141
66 3300005459 Ga0068867_100645524 Ga0068867_1006455241 141
67 3300005467 Ga0070706_100006360 Ga0070706_1000063602 141
68 3300005467 Ga0070706_100070735 Ga0070706_1000707354 141
69 3300005468 Ga0070707_100156060 Ga0070707_1001560603 141
70 3300005468 Ga0070707_100347554 Ga0070707_1003475541 141
71 3300005471 Ga0070698_100085494 Ga0070698_1000854942 141
72 3300005530 Ga0070679_100180309 Ga0070679_1001803091 141
73 3300005536 Ga0070697_100241597 Ga0070697_1002415972 141
74 3300005539 Ga0068853_100007840 Ga0068853_1000078408 141
75 3300005539 Ga0068853_100160911 Ga0068853_1001609115 141
76 3300005539 Ga0068853_100193633 Ga0068853_1001936331 141
77 3300005544 Ga0070686_100066795 Ga0070686_1000667952 141
78 3300005545 Ga0070695_100000132 Ga0070695_10000013212 141
79 3300005545 Ga0070695_100025817 Ga0070695_1000258174 141
80 3300005545 Ga0070695_100100854 Ga0070695_1001008545 141
81 3300005545 Ga0070695_100125865 Ga0070695_1001258653 141
82 3300005546 Ga0070696_100101723 Ga0070696_1001017232 141
83 3300005547 Ga0070693_100017854 Ga0070693_1000178541 141
84 3300005547 Ga0070693_100043145 Ga0070693_1000431451 141
85 3300005549 Ga0070704_100252335 Ga0070704_1002523352 141
86 3300005563 Ga0068855_100014323 Ga0068855_1000143238 141
87 3300005564 Ga0070664_100000591 Ga0070664_10000059114 141
88 3300005564 Ga0070664_100024412 Ga0070664_1000244127 141
89 3300005564 Ga0070664_100105343 Ga0070664_1001053431 141
90 3300005577 Ga0068857_100162411 Ga0068857_1001624115 141
91 3300005578 Ga0068854_100143907 Ga0068854_1001439071 141
92 3300005614 Ga0068856_100470557 Ga0068856_1004705571 141
93 3300005615 Ga0070702_100003845 Ga0070702_1000038452 141
94 3300005615 Ga0070702_100079277 Ga0070702_1000792772 141
95 3300005617 Ga0068859_100000901 Ga0068859_10000090113 141
96 3300005617 Ga0068859_100001569 Ga0068859_10000156914 141
97 3300005617 Ga0068859_102376055 Ga0068859_1023760551 141
98 3300005618 Ga0068864_100000087 Ga0068864_10000008779 141
99 3300005618 Ga0068864_100147223 Ga0068864_1001472231 141
100 3300005618 Ga0068864_100163737 Ga0068864_1001637375 141
101 3300005718 Ga0068866_11105390 Ga0068866_111053902 141
102 3300005719 Ga0068861_100004444 Ga0068861_1000044449 141
103 3300005719 Ga0068861_100004876 Ga0068861_1000048767 141
104 3300005719 Ga0068861_100144059 Ga0068861_1001440592 141
105 3300005840 Ga0068870_10072778 Ga0068870_100727782 141
106 3300005840 Ga0068870_10125825 Ga0068870_101258252 141
107 3300005840 Ga0068870_10174541 Ga0068870_101745412 141
108 3300005841 Ga0068863_100001792 Ga0068863_10000179211 141
109 3300005841 Ga0068863_100146305 Ga0068863_1001463053 141
110 3300005841 Ga0068863_100577467 Ga0068863_1005774672 141
111 3300005842 Ga0068858_100002332 Ga0068858_1000023322 141
112 3300005842 Ga0068858_101211974 Ga0068858_1012119741 141
113 3300005843 Ga0068860_100006501 Ga0068860_1000065018 141
114 3300005844 Ga0068862_100000534 Ga0068862_10000053417 141
115 3300006237 Ga0097621_100030316 Ga0097621_1000303164 141
116 3300006844 Ga0075428_101871349 Ga0075428_1018713491 141
117 3300006847 Ga0075431_100033343 Ga0075431_1000333435 141
118 3300006931 Ga0097620_100000901 Ga0097620_10000090113 141
119 3300006931 Ga0097620_100001569 Ga0097620_10000156914 141
120 3300006931 Ga0097620_102376146 Ga0097620_1023761461 141
121 3300009093 Ga0105240_10466607 Ga0105240_104666071 141
122 3300009093 Ga0105240_11347004 Ga0105240_113470041 141
123 3300009098 Ga0105245_10003699 Ga0105245_100036991 141
124 3300009098 Ga0105245_10003839 Ga0105245_100038399 141
125 3300009098 Ga0105245_10095267 Ga0105245_100952675 141
126 3300009098 Ga0105245_10705359 Ga0105245_107053593 141
127 3300009098 Ga0105245_12397036 Ga0105245_123970361 141
128 3300009174 Ga0105241_10012734 Ga0105241_100127348 141
129 3300009174 Ga0105241_10025138 Ga0105241_100251384 141
130 3300009174 Ga0105241_10070569 Ga0105241_100705695 141
131 3300009174 Ga0105241_11660406 Ga0105241_116604062 141
132 3300009176 Ga0105242_10005795 Ga0105242_100057956 141
133 3300009176 Ga0105242_10075240 Ga0105242_100752402 141
134 3300009176 Ga0105242_13317079 Ga0105242_133170791 141
135 3300009177 Ga0105248_10000703 Ga0105248_1000070322 141
136 3300009177 Ga0105248_10003512 Ga0105248_1000351217 141
137 3300009177 Ga0105248_11723217 Ga0105248_117232172 141
138 3300009545 Ga0105237_10723114 Ga0105237_107231142 141
139 3300009551 Ga0105238_10113728 Ga0105238_101137281 141
140 3300009553 Ga0105249_10172514 Ga0105249_101725145 141
141 3300009553 Ga0105249_13186979 Ga0105249_131869791 141
142 3300010375 Ga0105239_10007911 Ga0105239_100079118 141
143 3300010375 Ga0105239_10721631 Ga0105239_107216311 141
144 3300010375 Ga0105239_11217019 Ga0105239_112170192 141
145 3300011119 Ga0105246_10000492 Ga0105246_100004925 141
146 3300011119 Ga0105246_10128456 Ga0105246_101284562 141
147 3300013100 Ga0157373_10020765 Ga0157373_100207654 141
148 3300013100 Ga0157373_10125094 Ga0157373_101250943 141
149 3300013105 Ga0157369_10124752 Ga0157369_101247521 141
150 3300013296 Ga0157374_10023799 Ga0157374_100237991 141
151 3300013297 Ga0157378_10862282 Ga0157378_108622821 141
152 3300013306 Ga0163162_10151649 Ga0163162_101516492 141
153 3300013306 Ga0163162_10804142 Ga0163162_108041421 141
154 3300013307 Ga0157372_10027689 Ga0157372_100276898 141
155 3300013308 Ga0157375_10000009 Ga0157375_10000009219 141
156 3300013308 Ga0157375_12587475 Ga0157375_125874752 141
157 3300013308 Ga0157375_13001235 Ga0157375_130012352 141
158 3300014325 Ga0163163_10012245 Ga0163163_100122454 141
159 3300014325 Ga0163163_10060750 Ga0163163_100607505 141
160 3300014325 Ga0163163_10113617 Ga0163163_101136173 141
161 3300014326 Ga0157380_10000155 Ga0157380_1000015517 141
162 3300014326 Ga0157380_10916107 Ga0157380_109161071 141
163 3300014326 Ga0157380_11379939 Ga0157380_113799392 141
164 3300014969 Ga0157376_10001375 Ga0157376_100013758 141
165 3300017792 Ga0163161_10027471 Ga0163161_100274713 141
166 3300025292 Ga0209676_1009115 Ga0209676_10091155 141
167 3300025292 Ga0209676_1036520 Ga0209676_10365204 141
168 3300025907 Ga0207645_10347347 Ga0207645_103473472 141
169 3300025908 Ga0207643_10276031 Ga0207643_102760312 141
170 3300025908 Ga0207643_10370535 Ga0207643_103705352 141
171 3300025910 Ga0207684_10005957 Ga0207684_100059571 141
172 3300025910 Ga0207684_10047141 Ga0207684_100471414 141
173 3300025911 Ga0207654_10043838 Ga0207654_100438385 141
174 3300025911 Ga0207654_10298103 Ga0207654_102981032 141
175 3300025911 Ga0207654_10865826 Ga0207654_108658261 141
176 3300025912 Ga0207707_10044064 Ga0207707_100440646 141
177 3300025912 Ga0207707_10293123 Ga0207707_102931232 141
178 3300025913 Ga0207695_10722525 Ga0207695_107225252 141
179 3300025917 Ga0207660_10011476 Ga0207660_100114764 141
180 3300025918 Ga0207662_10305142 Ga0207662_103051423 141
181 3300025919 Ga0207657_10270376 Ga0207657_102703762 141
182 3300025920 Ga0207649_10007443 Ga0207649_100074438 141
183 3300025920 Ga0207649_10115036 Ga0207649_101150362 141
184 3300025921 Ga0207652_10015041 Ga0207652_100150416 141
185 3300025923 Ga0207681_10361917 Ga0207681_103619173 141
186 3300025924 Ga0207694_10458057 Ga0207694_104580571 141
187 3300025925 Ga0207650_10000004 Ga0207650_10000004735 141
188 3300025926 Ga0207659_10014539 Ga0207659_100145391 141
189 3300025927 Ga0207687_10000588 Ga0207687_1000058813 141
190 3300025927 Ga0207687_10002111 Ga0207687_100021111 141
191 3300025931 Ga0207644_10638229 Ga0207644_106382292 141
192 3300025932 Ga0207690_10027784 Ga0207690_100277845 141
193 3300025933 Ga0207706_10019075 Ga0207706_100190756 141
194 3300025934 Ga0207686_10002732 Ga0207686_100027329 141
195 3300025934 Ga0207686_10046830 Ga0207686_100468305 141
196 3300025934 Ga0207686_11688163 Ga0207686_116881631 141
197 3300025936 Ga0207670_10017537 Ga0207670_100175376 141
198 3300025936 Ga0207670_10059695 Ga0207670_100596955 141
199 3300025936 Ga0207670_10244517 Ga0207670_102445174 141
200 3300025937 Ga0207669_10956296 Ga0207669_109562962 141
201 3300025941 Ga0207711_10000973 Ga0207711_1000097317 141
202 3300025941 Ga0207711_10076817 Ga0207711_100768175 141
203 3300025942 Ga0207689_10001863 Ga0207689_100018632 141
204 3300025942 Ga0207689_10060802 Ga0207689_100608023 141
205 3300025942 Ga0207689_10475968 Ga0207689_104759682 141
206 3300025944 Ga0207661_10000194 Ga0207661_100001946 141
207 3300025944 Ga0207661_11036933 Ga0207661_110369331 141
208 3300025945 Ga0207679_10000255 Ga0207679_1000025513 141
209 3300025945 Ga0207679_10018522 Ga0207679_100185225 141
210 3300025945 Ga0207679_10146993 Ga0207679_101469935 141
211 3300025949 Ga0207667_10674720 Ga0207667_106747201 141
212 3300025961 Ga0207712_10102096 Ga0207712_101020963 141
213 3300025961 Ga0207712_11567721 Ga0207712_115677211 141
214 3300025972 Ga0207668_10040537 Ga0207668_100405374 141
215 3300025981 Ga0207640_10163742 Ga0207640_101637423 141
216 3300025986 Ga0207658_10001122 Ga0207658_100011228 141
217 3300025986 Ga0207658_10322274 Ga0207658_103222744 141
218 3300026023 Ga0207677_10047978 Ga0207677_100479785 141
219 3300026035 Ga0207703_10000601 Ga0207703_100006012 141
220 3300026041 Ga0207639_10000026 Ga0207639_1000002669 141
221 3300026041 Ga0207639_10657969 Ga0207639_106579692 141
222 3300026067 Ga0207678_10482253 Ga0207678_104822532 141
223 3300026088 Ga0207641_10915269 Ga0207641_109152692 141
224 3300026095 Ga0207676_10000143 Ga0207676_1000014314 141
225 3300026095 Ga0207676_10347068 Ga0207676_103470683 141
226 3300026116 Ga0207674_10000570 Ga0207674_1000057025 141
227 3300026118 Ga0207675_100010991 Ga0207675_1000109919 141
228 3300026118 Ga0207675_100027936 Ga0207675_1000279362 141
229 3300026118 Ga0207675_100291629 Ga0207675_1002916291 141
230 3300026118 Ga0207675_100576006 Ga0207675_1005760062 141
231 3300026142 Ga0207698_11163518 Ga0207698_111635183 141
232 3300028380 Ga0268265_10000001 Ga0268265_100000011196 141
233 3300028380 Ga0268265_11046528 Ga0268265_110465281 141
234 3300028381 Ga0268264_10007116 Ga0268264_100071168 141
235 3300028381 Ga0268264_11360426 Ga0268264_113604262 141
236 3300028786 Ga0307517_10258476 Ga0307517_102584762 141
237 3300031911 Ga0307412_10002083 Ga0307412_1000208310 141
238 3300032002 Ga0307416_102394241 Ga0307416_1023942411 141
239 3300032005 Ga0307411_10366435 Ga0307411_103664352 141
240 3300035172 Ga0373955_0098283 Ga0373955_0098283_19_444 141
241 3300036401 Ga0373937_0200129 Ga0373937_0200129_619_1044 141
242 3300037471 Ga0395905_0494785 Ga0395905_0494785_493_921 141
243 3300037471 Ga0395905_0555302 Ga0395905_0555302_387_815 141
244 3300041512 Ga0451853_0598517 Ga0451853_0598517_85_510 141
245 3300042007 Ga0439449_0164408 Ga0439449_0164408_266_694 141
246 3300046474 Ga0495605_0130413 Ga0495605_0130413_277_702 141
247 3300046491 Ga0495584_0268199 Ga0495584_0268199_212_637 141
248 3300046506 Ga0495583_0007506 Ga0495583_0007506_12_437 141
249 3300046513 Ga0495616_0000052 Ga0495616_0000052_67193_67618 141
250 3300046515 Ga0495620_0319791 Ga0495620_0319791_135_563 141
251 3300046517 Ga0495630_0600192 Ga0495630_0600192_62_490 141
252 3300046522 Ga0495643_0000079 Ga0495643_0000079_115268_115693 141
253 3300046539 Ga0495621_0245465 Ga0495621_0245465_136_561 141
254 3300046542 Ga0495597_0031431 Ga0495597_0031431_1782_2207 141
255 3300046615 Ga0495656_0153137 Ga0495656_0153137_370_795 141
256 3300046615 Ga0495656_0435787 Ga0495656_0435787_77_502 141
257 3300046616 Ga0495668_0091073 Ga0495668_0091073_465_890 141
258 3300046660 Ga0495625_0026470 Ga0495625_0026470_1098_1523 141
259 3300046665 Ga0495661_0034421 Ga0495661_0034421_221_646 141
260 3300046691 Ga0495670_0023487 Ga0495670_0023487_2472_2897 141
261 3300046809 Ga0495600_0634796 Ga0495600_0634796_85_510 141
262 3300047323 Ga0495683_0032760 Ga0495683_0032760_647_1072 141
263 3300047443 Ga0495687_000187 Ga0495687_000187_61330_61755 141
264 3300047446 Ga0495679_008567 Ga0495679_008567_3448_3873 141
265 3300047472 Ga0495686_0003318 Ga0495686_0003318_5742_6191 141
266 3300048903 Ga0496100_0019480 Ga0496100_0019480_266_691 141
267 3300048904 Ga0496101_0026284 Ga0496101_0026284_3279_3704 141
268 3300048905 Ga0496102_0004345 Ga0496102_0004345_5915_6340 141
269 3300048907 Ga0496104_0114200 Ga0496104_0114200_106_531 141
270 3300048909 Ga0496106_0010643 Ga0496106_0010643_5570_5995 141
271 3300048909 Ga0496106_0496681 Ga0496106_0496681_306_731 141
272 3300048910 Ga0496107_0167305 Ga0496107_0167305_951_1376 141
273 3300048911 Ga0496108_0002232 Ga0496108_0002232_9878_10303 141
274 3300048912 Ga0496109_0015121 Ga0496109_0015121_4206_4631 141
275 3300048913 Ga0496110_0005940 Ga0496110_0005940_7058_7483 141
276 3300048914 Ga0496111_0559459 Ga0496111_0559459_87_512 141
277 3300048914 Ga0496111_0812225 Ga0496111_0812225_65_490 141
278 3300048915 Ga0496112_0000842 Ga0496112_0000842_11589_12014 141
279 3300048915 Ga0496112_0219340 Ga0496112_0219340_798_1223 141
280 3300048916 Ga0496113_0100198 Ga0496113_0100198_434_859 141
281 3300048918 Ga0496115_0011104 Ga0496115_0011104_944_1369 141
282 3300049515 Ga0501292_022894 Ga0501292_022894_260_685 141
283 3300049587 Ga0501071_0159605 Ga0501071_0159605_329_754 141
284 3300049668 Ga0501233_038491 Ga0501233_038491_447_872 141
285 3300049669 Ga0501235_034101 Ga0501235_034101_199_624 141
286 3300049675 Ga0501243_051239 Ga0501243_051239_272_697 141
287 3300049686 Ga0501257_048160 Ga0501257_048160_413_838 141
288 3300049704 Ga0501221_008480 Ga0501221_008480_343_768 141
289 3300049707 Ga0501234_020525 Ga0501234_020525_395_820 141
290 3300049762 Ga0501265_075827 Ga0501265_075827_11_436 141
291 3300049770 Ga0501273_011983 Ga0501273_011983_335_760 141
292 3300050510 nmdc:mga06r32_133702_c1 nmdc:mga06r32_133702_c1_730_1155 141
293 3300053093 Ga0500651_0032137 Ga0500651_0032137_873_1298 141
294 3300053130 Ga0500642_0201141 Ga0500642_0201141_386_811 141
295 3300053139 Ga0500568_0003238 Ga0500568_0003238_6195_6620 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

11

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yw0-assembly1.cif.gz_B bacteroides fragilis hcp5 0.7101 10 140
7aeb-assembly1.cif.gz_Y cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.709 10 141
8gra-assembly1.cif.gz_E structure of type vi secretion system cargo delivery vehicle hcp-vgrg-paar 0.7004 10 140
7yw0-assembly1.cif.gz_A bacteroides fragilis hcp5 0.6982 10 140
6bdc-assembly1.cif.gz_A structure of hcp1 from flavobacterium johnsoniae 0.6969 10 139
ID Description Score Start End Superfamily
af_P46855_3_149_2.30.110.20 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6662 33 137 2.30.110.20
af_Q550Q3_44_421_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6615 31 63 3.40.630.10
af_Q9VEQ0_8_287_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6547 83 105 3.30.420.40
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.6248 10 139 2.30.110.20
5xhhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.5967 11 137 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A413W1T0-F1-model_v4 deleted 0.8341 10 141
AF-A0A4Q3J232-F1-model_v4 Phage tail protein 0.8334 57 141 GO:0005198
AF-A0A3M1E306-F1-model_v4 Phage tail protein 0.8313 61 140 GO:0005198
AF-A0A536KB96-F1-model_v4 Phage tail protein 0.8294 11 141 GO:0005198
AF-A0A4Y8PPI9-F1-model_v4 deleted 0.8289 15 141

Feature Viewer

pLDDT pTM Quality
86.88 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map