F392627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 191 | 291 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_11217019|Ga0105239_112170192 |
| Length | 144 |
| Sequence | VTAMERKDPLRGFRYLVEIDGLVSGAFLRVKGISREVKHESYREGGVNDYEHKLLTQVTYSAVVFERGLVFDDLWNWALAAADGDARRRTVRVRLLDEGGSRAWAWEIKDALPVKWSSSDLDATASQVVMETLELAHHGLRKAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2904699407 | |||
| 2 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 3 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 88 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 89 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 90 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 91 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 177 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 181 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 182 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 183 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 185 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 188 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 189 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 190 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 191 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 0.34 |
| Isolates | 1.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 1.69 |
| Rhizoplane | 5.42 |
| Rhizosphere | 89.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000028 | 3300002459 | Bacteria | 94523 |
| 2 | Ga0007416J51690_1014507 | 3300003577 | Bacteria | 8646 |
| 3 | Ga0070683_100006107 | 3300005329 | Bacteria | 10098 |
| 4 | Ga0070683_101098172 | 3300005329 | Bacteria | 764 |
| 5 | Ga0070690_100019527 | 3300005330 | Bacteria | 4115 |
| 6 | Ga0070670_100000093 | 3300005331 | Bacteria | 84800 |
| 7 | Ga0068869_100002916 | 3300005334 | Bacteria | 10383 |
| 8 | Ga0070666_10056864 | 3300005335 | Bacteria | 2643 |
| 9 | Ga0070680_100141788 | 3300005336 | Bacteria | 2016 |
| 10 | Ga0070682_100017298 | 3300005337 | Bacteria | 4202 |
| 11 | Ga0068868_100040986 | 3300005338 | Bacteria | 3606 |
| 12 | Ga0068868_100739008 | 3300005338 | Bacteria | 883 |
| 13 | Ga0070660_100330708 | 3300005339 | Bacteria | 1253 |
| 14 | Ga0070689_100033971 | 3300005340 | Bacteria | 3890 |
| 15 | Ga0070689_100049952 | 3300005340 | Bacteria | 3230 |
| 16 | Ga0070689_100284267 | 3300005340 | Bacteria | 1373 |
| 17 | Ga0070691_10229491 | 3300005341 | Bacteria | 987 |
| 18 | Ga0070687_100404732 | 3300005343 | Bacteria | 896 |
| 19 | Ga0070687_100908151 | 3300005343 | Unclassified | 632 |
| 20 | Ga0070661_100001294 | 3300005344 | Bacteria | 17558 |
| 21 | Ga0070692_10037331 | 3300005345 | Bacteria | 2469 |
| 22 | Ga0070668_100152427 | 3300005347 | Bacteria | 1870 |
| 23 | Ga0070675_100206312 | 3300005354 | Bacteria | 1707 |
| 24 | Ga0070675_101024391 | 3300005354 | Bacteria | 758 |
| 25 | Ga0070671_101079056 | 3300005355 | Unclassified | 705 |
| 26 | Ga0070674_100617139 | 3300005356 | Bacteria | 918 |
| 27 | Ga0070673_100009318 | 3300005364 | Bacteria | 6587 |
| 28 | Ga0070688_100204529 | 3300005365 | Bacteria | 1383 |
| 29 | Ga0070659_100000484 | 3300005366 | Bacteria | 29211 |
| 30 | Ga0070667_100001690 | 3300005367 | Bacteria | 19736 |
| 31 | Ga0070667_100477551 | 3300005367 | Bacteria | 1141 |
| 32 | Ga0070694_101172891 | 3300005444 | Unclassified | 643 |
| 33 | Ga0070663_100448236 | 3300005455 | Bacteria | 1063 |
| 34 | Ga0070662_100008355 | 3300005457 | Bacteria | 6746 |
| 35 | Ga0070662_100931227 | 3300005457 | Bacteria | 742 |
| 36 | Ga0070681_10003822 | 3300005458 | Bacteria | 14158 |
| 37 | Ga0070681_10006958 | 3300005458 | Bacteria | 11006 |
| 38 | Ga0068867_100645524 | 3300005459 | Bacteria | 928 |
| 39 | Ga0070685_10066239 | 3300005466 | Bacteria | 2128 |
| 40 | Ga0070706_100006360 | 3300005467 | Bacteria | 11156 |
| 41 | Ga0070706_100070735 | 3300005467 | Unclassified | 3227 |
| 42 | Ga0070707_100156060 | 3300005468 | Unclassified | 2223 |
| 43 | Ga0070707_100347554 | 3300005468 | Bacteria | 1440 |
| 44 | Ga0070698_100085494 | 3300005471 | Unclassified | 3141 |
| 45 | Ga0070679_100180309 | 3300005530 | Bacteria | 2084 |
| 46 | Ga0070697_100241597 | 3300005536 | Unclassified | 1542 |
| 47 | Ga0068853_100007840 | 3300005539 | Bacteria | 8564 |
| 48 | Ga0068853_100160911 | 3300005539 | Bacteria | 2026 |
| 49 | Ga0068853_100193633 | 3300005539 | Bacteria | 1848 |
| 50 | Ga0070686_100066795 | 3300005544 | Bacteria | 2341 |
| 51 | Ga0070695_100000132 | 3300005545 | Bacteria | 34051 |
| 52 | Ga0070695_100025817 | 3300005545 | Bacteria | 3630 |
| 53 | Ga0070695_100100854 | 3300005545 | Bacteria | 1944 |
| 54 | Ga0070695_100125865 | 3300005545 | Bacteria | 1759 |
| 55 | Ga0070695_101047490 | 3300005545 | Unclassified | 665 |
| 56 | Ga0070696_100101723 | 3300005546 | Bacteria | 2060 |
| 57 | Ga0070696_100352218 | 3300005546 | Bacteria | 1140 |
| 58 | Ga0070693_100017854 | 3300005547 | Bacteria | 3697 |
| 59 | Ga0070693_100043145 | 3300005547 | Bacteria | 2546 |
| 60 | Ga0070704_100252335 | 3300005549 | Bacteria | 1450 |
| 61 | Ga0068855_100014323 | 3300005563 | Bacteria | 9549 |
| 62 | Ga0070664_100000591 | 3300005564 | Bacteria | 27629 |
| 63 | Ga0070664_100024412 | 3300005564 | Bacteria | 5000 |
| 64 | Ga0070664_100105343 | 3300005564 | Bacteria | 2456 |
| 65 | Ga0068857_100162411 | 3300005577 | Bacteria | 2027 |
| 66 | Ga0068854_100143907 | 3300005578 | Bacteria | 1832 |
| 67 | Ga0068856_100470557 | 3300005614 | Unclassified | 1277 |
| 68 | Ga0070702_100003845 | 3300005615 | Bacteria | 6796 |
| 69 | Ga0070702_100079277 | 3300005615 | Bacteria | 1962 |
| 70 | Ga0068859_100000901 | 3300005617 | Bacteria | 30305 |
| 71 | Ga0068859_100001569 | 3300005617 | Bacteria | 23304 |
| 72 | Ga0068859_102376055 | 3300005617 | Bacteria | 584 |
| 73 | Ga0068864_100000087 | 3300005618 | Bacteria | 98532 |
| 74 | Ga0068864_100147223 | 3300005618 | Bacteria | 2130 |
| 75 | Ga0068864_100163737 | 3300005618 | Bacteria | 2023 |
| 76 | Ga0068866_11105390 | 3300005718 | Bacteria | 568 |
| 77 | Ga0068861_100004444 | 3300005719 | Bacteria | 9409 |
| 78 | Ga0068861_100004876 | 3300005719 | Bacteria | 9030 |
| 79 | Ga0068861_100144059 | 3300005719 | Bacteria | 1948 |
| 80 | Ga0068861_102246425 | 3300005719 | Unclassified | 547 |
| 81 | Ga0068870_10072778 | 3300005840 | Bacteria | 1879 |
| 82 | Ga0068870_10125825 | 3300005840 | Bacteria | 1482 |
| 83 | Ga0068870_10174541 | 3300005840 | Bacteria | 1285 |
| 84 | Ga0068863_100001792 | 3300005841 | Bacteria | 21314 |
| 85 | Ga0068863_100146305 | 3300005841 | Bacteria | 2260 |
| 86 | Ga0068863_100245366 | 3300005841 | Bacteria | 1729 |
| 87 | Ga0068863_100577467 | 3300005841 | Bacteria | 1111 |
| 88 | Ga0068858_100002332 | 3300005842 | Bacteria | 19193 |
| 89 | Ga0068858_101211974 | 3300005842 | Unclassified | 742 |
| 90 | Ga0068860_100006501 | 3300005843 | Bacteria | 11740 |
| 91 | Ga0068862_100000534 | 3300005844 | Bacteria | 39782 |
| 92 | Ga0097621_100030316 | 3300006237 | Bacteria | 4280 |
| 93 | Ga0075428_101442157 | 3300006844 | Bacteria | 722 |
| 94 | Ga0075428_101871349 | 3300006844 | Bacteria | 624 |
| 95 | Ga0075431_100033343 | 3300006847 | Bacteria | 5308 |
| 96 | Ga0097620_100000901 | 3300006931 | Bacteria | 30305 |
| 97 | Ga0097620_100001569 | 3300006931 | Bacteria | 23304 |
| 98 | Ga0097620_102376146 | 3300006931 | Bacteria | 584 |
| 99 | Ga0105240_10466607 | 3300009093 | Bacteria | 1410 |
| 100 | Ga0105240_11347004 | 3300009093 | Archaea | 752 |
| 101 | Ga0105245_10003699 | 3300009098 | Bacteria | 13647 |
| 102 | Ga0105245_10003839 | 3300009098 | Bacteria | 13369 |
| 103 | Ga0105245_10095267 | 3300009098 | Bacteria | 2746 |
| 104 | Ga0105245_10462956 | 3300009098 | Bacteria | 1278 |
| 105 | Ga0105245_10705359 | 3300009098 | Bacteria | 1042 |
| 106 | Ga0105245_12397036 | 3300009098 | Unclassified | 581 |
| 107 | Ga0114129_10649491 | 3300009147 | Bacteria | 1362 |
| 108 | Ga0105243_11075464 | 3300009148 | Bacteria | 811 |
| 109 | Ga0105241_10012734 | 3300009174 | Bacteria | 6172 |
| 110 | Ga0105241_10025138 | 3300009174 | Bacteria | 4426 |
| 111 | Ga0105241_10070569 | 3300009174 | Bacteria | 2711 |
| 112 | Ga0105241_11660406 | 3300009174 | Unclassified | 620 |
| 113 | Ga0105242_10005795 | 3300009176 | Bacteria | 9515 |
| 114 | Ga0105242_10075240 | 3300009176 | Bacteria | 2811 |
| 115 | Ga0105242_13317079 | 3300009176 | Unclassified | 500 |
| 116 | Ga0105248_10000703 | 3300009177 | Bacteria | 37833 |
| 117 | Ga0105248_10003512 | 3300009177 | Bacteria | 17384 |
| 118 | Ga0105248_10275351 | 3300009177 | Bacteria | 1895 |
| 119 | Ga0105248_11723217 | 3300009177 | Bacteria | 710 |
| 120 | Ga0105237_10723114 | 3300009545 | Bacteria | 1002 |
| 121 | Ga0105238_10113728 | 3300009551 | Bacteria | 2686 |
| 122 | Ga0105249_10172514 | 3300009553 | Bacteria | 2098 |
| 123 | Ga0105249_13186979 | 3300009553 | Unclassified | 527 |
| 124 | Ga0105239_10007911 | 3300010375 | Bacteria | 12154 |
| 125 | Ga0105239_10721631 | 3300010375 | Bacteria | 1140 |
| 126 | Ga0105239_11217019 | 3300010375 | Bacteria | 868 |
| 127 | Ga0105246_10000492 | 3300011119 | Bacteria | 21438 |
| 128 | Ga0105246_10128456 | 3300011119 | Bacteria | 1889 |
| 129 | Ga0157373_10020765 | 3300013100 | Bacteria | 4769 |
| 130 | Ga0157373_10125094 | 3300013100 | Bacteria | 1808 |
| 131 | Ga0157369_10124752 | 3300013105 | Bacteria | 2731 |
| 132 | Ga0157374_10023799 | 3300013296 | Bacteria | 5483 |
| 133 | Ga0157378_10862282 | 3300013297 | Bacteria | 934 |
| 134 | Ga0163162_10151649 | 3300013306 | Bacteria | 2436 |
| 135 | Ga0163162_10804142 | 3300013306 | Bacteria | 1057 |
| 136 | Ga0157372_10027689 | 3300013307 | Bacteria | 6176 |
| 137 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 138 | Ga0157375_12587475 | 3300013308 | Bacteria | 606 |
| 139 | Ga0157375_13001235 | 3300013308 | Unclassified | 563 |
| 140 | Ga0163163_10012245 | 3300014325 | Bacteria | 7809 |
| 141 | Ga0163163_10060750 | 3300014325 | Bacteria | 3743 |
| 142 | Ga0163163_10113617 | 3300014325 | Bacteria | 2738 |
| 143 | Ga0157380_10000155 | 3300014326 | Bacteria | 39407 |
| 144 | Ga0157380_10525051 | 3300014326 | Bacteria | 1155 |
| 145 | Ga0157380_10916107 | 3300014326 | Unclassified | 904 |
| 146 | Ga0157380_11379939 | 3300014326 | Bacteria | 754 |
| 147 | Ga0157376_10001375 | 3300014969 | Bacteria | 16012 |
| 148 | Ga0157376_10629293 | 3300014969 | Bacteria | 1071 |
| 149 | Ga0163161_10027471 | 3300017792 | Bacteria | 4037 |
| 150 | Ga0214544_1000256 | 3300021320 | Bacteria | 88722 |
| 151 | Ga0214542_1000256 | 3300021321 | Bacteria | 88722 |
| 152 | Ga0214545_1000137 | 3300021324 | Bacteria | 88722 |
| 153 | Ga0214543_1000203 | 3300021327 | Bacteria | 88820 |
| 154 | Ga0209676_1009115 | 3300025292 | Bacteria | 4325 |
| 155 | Ga0209676_1036520 | 3300025292 | Bacteria | 1429 |
| 156 | Ga0207682_10001024 | 3300025893 | Bacteria | 12934 |
| 157 | Ga0207645_10347347 | 3300025907 | Bacteria | 992 |
| 158 | Ga0207643_10276031 | 3300025908 | Bacteria | 1041 |
| 159 | Ga0207643_10370535 | 3300025908 | Bacteria | 901 |
| 160 | Ga0207684_10005957 | 3300025910 | Bacteria | 11159 |
| 161 | Ga0207684_10047141 | 3300025910 | Unclassified | 3656 |
| 162 | Ga0207654_10043838 | 3300025911 | Bacteria | 2537 |
| 163 | Ga0207654_10298103 | 3300025911 | Bacteria | 1095 |
| 164 | Ga0207654_10865826 | 3300025911 | Unclassified | 654 |
| 165 | Ga0207707_10044064 | 3300025912 | Bacteria | 3890 |
| 166 | Ga0207707_10293123 | 3300025912 | Unclassified | 1407 |
| 167 | Ga0207695_10722525 | 3300025913 | Bacteria | 876 |
| 168 | Ga0207660_10011476 | 3300025917 | Bacteria | 5769 |
| 169 | Ga0207662_10305142 | 3300025918 | Bacteria | 1059 |
| 170 | Ga0207662_10413278 | 3300025918 | Bacteria | 917 |
| 171 | Ga0207657_10270376 | 3300025919 | Bacteria | 1351 |
| 172 | Ga0207649_10007443 | 3300025920 | Bacteria | 5955 |
| 173 | Ga0207649_10115036 | 3300025920 | Bacteria | 1804 |
| 174 | Ga0207652_10015041 | 3300025921 | Bacteria | 6277 |
| 175 | Ga0207681_10361917 | 3300025923 | Unclassified | 1164 |
| 176 | Ga0207694_10458057 | 3300025924 | Unclassified | 1065 |
| 177 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 178 | Ga0207659_10014539 | 3300025926 | Bacteria | 5080 |
| 179 | Ga0207659_11061692 | 3300025926 | Bacteria | 697 |
| 180 | Ga0207687_10000588 | 3300025927 | Bacteria | 24580 |
| 181 | Ga0207687_10002111 | 3300025927 | Bacteria | 13587 |
| 182 | Ga0207644_10638229 | 3300025931 | Bacteria | 886 |
| 183 | Ga0207690_10027784 | 3300025932 | Bacteria | 3578 |
| 184 | Ga0207706_10019075 | 3300025933 | Bacteria | 6170 |
| 185 | Ga0207686_10002732 | 3300025934 | Bacteria | 9562 |
| 186 | Ga0207686_10046830 | 3300025934 | Bacteria | 2670 |
| 187 | Ga0207686_11688163 | 3300025934 | Unclassified | 524 |
| 188 | Ga0207670_10017537 | 3300025936 | Bacteria | 4329 |
| 189 | Ga0207670_10059695 | 3300025936 | Bacteria | 2595 |
| 190 | Ga0207670_10244517 | 3300025936 | Bacteria | 1384 |
| 191 | Ga0207669_10956296 | 3300025937 | Bacteria | 718 |
| 192 | Ga0207711_10000973 | 3300025941 | Bacteria | 27429 |
| 193 | Ga0207711_10076817 | 3300025941 | Bacteria | 2909 |
| 194 | Ga0207711_10192346 | 3300025941 | Bacteria | 1860 |
| 195 | Ga0207689_10001863 | 3300025942 | Bacteria | 19958 |
| 196 | Ga0207689_10060802 | 3300025942 | Bacteria | 3107 |
| 197 | Ga0207689_10475968 | 3300025942 | Bacteria | 1045 |
| 198 | Ga0207661_10000194 | 3300025944 | Bacteria | 39579 |
| 199 | Ga0207661_11036933 | 3300025944 | Bacteria | 755 |
| 200 | Ga0207661_11140232 | 3300025944 | Bacteria | 718 |
| 201 | Ga0207679_10000255 | 3300025945 | Bacteria | 40708 |
| 202 | Ga0207679_10018522 | 3300025945 | Bacteria | 4667 |
| 203 | Ga0207679_10146993 | 3300025945 | Bacteria | 1913 |
| 204 | Ga0207667_10674720 | 3300025949 | Unclassified | 1037 |
| 205 | Ga0207712_10102096 | 3300025961 | Bacteria | 2134 |
| 206 | Ga0207712_11567721 | 3300025961 | Unclassified | 590 |
| 207 | Ga0207668_10040537 | 3300025972 | Bacteria | 3143 |
| 208 | Ga0207640_10163742 | 3300025981 | Bacteria | 1649 |
| 209 | Ga0207658_10001122 | 3300025986 | Bacteria | 21606 |
| 210 | Ga0207658_10322274 | 3300025986 | Bacteria | 1338 |
| 211 | Ga0207677_10047978 | 3300026023 | Bacteria | 2872 |
| 212 | Ga0207703_10000601 | 3300026035 | Bacteria | 36559 |
| 213 | Ga0207639_10000026 | 3300026041 | Bacteria | 205256 |
| 214 | Ga0207639_10657969 | 3300026041 | Unclassified | 970 |
| 215 | Ga0207678_10482253 | 3300026067 | Bacteria | 1080 |
| 216 | Ga0207641_10178941 | 3300026088 | Bacteria | 1941 |
| 217 | Ga0207641_10915269 | 3300026088 | Bacteria | 871 |
| 218 | Ga0207676_10000143 | 3300026095 | Bacteria | 62176 |
| 219 | Ga0207676_10347068 | 3300026095 | Bacteria | 1371 |
| 220 | Ga0207674_10000570 | 3300026116 | Bacteria | 48354 |
| 221 | Ga0207675_100010991 | 3300026118 | Bacteria | 8481 |
| 222 | Ga0207675_100027936 | 3300026118 | Bacteria | 5254 |
| 223 | Ga0207675_100291629 | 3300026118 | Bacteria | 1587 |
| 224 | Ga0207675_100576006 | 3300026118 | Bacteria | 1127 |
| 225 | Ga0207698_11163518 | 3300026142 | Unclassified | 785 |
| 226 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 227 | Ga0268265_11046528 | 3300028380 | Unclassified | 808 |
| 228 | Ga0268264_10007116 | 3300028381 | Bacteria | 9377 |
| 229 | Ga0268264_10805664 | 3300028381 | Unclassified | 939 |
| 230 | Ga0268264_11360426 | 3300028381 | Bacteria | 720 |
| 231 | Ga0307517_10258476 | 3300028786 | Bacteria | 1014 |
| 232 | Ga0307412_10002083 | 3300031911 | Bacteria | 11106 |
| 233 | Ga0307416_102394241 | 3300032002 | Unclassified | 628 |
| 234 | Ga0307411_10366435 | 3300032005 | Unclassified | 1180 |
| 235 | Ga0373955_0098283 | 3300035172 | Bacteria | 1677 |
| 236 | Ga0373937_0200129 | 3300036401 | Bacteria | 1878 |
| 237 | Ga0395905_0494785 | 3300037471 | Bacteria | 1123 |
| 238 | Ga0395905_0555302 | 3300037471 | Bacteria | 1049 |
| 239 | Ga0451853_0598517 | 3300041512 | Unclassified | 606 |
| 240 | Ga0439449_0164408 | 3300042007 | Bacteria | 829 |
| 241 | Ga0495605_0130413 | 3300046474 | Bacteria | 1134 |
| 242 | Ga0495584_0268199 | 3300046491 | Bacteria | 868 |
| 243 | Ga0495583_0007506 | 3300046506 | Bacteria | 6830 |
| 244 | Ga0495616_0000052 | 3300046513 | Bacteria | 105258 |
| 245 | Ga0495620_0319791 | 3300046515 | Bacteria | 589 |
| 246 | Ga0495630_0600192 | 3300046517 | Bacteria | 844 |
| 247 | Ga0495643_0000079 | 3300046522 | Bacteria | 162735 |
| 248 | Ga0495621_0245465 | 3300046539 | Bacteria | 730 |
| 249 | Ga0495597_0031431 | 3300046542 | Bacteria | 2416 |
| 250 | Ga0495656_0153137 | 3300046615 | Bacteria | 1115 |
| 251 | Ga0495656_0435787 | 3300046615 | Bacteria | 689 |
| 252 | Ga0495668_0091073 | 3300046616 | Bacteria | 1671 |
| 253 | Ga0495625_0026470 | 3300046660 | Bacteria | 4383 |
| 254 | Ga0495661_0034421 | 3300046665 | Bacteria | 3188 |
| 255 | Ga0495670_0023487 | 3300046691 | Bacteria | 3043 |
| 256 | Ga0495600_0634796 | 3300046809 | Unclassified | 647 |
| 257 | Ga0495683_0032760 | 3300047323 | Bacteria | 2646 |
| 258 | Ga0495687_000187 | 3300047443 | Bacteria | 90147 |
| 259 | Ga0495679_008567 | 3300047446 | Bacteria | 4146 |
| 260 | Ga0495686_0003318 | 3300047472 | Bacteria | 14055 |
| 261 | Ga0496100_0019480 | 3300048903 | Bacteria | 4050 |
| 262 | Ga0496101_0026284 | 3300048904 | Bacteria | 4047 |
| 263 | Ga0496102_0004345 | 3300048905 | Bacteria | 11980 |
| 264 | Ga0496104_0114200 | 3300048907 | Bacteria | 2590 |
| 265 | Ga0496106_0010643 | 3300048909 | Bacteria | 6797 |
| 266 | Ga0496106_0496681 | 3300048909 | Bacteria | 980 |
| 267 | Ga0496107_0167305 | 3300048910 | Bacteria | 1630 |
| 268 | Ga0496108_0002232 | 3300048911 | Bacteria | 15524 |
| 269 | Ga0496109_0015121 | 3300048912 | Bacteria | 6717 |
| 270 | Ga0496110_0005940 | 3300048913 | Bacteria | 9609 |
| 271 | Ga0496111_0559459 | 3300048914 | Bacteria | 839 |
| 272 | Ga0496111_0812225 | 3300048914 | Bacteria | 676 |
| 273 | Ga0496112_0000842 | 3300048915 | Bacteria | 21887 |
| 274 | Ga0496112_0219340 | 3300048915 | Bacteria | 1858 |
| 275 | Ga0496113_0100198 | 3300048916 | Bacteria | 2244 |
| 276 | Ga0496115_0011104 | 3300048918 | Bacteria | 6749 |
| 277 | Ga0501292_022894 | 3300049515 | Bacteria | 1018 |
| 278 | Ga0501071_0159605 | 3300049587 | Bacteria | 1685 |
| 279 | Ga0501233_038491 | 3300049668 | Bacteria | 1114 |
| 280 | Ga0501235_034101 | 3300049669 | Bacteria | 1154 |
| 281 | Ga0501243_051239 | 3300049675 | Unclassified | 746 |
| 282 | Ga0501257_048160 | 3300049686 | Bacteria | 1059 |
| 283 | Ga0501221_008480 | 3300049704 | Bacteria | 1787 |
| 284 | Ga0501234_020525 | 3300049707 | Bacteria | 1051 |
| 285 | Ga0501265_075827 | 3300049762 | Unclassified | 576 |
| 286 | Ga0501273_011983 | 3300049770 | Bacteria | 1087 |
| 287 | nmdc:mga06r32_133702_c1 | 3300050510 | Bacteria | 2454 |
| 288 | Ga0500583_0000473 | 3300053092 | Bacteria | 12551 |
| 289 | Ga0500651_0032137 | 3300053093 | Bacteria | 3308 |
| 290 | Ga0500642_0201141 | 3300053130 | Unclassified | 927 |
| 291 | Ga0500568_0003238 | 3300053139 | Bacteria | 9207 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025926 | Ga0207659_11061692 | Ga0207659_110616922 | 117 |
| 2 | 3300053092 | Ga0500583_0000473 | Ga0500583_0000473_6251_6634 | 127 |
| 3 | 3300009148 | Ga0105243_11075464 | Ga0105243_110754642 | 133 |
| 4 | 3300021320 | Ga0214544_1000256 | Ga0214544_100025676 | 133 |
| 5 | 3300021321 | Ga0214542_1000256 | Ga0214542_100025613 | 133 |
| 6 | 3300021324 | Ga0214545_1000137 | Ga0214545_100013713 | 133 |
| 7 | 3300021327 | Ga0214543_1000203 | Ga0214543_100020313 | 133 |
| 8 | 3300005545 | Ga0070695_101047490 | Ga0070695_1010474901 | 134 |
| 9 | 3300009147 | Ga0114129_10649491 | Ga0114129_106494913 | 134 |
| 10 | 3300005329 | Ga0070683_101098172 | Ga0070683_1010981721 | 136 |
| 11 | 3300025944 | Ga0207661_11140232 | Ga0207661_111402321 | 136 |
| 12 | iso_pu_bacteria | 2904699407 | 2904708345 | 137 |
| 13 | iso_pu_bacteria | 3005445848 | 3005452207 | 137 |
| 14 | iso_pu_bacteria | 637000159 | 637078507 | 137 |
| 15 | iso_pu_bacteria | 2932784394 | 2932792745 | 138 |
| 16 | 3300025893 | Ga0207682_10001024 | Ga0207682_1000102412 | 139 |
| 17 | 3300005340 | Ga0070689_100033971 | Ga0070689_1000339711 | 140 |
| 18 | 3300005343 | Ga0070687_100404732 | Ga0070687_1004047321 | 140 |
| 19 | 3300005466 | Ga0070685_10066239 | Ga0070685_100662392 | 140 |
| 20 | 3300005546 | Ga0070696_100352218 | Ga0070696_1003522182 | 140 |
| 21 | 3300005719 | Ga0068861_102246425 | Ga0068861_1022464252 | 140 |
| 22 | 3300005841 | Ga0068863_100245366 | Ga0068863_1002453663 | 140 |
| 23 | 3300006844 | Ga0075428_101442157 | Ga0075428_1014421572 | 140 |
| 24 | 3300009098 | Ga0105245_10462956 | Ga0105245_104629563 | 140 |
| 25 | 3300009177 | Ga0105248_10275351 | Ga0105248_102753512 | 140 |
| 26 | 3300014326 | Ga0157380_10525051 | Ga0157380_105250513 | 140 |
| 27 | 3300014969 | Ga0157376_10629293 | Ga0157376_106292932 | 140 |
| 28 | 3300025918 | Ga0207662_10413278 | Ga0207662_104132782 | 140 |
| 29 | 3300025941 | Ga0207711_10192346 | Ga0207711_101923462 | 140 |
| 30 | 3300026088 | Ga0207641_10178941 | Ga0207641_101789413 | 140 |
| 31 | 3300028381 | Ga0268264_10805664 | Ga0268264_108056641 | 140 |
| 32 | 3300002459 | JGI24751J29686_10000028 | JGI24751J29686_1000002858 | 141 |
| 33 | 3300003577 | Ga0007416J51690_1014507 | Ga0007416J51690_10145079 | 141 |
| 34 | 3300005329 | Ga0070683_100006107 | Ga0070683_1000061078 | 141 |
| 35 | 3300005330 | Ga0070690_100019527 | Ga0070690_1000195275 | 141 |
| 36 | 3300005331 | Ga0070670_100000093 | Ga0070670_10000009378 | 141 |
| 37 | 3300005334 | Ga0068869_100002916 | Ga0068869_1000029168 | 141 |
| 38 | 3300005335 | Ga0070666_10056864 | Ga0070666_100568642 | 141 |
| 39 | 3300005336 | Ga0070680_100141788 | Ga0070680_1001417885 | 141 |
| 40 | 3300005337 | Ga0070682_100017298 | Ga0070682_1000172984 | 141 |
| 41 | 3300005338 | Ga0068868_100040986 | Ga0068868_1000409865 | 141 |
| 42 | 3300005338 | Ga0068868_100739008 | Ga0068868_1007390081 | 141 |
| 43 | 3300005339 | Ga0070660_100330708 | Ga0070660_1003307083 | 141 |
| 44 | 3300005340 | Ga0070689_100049952 | Ga0070689_1000499525 | 141 |
| 45 | 3300005340 | Ga0070689_100284267 | Ga0070689_1002842672 | 141 |
| 46 | 3300005341 | Ga0070691_10229491 | Ga0070691_102294913 | 141 |
| 47 | 3300005343 | Ga0070687_100908151 | Ga0070687_1009081511 | 141 |
| 48 | 3300005344 | Ga0070661_100001294 | Ga0070661_1000012947 | 141 |
| 49 | 3300005345 | Ga0070692_10037331 | Ga0070692_100373313 | 141 |
| 50 | 3300005347 | Ga0070668_100152427 | Ga0070668_1001524275 | 141 |
| 51 | 3300005354 | Ga0070675_100206312 | Ga0070675_1002063123 | 141 |
| 52 | 3300005354 | Ga0070675_101024391 | Ga0070675_1010243912 | 141 |
| 53 | 3300005355 | Ga0070671_101079056 | Ga0070671_1010790561 | 141 |
| 54 | 3300005356 | Ga0070674_100617139 | Ga0070674_1006171391 | 141 |
| 55 | 3300005364 | Ga0070673_100009318 | Ga0070673_1000093182 | 141 |
| 56 | 3300005365 | Ga0070688_100204529 | Ga0070688_1002045292 | 141 |
| 57 | 3300005366 | Ga0070659_100000484 | Ga0070659_1000004845 | 141 |
| 58 | 3300005367 | Ga0070667_100001690 | Ga0070667_10000169013 | 141 |
| 59 | 3300005367 | Ga0070667_100477551 | Ga0070667_1004775513 | 141 |
| 60 | 3300005444 | Ga0070694_101172891 | Ga0070694_1011728911 | 141 |
| 61 | 3300005455 | Ga0070663_100448236 | Ga0070663_1004482362 | 141 |
| 62 | 3300005457 | Ga0070662_100008355 | Ga0070662_1000083558 | 141 |
| 63 | 3300005457 | Ga0070662_100931227 | Ga0070662_1009312272 | 141 |
| 64 | 3300005458 | Ga0070681_10003822 | Ga0070681_100038225 | 141 |
| 65 | 3300005458 | Ga0070681_10006958 | Ga0070681_100069588 | 141 |
| 66 | 3300005459 | Ga0068867_100645524 | Ga0068867_1006455241 | 141 |
| 67 | 3300005467 | Ga0070706_100006360 | Ga0070706_1000063602 | 141 |
| 68 | 3300005467 | Ga0070706_100070735 | Ga0070706_1000707354 | 141 |
| 69 | 3300005468 | Ga0070707_100156060 | Ga0070707_1001560603 | 141 |
| 70 | 3300005468 | Ga0070707_100347554 | Ga0070707_1003475541 | 141 |
| 71 | 3300005471 | Ga0070698_100085494 | Ga0070698_1000854942 | 141 |
| 72 | 3300005530 | Ga0070679_100180309 | Ga0070679_1001803091 | 141 |
| 73 | 3300005536 | Ga0070697_100241597 | Ga0070697_1002415972 | 141 |
| 74 | 3300005539 | Ga0068853_100007840 | Ga0068853_1000078408 | 141 |
| 75 | 3300005539 | Ga0068853_100160911 | Ga0068853_1001609115 | 141 |
| 76 | 3300005539 | Ga0068853_100193633 | Ga0068853_1001936331 | 141 |
| 77 | 3300005544 | Ga0070686_100066795 | Ga0070686_1000667952 | 141 |
| 78 | 3300005545 | Ga0070695_100000132 | Ga0070695_10000013212 | 141 |
| 79 | 3300005545 | Ga0070695_100025817 | Ga0070695_1000258174 | 141 |
| 80 | 3300005545 | Ga0070695_100100854 | Ga0070695_1001008545 | 141 |
| 81 | 3300005545 | Ga0070695_100125865 | Ga0070695_1001258653 | 141 |
| 82 | 3300005546 | Ga0070696_100101723 | Ga0070696_1001017232 | 141 |
| 83 | 3300005547 | Ga0070693_100017854 | Ga0070693_1000178541 | 141 |
| 84 | 3300005547 | Ga0070693_100043145 | Ga0070693_1000431451 | 141 |
| 85 | 3300005549 | Ga0070704_100252335 | Ga0070704_1002523352 | 141 |
| 86 | 3300005563 | Ga0068855_100014323 | Ga0068855_1000143238 | 141 |
| 87 | 3300005564 | Ga0070664_100000591 | Ga0070664_10000059114 | 141 |
| 88 | 3300005564 | Ga0070664_100024412 | Ga0070664_1000244127 | 141 |
| 89 | 3300005564 | Ga0070664_100105343 | Ga0070664_1001053431 | 141 |
| 90 | 3300005577 | Ga0068857_100162411 | Ga0068857_1001624115 | 141 |
| 91 | 3300005578 | Ga0068854_100143907 | Ga0068854_1001439071 | 141 |
| 92 | 3300005614 | Ga0068856_100470557 | Ga0068856_1004705571 | 141 |
| 93 | 3300005615 | Ga0070702_100003845 | Ga0070702_1000038452 | 141 |
| 94 | 3300005615 | Ga0070702_100079277 | Ga0070702_1000792772 | 141 |
| 95 | 3300005617 | Ga0068859_100000901 | Ga0068859_10000090113 | 141 |
| 96 | 3300005617 | Ga0068859_100001569 | Ga0068859_10000156914 | 141 |
| 97 | 3300005617 | Ga0068859_102376055 | Ga0068859_1023760551 | 141 |
| 98 | 3300005618 | Ga0068864_100000087 | Ga0068864_10000008779 | 141 |
| 99 | 3300005618 | Ga0068864_100147223 | Ga0068864_1001472231 | 141 |
| 100 | 3300005618 | Ga0068864_100163737 | Ga0068864_1001637375 | 141 |
| 101 | 3300005718 | Ga0068866_11105390 | Ga0068866_111053902 | 141 |
| 102 | 3300005719 | Ga0068861_100004444 | Ga0068861_1000044449 | 141 |
| 103 | 3300005719 | Ga0068861_100004876 | Ga0068861_1000048767 | 141 |
| 104 | 3300005719 | Ga0068861_100144059 | Ga0068861_1001440592 | 141 |
| 105 | 3300005840 | Ga0068870_10072778 | Ga0068870_100727782 | 141 |
| 106 | 3300005840 | Ga0068870_10125825 | Ga0068870_101258252 | 141 |
| 107 | 3300005840 | Ga0068870_10174541 | Ga0068870_101745412 | 141 |
| 108 | 3300005841 | Ga0068863_100001792 | Ga0068863_10000179211 | 141 |
| 109 | 3300005841 | Ga0068863_100146305 | Ga0068863_1001463053 | 141 |
| 110 | 3300005841 | Ga0068863_100577467 | Ga0068863_1005774672 | 141 |
| 111 | 3300005842 | Ga0068858_100002332 | Ga0068858_1000023322 | 141 |
| 112 | 3300005842 | Ga0068858_101211974 | Ga0068858_1012119741 | 141 |
| 113 | 3300005843 | Ga0068860_100006501 | Ga0068860_1000065018 | 141 |
| 114 | 3300005844 | Ga0068862_100000534 | Ga0068862_10000053417 | 141 |
| 115 | 3300006237 | Ga0097621_100030316 | Ga0097621_1000303164 | 141 |
| 116 | 3300006844 | Ga0075428_101871349 | Ga0075428_1018713491 | 141 |
| 117 | 3300006847 | Ga0075431_100033343 | Ga0075431_1000333435 | 141 |
| 118 | 3300006931 | Ga0097620_100000901 | Ga0097620_10000090113 | 141 |
| 119 | 3300006931 | Ga0097620_100001569 | Ga0097620_10000156914 | 141 |
| 120 | 3300006931 | Ga0097620_102376146 | Ga0097620_1023761461 | 141 |
| 121 | 3300009093 | Ga0105240_10466607 | Ga0105240_104666071 | 141 |
| 122 | 3300009093 | Ga0105240_11347004 | Ga0105240_113470041 | 141 |
| 123 | 3300009098 | Ga0105245_10003699 | Ga0105245_100036991 | 141 |
| 124 | 3300009098 | Ga0105245_10003839 | Ga0105245_100038399 | 141 |
| 125 | 3300009098 | Ga0105245_10095267 | Ga0105245_100952675 | 141 |
| 126 | 3300009098 | Ga0105245_10705359 | Ga0105245_107053593 | 141 |
| 127 | 3300009098 | Ga0105245_12397036 | Ga0105245_123970361 | 141 |
| 128 | 3300009174 | Ga0105241_10012734 | Ga0105241_100127348 | 141 |
| 129 | 3300009174 | Ga0105241_10025138 | Ga0105241_100251384 | 141 |
| 130 | 3300009174 | Ga0105241_10070569 | Ga0105241_100705695 | 141 |
| 131 | 3300009174 | Ga0105241_11660406 | Ga0105241_116604062 | 141 |
| 132 | 3300009176 | Ga0105242_10005795 | Ga0105242_100057956 | 141 |
| 133 | 3300009176 | Ga0105242_10075240 | Ga0105242_100752402 | 141 |
| 134 | 3300009176 | Ga0105242_13317079 | Ga0105242_133170791 | 141 |
| 135 | 3300009177 | Ga0105248_10000703 | Ga0105248_1000070322 | 141 |
| 136 | 3300009177 | Ga0105248_10003512 | Ga0105248_1000351217 | 141 |
| 137 | 3300009177 | Ga0105248_11723217 | Ga0105248_117232172 | 141 |
| 138 | 3300009545 | Ga0105237_10723114 | Ga0105237_107231142 | 141 |
| 139 | 3300009551 | Ga0105238_10113728 | Ga0105238_101137281 | 141 |
| 140 | 3300009553 | Ga0105249_10172514 | Ga0105249_101725145 | 141 |
| 141 | 3300009553 | Ga0105249_13186979 | Ga0105249_131869791 | 141 |
| 142 | 3300010375 | Ga0105239_10007911 | Ga0105239_100079118 | 141 |
| 143 | 3300010375 | Ga0105239_10721631 | Ga0105239_107216311 | 141 |
| 144 | 3300010375 | Ga0105239_11217019 | Ga0105239_112170192 | 141 |
| 145 | 3300011119 | Ga0105246_10000492 | Ga0105246_100004925 | 141 |
| 146 | 3300011119 | Ga0105246_10128456 | Ga0105246_101284562 | 141 |
| 147 | 3300013100 | Ga0157373_10020765 | Ga0157373_100207654 | 141 |
| 148 | 3300013100 | Ga0157373_10125094 | Ga0157373_101250943 | 141 |
| 149 | 3300013105 | Ga0157369_10124752 | Ga0157369_101247521 | 141 |
| 150 | 3300013296 | Ga0157374_10023799 | Ga0157374_100237991 | 141 |
| 151 | 3300013297 | Ga0157378_10862282 | Ga0157378_108622821 | 141 |
| 152 | 3300013306 | Ga0163162_10151649 | Ga0163162_101516492 | 141 |
| 153 | 3300013306 | Ga0163162_10804142 | Ga0163162_108041421 | 141 |
| 154 | 3300013307 | Ga0157372_10027689 | Ga0157372_100276898 | 141 |
| 155 | 3300013308 | Ga0157375_10000009 | Ga0157375_10000009219 | 141 |
| 156 | 3300013308 | Ga0157375_12587475 | Ga0157375_125874752 | 141 |
| 157 | 3300013308 | Ga0157375_13001235 | Ga0157375_130012352 | 141 |
| 158 | 3300014325 | Ga0163163_10012245 | Ga0163163_100122454 | 141 |
| 159 | 3300014325 | Ga0163163_10060750 | Ga0163163_100607505 | 141 |
| 160 | 3300014325 | Ga0163163_10113617 | Ga0163163_101136173 | 141 |
| 161 | 3300014326 | Ga0157380_10000155 | Ga0157380_1000015517 | 141 |
| 162 | 3300014326 | Ga0157380_10916107 | Ga0157380_109161071 | 141 |
| 163 | 3300014326 | Ga0157380_11379939 | Ga0157380_113799392 | 141 |
| 164 | 3300014969 | Ga0157376_10001375 | Ga0157376_100013758 | 141 |
| 165 | 3300017792 | Ga0163161_10027471 | Ga0163161_100274713 | 141 |
| 166 | 3300025292 | Ga0209676_1009115 | Ga0209676_10091155 | 141 |
| 167 | 3300025292 | Ga0209676_1036520 | Ga0209676_10365204 | 141 |
| 168 | 3300025907 | Ga0207645_10347347 | Ga0207645_103473472 | 141 |
| 169 | 3300025908 | Ga0207643_10276031 | Ga0207643_102760312 | 141 |
| 170 | 3300025908 | Ga0207643_10370535 | Ga0207643_103705352 | 141 |
| 171 | 3300025910 | Ga0207684_10005957 | Ga0207684_100059571 | 141 |
| 172 | 3300025910 | Ga0207684_10047141 | Ga0207684_100471414 | 141 |
| 173 | 3300025911 | Ga0207654_10043838 | Ga0207654_100438385 | 141 |
| 174 | 3300025911 | Ga0207654_10298103 | Ga0207654_102981032 | 141 |
| 175 | 3300025911 | Ga0207654_10865826 | Ga0207654_108658261 | 141 |
| 176 | 3300025912 | Ga0207707_10044064 | Ga0207707_100440646 | 141 |
| 177 | 3300025912 | Ga0207707_10293123 | Ga0207707_102931232 | 141 |
| 178 | 3300025913 | Ga0207695_10722525 | Ga0207695_107225252 | 141 |
| 179 | 3300025917 | Ga0207660_10011476 | Ga0207660_100114764 | 141 |
| 180 | 3300025918 | Ga0207662_10305142 | Ga0207662_103051423 | 141 |
| 181 | 3300025919 | Ga0207657_10270376 | Ga0207657_102703762 | 141 |
| 182 | 3300025920 | Ga0207649_10007443 | Ga0207649_100074438 | 141 |
| 183 | 3300025920 | Ga0207649_10115036 | Ga0207649_101150362 | 141 |
| 184 | 3300025921 | Ga0207652_10015041 | Ga0207652_100150416 | 141 |
| 185 | 3300025923 | Ga0207681_10361917 | Ga0207681_103619173 | 141 |
| 186 | 3300025924 | Ga0207694_10458057 | Ga0207694_104580571 | 141 |
| 187 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004735 | 141 |
| 188 | 3300025926 | Ga0207659_10014539 | Ga0207659_100145391 | 141 |
| 189 | 3300025927 | Ga0207687_10000588 | Ga0207687_1000058813 | 141 |
| 190 | 3300025927 | Ga0207687_10002111 | Ga0207687_100021111 | 141 |
| 191 | 3300025931 | Ga0207644_10638229 | Ga0207644_106382292 | 141 |
| 192 | 3300025932 | Ga0207690_10027784 | Ga0207690_100277845 | 141 |
| 193 | 3300025933 | Ga0207706_10019075 | Ga0207706_100190756 | 141 |
| 194 | 3300025934 | Ga0207686_10002732 | Ga0207686_100027329 | 141 |
| 195 | 3300025934 | Ga0207686_10046830 | Ga0207686_100468305 | 141 |
| 196 | 3300025934 | Ga0207686_11688163 | Ga0207686_116881631 | 141 |
| 197 | 3300025936 | Ga0207670_10017537 | Ga0207670_100175376 | 141 |
| 198 | 3300025936 | Ga0207670_10059695 | Ga0207670_100596955 | 141 |
| 199 | 3300025936 | Ga0207670_10244517 | Ga0207670_102445174 | 141 |
| 200 | 3300025937 | Ga0207669_10956296 | Ga0207669_109562962 | 141 |
| 201 | 3300025941 | Ga0207711_10000973 | Ga0207711_1000097317 | 141 |
| 202 | 3300025941 | Ga0207711_10076817 | Ga0207711_100768175 | 141 |
| 203 | 3300025942 | Ga0207689_10001863 | Ga0207689_100018632 | 141 |
| 204 | 3300025942 | Ga0207689_10060802 | Ga0207689_100608023 | 141 |
| 205 | 3300025942 | Ga0207689_10475968 | Ga0207689_104759682 | 141 |
| 206 | 3300025944 | Ga0207661_10000194 | Ga0207661_100001946 | 141 |
| 207 | 3300025944 | Ga0207661_11036933 | Ga0207661_110369331 | 141 |
| 208 | 3300025945 | Ga0207679_10000255 | Ga0207679_1000025513 | 141 |
| 209 | 3300025945 | Ga0207679_10018522 | Ga0207679_100185225 | 141 |
| 210 | 3300025945 | Ga0207679_10146993 | Ga0207679_101469935 | 141 |
| 211 | 3300025949 | Ga0207667_10674720 | Ga0207667_106747201 | 141 |
| 212 | 3300025961 | Ga0207712_10102096 | Ga0207712_101020963 | 141 |
| 213 | 3300025961 | Ga0207712_11567721 | Ga0207712_115677211 | 141 |
| 214 | 3300025972 | Ga0207668_10040537 | Ga0207668_100405374 | 141 |
| 215 | 3300025981 | Ga0207640_10163742 | Ga0207640_101637423 | 141 |
| 216 | 3300025986 | Ga0207658_10001122 | Ga0207658_100011228 | 141 |
| 217 | 3300025986 | Ga0207658_10322274 | Ga0207658_103222744 | 141 |
| 218 | 3300026023 | Ga0207677_10047978 | Ga0207677_100479785 | 141 |
| 219 | 3300026035 | Ga0207703_10000601 | Ga0207703_100006012 | 141 |
| 220 | 3300026041 | Ga0207639_10000026 | Ga0207639_1000002669 | 141 |
| 221 | 3300026041 | Ga0207639_10657969 | Ga0207639_106579692 | 141 |
| 222 | 3300026067 | Ga0207678_10482253 | Ga0207678_104822532 | 141 |
| 223 | 3300026088 | Ga0207641_10915269 | Ga0207641_109152692 | 141 |
| 224 | 3300026095 | Ga0207676_10000143 | Ga0207676_1000014314 | 141 |
| 225 | 3300026095 | Ga0207676_10347068 | Ga0207676_103470683 | 141 |
| 226 | 3300026116 | Ga0207674_10000570 | Ga0207674_1000057025 | 141 |
| 227 | 3300026118 | Ga0207675_100010991 | Ga0207675_1000109919 | 141 |
| 228 | 3300026118 | Ga0207675_100027936 | Ga0207675_1000279362 | 141 |
| 229 | 3300026118 | Ga0207675_100291629 | Ga0207675_1002916291 | 141 |
| 230 | 3300026118 | Ga0207675_100576006 | Ga0207675_1005760062 | 141 |
| 231 | 3300026142 | Ga0207698_11163518 | Ga0207698_111635183 | 141 |
| 232 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011196 | 141 |
| 233 | 3300028380 | Ga0268265_11046528 | Ga0268265_110465281 | 141 |
| 234 | 3300028381 | Ga0268264_10007116 | Ga0268264_100071168 | 141 |
| 235 | 3300028381 | Ga0268264_11360426 | Ga0268264_113604262 | 141 |
| 236 | 3300028786 | Ga0307517_10258476 | Ga0307517_102584762 | 141 |
| 237 | 3300031911 | Ga0307412_10002083 | Ga0307412_1000208310 | 141 |
| 238 | 3300032002 | Ga0307416_102394241 | Ga0307416_1023942411 | 141 |
| 239 | 3300032005 | Ga0307411_10366435 | Ga0307411_103664352 | 141 |
| 240 | 3300035172 | Ga0373955_0098283 | Ga0373955_0098283_19_444 | 141 |
| 241 | 3300036401 | Ga0373937_0200129 | Ga0373937_0200129_619_1044 | 141 |
| 242 | 3300037471 | Ga0395905_0494785 | Ga0395905_0494785_493_921 | 141 |
| 243 | 3300037471 | Ga0395905_0555302 | Ga0395905_0555302_387_815 | 141 |
| 244 | 3300041512 | Ga0451853_0598517 | Ga0451853_0598517_85_510 | 141 |
| 245 | 3300042007 | Ga0439449_0164408 | Ga0439449_0164408_266_694 | 141 |
| 246 | 3300046474 | Ga0495605_0130413 | Ga0495605_0130413_277_702 | 141 |
| 247 | 3300046491 | Ga0495584_0268199 | Ga0495584_0268199_212_637 | 141 |
| 248 | 3300046506 | Ga0495583_0007506 | Ga0495583_0007506_12_437 | 141 |
| 249 | 3300046513 | Ga0495616_0000052 | Ga0495616_0000052_67193_67618 | 141 |
| 250 | 3300046515 | Ga0495620_0319791 | Ga0495620_0319791_135_563 | 141 |
| 251 | 3300046517 | Ga0495630_0600192 | Ga0495630_0600192_62_490 | 141 |
| 252 | 3300046522 | Ga0495643_0000079 | Ga0495643_0000079_115268_115693 | 141 |
| 253 | 3300046539 | Ga0495621_0245465 | Ga0495621_0245465_136_561 | 141 |
| 254 | 3300046542 | Ga0495597_0031431 | Ga0495597_0031431_1782_2207 | 141 |
| 255 | 3300046615 | Ga0495656_0153137 | Ga0495656_0153137_370_795 | 141 |
| 256 | 3300046615 | Ga0495656_0435787 | Ga0495656_0435787_77_502 | 141 |
| 257 | 3300046616 | Ga0495668_0091073 | Ga0495668_0091073_465_890 | 141 |
| 258 | 3300046660 | Ga0495625_0026470 | Ga0495625_0026470_1098_1523 | 141 |
| 259 | 3300046665 | Ga0495661_0034421 | Ga0495661_0034421_221_646 | 141 |
| 260 | 3300046691 | Ga0495670_0023487 | Ga0495670_0023487_2472_2897 | 141 |
| 261 | 3300046809 | Ga0495600_0634796 | Ga0495600_0634796_85_510 | 141 |
| 262 | 3300047323 | Ga0495683_0032760 | Ga0495683_0032760_647_1072 | 141 |
| 263 | 3300047443 | Ga0495687_000187 | Ga0495687_000187_61330_61755 | 141 |
| 264 | 3300047446 | Ga0495679_008567 | Ga0495679_008567_3448_3873 | 141 |
| 265 | 3300047472 | Ga0495686_0003318 | Ga0495686_0003318_5742_6191 | 141 |
| 266 | 3300048903 | Ga0496100_0019480 | Ga0496100_0019480_266_691 | 141 |
| 267 | 3300048904 | Ga0496101_0026284 | Ga0496101_0026284_3279_3704 | 141 |
| 268 | 3300048905 | Ga0496102_0004345 | Ga0496102_0004345_5915_6340 | 141 |
| 269 | 3300048907 | Ga0496104_0114200 | Ga0496104_0114200_106_531 | 141 |
| 270 | 3300048909 | Ga0496106_0010643 | Ga0496106_0010643_5570_5995 | 141 |
| 271 | 3300048909 | Ga0496106_0496681 | Ga0496106_0496681_306_731 | 141 |
| 272 | 3300048910 | Ga0496107_0167305 | Ga0496107_0167305_951_1376 | 141 |
| 273 | 3300048911 | Ga0496108_0002232 | Ga0496108_0002232_9878_10303 | 141 |
| 274 | 3300048912 | Ga0496109_0015121 | Ga0496109_0015121_4206_4631 | 141 |
| 275 | 3300048913 | Ga0496110_0005940 | Ga0496110_0005940_7058_7483 | 141 |
| 276 | 3300048914 | Ga0496111_0559459 | Ga0496111_0559459_87_512 | 141 |
| 277 | 3300048914 | Ga0496111_0812225 | Ga0496111_0812225_65_490 | 141 |
| 278 | 3300048915 | Ga0496112_0000842 | Ga0496112_0000842_11589_12014 | 141 |
| 279 | 3300048915 | Ga0496112_0219340 | Ga0496112_0219340_798_1223 | 141 |
| 280 | 3300048916 | Ga0496113_0100198 | Ga0496113_0100198_434_859 | 141 |
| 281 | 3300048918 | Ga0496115_0011104 | Ga0496115_0011104_944_1369 | 141 |
| 282 | 3300049515 | Ga0501292_022894 | Ga0501292_022894_260_685 | 141 |
| 283 | 3300049587 | Ga0501071_0159605 | Ga0501071_0159605_329_754 | 141 |
| 284 | 3300049668 | Ga0501233_038491 | Ga0501233_038491_447_872 | 141 |
| 285 | 3300049669 | Ga0501235_034101 | Ga0501235_034101_199_624 | 141 |
| 286 | 3300049675 | Ga0501243_051239 | Ga0501243_051239_272_697 | 141 |
| 287 | 3300049686 | Ga0501257_048160 | Ga0501257_048160_413_838 | 141 |
| 288 | 3300049704 | Ga0501221_008480 | Ga0501221_008480_343_768 | 141 |
| 289 | 3300049707 | Ga0501234_020525 | Ga0501234_020525_395_820 | 141 |
| 290 | 3300049762 | Ga0501265_075827 | Ga0501265_075827_11_436 | 141 |
| 291 | 3300049770 | Ga0501273_011983 | Ga0501273_011983_335_760 | 141 |
| 292 | 3300050510 | nmdc:mga06r32_133702_c1 | nmdc:mga06r32_133702_c1_730_1155 | 141 |
| 293 | 3300053093 | Ga0500651_0032137 | Ga0500651_0032137_873_1298 | 141 |
| 294 | 3300053130 | Ga0500642_0201141 | Ga0500642_0201141_386_811 | 141 |
| 295 | 3300053139 | Ga0500568_0003238 | Ga0500568_0003238_6195_6620 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yw0-assembly1.cif.gz_B | bacteroides fragilis hcp5 | 0.7101 | 10 | 140 |
| 7aeb-assembly1.cif.gz_Y | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. | 0.709 | 10 | 141 |
| 8gra-assembly1.cif.gz_E | structure of type vi secretion system cargo delivery vehicle hcp-vgrg-paar | 0.7004 | 10 | 140 |
| 7yw0-assembly1.cif.gz_A | bacteroides fragilis hcp5 | 0.6982 | 10 | 140 |
| 6bdc-assembly1.cif.gz_A | structure of hcp1 from flavobacterium johnsoniae | 0.6969 | 10 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P46855_3_149_2.30.110.20 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6662 | 33 | 137 | 2.30.110.20 |
| af_Q550Q3_44_421_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.6615 | 31 | 63 | 3.40.630.10 |
| af_Q9VEQ0_8_287_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.6547 | 83 | 105 | 3.30.420.40 |
| 5xeuF00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.6248 | 10 | 139 | 2.30.110.20 |
| 5xhhA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.5967 | 11 | 137 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A413W1T0-F1-model_v4 | deleted | 0.8341 | 10 | 141 |
|
| AF-A0A4Q3J232-F1-model_v4 | Phage tail protein | 0.8334 | 57 | 141 |
GO:0005198
|
| AF-A0A3M1E306-F1-model_v4 | Phage tail protein | 0.8313 | 61 | 140 |
GO:0005198
|
| AF-A0A536KB96-F1-model_v4 | Phage tail protein | 0.8294 | 11 | 141 |
GO:0005198
|
| AF-A0A4Y8PPI9-F1-model_v4 | deleted | 0.8289 | 15 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar