F392516

General Info

Members Datasets Scaffolds Average Seq Length
295 173 590 662

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100017503|Ga0070705_1000175031
Length 720
Sequence MASAAFGRPRLRHLREAVVTRRFVGLQVAPNRMSGGMMRNARWVTLGVTLVLTAGLATYAKRRVVAAASPADAVTAGEFIVDPPTLINLGFEWFVDGDENRNATVDVTYRKQGSTDWKQALPMLRLHGERIKQGDQIDVISPNMFAGSILDLEPNTSYEARFVLRDPDGARGQTTKTFTVKTRAEPMPASGGNVYHVYPPGYKGQKSEPSFEGLMCAYNLTCAGTDWATAGRPRVKAGDIILVHAGLYKYNRYEYTNDPAVNRTEPLDGTYYLLAKGTPEKPIALFDVRAADYNYFEGLTFRNTDYAILAGTQFLAGAKGITVKHCRFEDIGAGVFTNFSGSSNFYIADNYFIGRHDPEHVMGWSGEFWRKFDGKDGQKFPPVMGSYIAVKVYGPGHVIAYNYVANFHDGIDTETYGNPDGSAAVDGPKYPTREYFDKRTVSIDYYNNYMTNFHDNPFEVDGSMHNVRVLRNMMINSASHAFCNQPAIGGPVYWVRNIVYHMPGGSTRLTGGAAGAIFYNNTVLSETQAQPAIFTVNTYTNYSSSDYNGFRPNAGAPYSFGWNSPPWTTAADYAPLLRGRGFGPAPTPGTAQGGRGGPDVXXXXAAPAGLETRQFKTLDEYSRATHQDAHSVLVDYDVFMDVPKLDAQDIATVQKVYKAESFDFRLKPGSAAVDKGTVLANITDGFAGRAPDLGALEVGQPLPHFGPREPTKQPPSSPRQ

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 2.37
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100017503 3300005440 Unclassified 3742
2 JGI25406J46586_10005535 3300003203 Bacteria 5849
3 Ga0065712_10072840 3300005290 Bacteria 4588
4 Ga0065712_10078011 3300005290 Bacteria 3403
5 Ga0070676_10001351 3300005328 Bacteria 12334
6 Ga0070670_100015425 3300005331 Bacteria 6561
7 Ga0068869_100005733 3300005334 Bacteria 7839
8 Ga0070666_10005341 3300005335 Bacteria 7876
9 Ga0070691_10009139 3300005341 Unclassified 4530
10 Ga0070675_100003784 3300005354 Bacteria 11492
11 Ga0070675_100016260 3300005354 Bacteria 5902
12 Ga0070675_100016498 3300005354 Bacteria 5864
13 Ga0070671_100012656 3300005355 Bacteria 6800
14 Ga0070673_100011191 3300005364 Bacteria 6117
15 Ga0070688_100039978 3300005365 Unclassified 2872
16 Ga0070667_100011139 3300005367 Bacteria 7439
17 Ga0070667_100059525 3300005367 Bacteria 3231
18 Ga0070714_100013818 3300005435 Bacteria 6474
19 Ga0070713_100007267 3300005436 Bacteria 7756
20 Ga0070713_100024747 3300005436 Bacteria 4684
21 Ga0070694_100017158 3300005444 Bacteria 4570
22 Ga0070708_100029332 3300005445 Bacteria 4743
23 Ga0070678_100004431 3300005456 Bacteria 7967
24 Ga0070706_100033815 3300005467 Unclassified 4720
25 Ga0070706_100107550 3300005467 Bacteria 2595
26 Ga0070707_100017471 3300005468 Bacteria 6744
27 Ga0070707_100045874 3300005468 Bacteria 4182
28 Ga0070698_100004895 3300005471 Bacteria 14698
29 Ga0070699_100004180 3300005518 Bacteria 12774
30 Ga0070679_100035875 3300005530 Unclassified 4920
31 Ga0070684_100063286 3300005535 Bacteria 3242
32 Ga0070684_100138290 3300005535 Bacteria 2201
33 Ga0070697_100022001 3300005536 Bacteria 5059
34 Ga0070672_100013765 3300005543 Bacteria 5719
35 Ga0070672_100065216 3300005543 Bacteria 2880
36 Ga0070686_100006072 3300005544 Bacteria 6702
37 Ga0070686_100011735 3300005544 Bacteria 4977
38 Ga0070695_100005693 3300005545 Bacteria 7348
39 Ga0070696_100018678 3300005546 Unclassified 4690
40 Ga0070665_100008583 3300005548 Bacteria 10339
41 Ga0070665_100083683 3300005548 Bacteria 3195
42 Ga0070704_100045839 3300005549 Unclassified 3044
43 Ga0068855_100035460 3300005563 Bacteria 5941
44 Ga0070664_100021042 3300005564 Bacteria 5373
45 Ga0070664_100021699 3300005564 Bacteria 5296
46 Ga0070664_100084383 3300005564 Bacteria 2742
47 Ga0068854_100032359 3300005578 Unclassified 3639
48 Ga0068852_100125326 3300005616 Unclassified 2358
49 Ga0068859_100033505 3300005617 Bacteria 5158
50 Ga0068859_100133194 3300005617 Bacteria 2557
51 Ga0068864_100008394 3300005618 Bacteria 8523
52 Ga0068864_100028669 3300005618 Bacteria 4709
53 Ga0068864_100049282 3300005618 Bacteria 3623
54 Ga0068864_100112559 3300005618 Bacteria 2426
55 Ga0068851_10021146 3300005834 Bacteria 3158
56 Ga0068863_100005972 3300005841 Bacteria 11943
57 Ga0068863_100015355 3300005841 Bacteria 7360
58 Ga0068860_100011370 3300005843 Bacteria 8772
59 Ga0068860_100050042 3300005843 Bacteria 3979
60 Ga0068860_100103876 3300005843 Bacteria 2712
61 Ga0081539_10000134 3300005985 Bacteria 173625
62 Ga0081539_10001280 3300005985 Bacteria 44281
63 Ga0081539_10003338 3300005985 Bacteria 19954
64 Ga0097621_100000466 3300006237 Bacteria 28353
65 Ga0097621_100001289 3300006237 Bacteria 17246
66 Ga0097621_100026463 3300006237 Bacteria 4551
67 Ga0097621_100033412 3300006237 Bacteria 4097
68 Ga0097621_100042783 3300006237 Unclassified 3650
69 Ga0097621_100053724 3300006237 Bacteria 3283
70 Ga0097621_100059109 3300006237 Unclassified 3137
71 Ga0068871_100000283 3300006358 Bacteria 35327
72 Ga0068871_100000996 3300006358 Bacteria 18967
73 Ga0068871_100005546 3300006358 Bacteria 8849
74 Ga0068871_100012825 3300006358 Bacteria 6203
75 Ga0068871_100014758 3300006358 Bacteria 5831
76 Ga0068871_100020196 3300006358 Bacteria 5099
77 Ga0068871_100045236 3300006358 Bacteria 3542
78 Ga0068871_100108211 3300006358 Bacteria 2336
79 Ga0075428_100024242 3300006844 Bacteria 6711
80 Ga0075428_100031290 3300006844 Bacteria 5884
81 Ga0075431_100015959 3300006847 Bacteria 7620
82 Ga0075431_100016708 3300006847 Bacteria 7452
83 Ga0075433_10047697 3300006852 Unclassified 3726
84 Ga0075434_100000153 3300006871 Bacteria 42782
85 Ga0075434_100002564 3300006871 Bacteria 16045
86 Ga0075434_100006881 3300006871 Bacteria 10475
87 Ga0068865_100001368 3300006881 Bacteria 14184
88 Ga0068865_100003776 3300006881 Bacteria 9092
89 Ga0068865_100003830 3300006881 Bacteria 9027
90 Ga0068865_100008452 3300006881 Bacteria 6363
91 Ga0075436_100060711 3300006914 Unclassified 2612
92 Ga0097620_100033506 3300006931 Bacteria 5158
93 Ga0097620_100133199 3300006931 Bacteria 2557
94 Ga0075435_100000010 3300007076 Bacteria 112658
95 Ga0075435_100000243 3300007076 Bacteria 33666
96 Ga0105240_10128526 3300009093 Unclassified 3042
97 Ga0105240_10144913 3300009093 Unclassified 2835
98 Ga0111539_10002931 3300009094 Bacteria 22620
99 Ga0111539_10007363 3300009094 Bacteria 14101
100 Ga0105245_10000192 3300009098 Bacteria 57750
101 Ga0105245_10006180 3300009098 Bacteria 10539
102 Ga0105245_10064095 3300009098 Bacteria 3321
103 Ga0114129_10010317 3300009147 Bacteria 13330
104 Ga0114129_10012468 3300009147 Bacteria 12101
105 Ga0114129_10041891 3300009147 Bacteria 6448
106 Ga0114129_10078219 3300009147 Bacteria 4601
107 Ga0105241_10028979 3300009174 Bacteria 4126
108 Ga0105241_10035682 3300009174 Bacteria 3740
109 Ga0105242_10003527 3300009176 Bacteria 12160
110 Ga0105248_10000600 3300009177 Bacteria 41051
111 Ga0105248_10002583 3300009177 Bacteria 20126
112 Ga0105248_10015774 3300009177 Bacteria 8326
113 Ga0105248_10028702 3300009177 Bacteria 6201
114 Ga0105248_10087344 3300009177 Unclassified 3509
115 Ga0105248_10145301 3300009177 Bacteria 2676
116 Ga0105238_10001055 3300009551 Bacteria 27867
117 Ga0105238_10020189 3300009551 Bacteria 6781
118 Ga0105238_10041619 3300009551 Bacteria 4653
119 Ga0105249_10005217 3300009553 Bacteria 11215
120 Ga0105239_10029975 3300010375 Bacteria 5984
121 Ga0105246_10022347 3300011119 Bacteria 4080
122 Ga0157371_10083285 3300013102 Bacteria 2265
123 Ga0157370_10006028 3300013104 Bacteria 13476
124 Ga0157374_10038843 3300013296 Bacteria 4377
125 Ga0157378_10002679 3300013297 Bacteria 15864
126 Ga0163162_10030614 3300013306 Bacteria 5332
127 Ga0157372_10012651 3300013307 Bacteria 8990
128 Ga0157375_10009539 3300013308 Bacteria 8522
129 Ga0163163_10000205 3300014325 Bacteria 61330
130 Ga0163163_10000629 3300014325 Bacteria 30399
131 Ga0163163_10014495 3300014325 Bacteria 7248
132 Ga0163163_10028285 3300014325 Bacteria 5380
133 Ga0163163_10107480 3300014325 Bacteria 2817
134 Ga0157379_10007456 3300014968 Bacteria 9473
135 Ga0157376_10056469 3300014969 Bacteria 3280
136 Ga0207680_10005926 3300025903 Bacteria 5872
137 Ga0207684_10080570 3300025910 Bacteria 2770
138 Ga0207695_10006546 3300025913 Bacteria 15085
139 Ga0207695_10143904 3300025913 Unclassified 2330
140 Ga0207663_10020780 3300025916 Bacteria 3725
141 Ga0207657_10068196 3300025919 Bacteria 3022
142 Ga0207646_10023591 3300025922 Bacteria 5649
143 Ga0207694_10018545 3300025924 Bacteria 5258
144 Ga0207694_10074772 3300025924 Bacteria 2652
145 Ga0207650_10010824 3300025925 Bacteria 6267
146 Ga0207650_10011321 3300025925 Bacteria 6138
147 Ga0207650_10046485 3300025925 Bacteria 3196
148 Ga0207687_10002182 3300025927 Bacteria 13363
149 Ga0207687_10011438 3300025927 Bacteria 5800
150 Ga0207687_10026143 3300025927 Bacteria 3908
151 Ga0207687_10063469 3300025927 Unclassified 2615
152 Ga0207700_10028982 3300025928 Bacteria 3902
153 Ga0207644_10059352 3300025931 Unclassified 2767
154 Ga0207706_10103486 3300025933 Unclassified 2505
155 Ga0207686_10006396 3300025934 Bacteria 6339
156 Ga0207686_10007540 3300025934 Bacteria 5858
157 Ga0207686_10039417 3300025934 Bacteria 2866
158 Ga0207709_10053779 3300025935 Bacteria 2479
159 Ga0207704_10003431 3300025938 Bacteria 7206
160 Ga0207704_10006354 3300025938 Bacteria 5506
161 Ga0207691_10008888 3300025940 Bacteria 9646
162 Ga0207691_10021430 3300025940 Bacteria 6102
163 Ga0207691_10022723 3300025940 Bacteria 5913
164 Ga0207691_10028833 3300025940 Bacteria 5195
165 Ga0207711_10000383 3300025941 Bacteria 46870
166 Ga0207711_10020714 3300025941 Bacteria 5487
167 Ga0207711_10055002 3300025941 Bacteria 3417
168 Ga0207711_10096130 3300025941 Bacteria 2614
169 Ga0207711_10101238 3300025941 Unclassified 2549
170 Ga0207689_10003712 3300025942 Bacteria 13914
171 Ga0207661_10022768 3300025944 Bacteria 4724
172 Ga0207661_10046045 3300025944 Bacteria 3457
173 Ga0207679_10009290 3300025945 Bacteria 6291
174 Ga0207667_10004565 3300025949 Bacteria 16978
175 Ga0207651_10069435 3300025960 Bacteria 2488
176 Ga0207712_10051773 3300025961 Bacteria 2873
177 Ga0207640_10040460 3300025981 Unclassified 2957
178 Ga0207703_10007927 3300026035 Bacteria 8395
179 Ga0207639_10035480 3300026041 Unclassified 3691
180 Ga0207702_10086032 3300026078 Bacteria 2740
181 Ga0207641_10016394 3300026088 Bacteria 6067
182 Ga0207648_10004620 3300026089 Bacteria 14111
183 Ga0207648_10004794 3300026089 Bacteria 13810
184 Ga0207648_10017466 3300026089 Bacteria 6527
185 Ga0207648_10026276 3300026089 Bacteria 5175
186 Ga0207676_10015696 3300026095 Bacteria 5471
187 Ga0207676_10019530 3300026095 Bacteria 4946
188 Ga0207676_10051873 3300026095 Bacteria 3204
189 Ga0207676_10091986 3300026095 Bacteria 2493
190 Ga0207674_10000496 3300026116 Bacteria 51908
191 Ga0207674_10049750 3300026116 Bacteria 4285
192 Ga0207675_100031450 3300026118 Bacteria 4943
193 Ga0207675_100100383 3300026118 Bacteria 2726
194 Ga0207683_10001405 3300026121 Bacteria 21745
195 Ga0207683_10011006 3300026121 Bacteria 7713
196 Ga0207428_10005034 3300027907 Bacteria 12419
197 Ga0207428_10016054 3300027907 Bacteria 6453
198 Ga0268266_10010951 3300028379 Bacteria 7894
199 Ga0268264_10031733 3300028381 Bacteria 4332
200 Ga0268264_10055105 3300028381 Unclassified 3322
201 Ga0268264_10120744 3300028381 Unclassified 2309
202 Ga0265334_10004667 3300028573 Bacteria 6043
203 Ga0265318_10000603 3300028577 Bacteria 25035
204 Ga0265332_10005362 3300031238 Bacteria 5921
205 Ga0265328_10016227 3300031239 Bacteria 2901
206 Ga0265325_10001367 3300031241 Bacteria 17222
207 Ga0265313_10011103 3300031595 Bacteria 5618
208 Ga0265313_10019098 3300031595 Bacteria 3829
209 Ga0265314_10025847 3300031711 Bacteria 4421
210 Ga0265314_10049286 3300031711 Unclassified 2949
211 Ga0307516_10021835 3300031730 Bacteria 6578
212 Ga0307410_10027295 3300031852 Bacteria 3607
213 Ga0307411_10043586 3300032005 Bacteria 2871
214 Ga0373938_0004707 3300034957 Unclassified 2289
215 Ga0373940_0004001 3300035088 Bacteria 3077
216 Ga0373932_0003195 3300035112 Bacteria 3980
217 Ga0373954_0017734 3300035118 Bacteria 3200
218 Ga0373960_0002081 3300035121 Bacteria 4502
219 Ga0373946_0011039 3300035171 Bacteria 3359
220 Ga0373927_0000461 3300035695 Bacteria 31104
221 Ga0373933_0014295 3300035724 Bacteria 4413
222 Ga0373947_0003616 3300035725 Bacteria 9123
223 Ga0373937_0003859 3300036401 Bacteria 12675
224 Ga0373937_0017997 3300036401 Bacteria 6302
225 Ga0373937_0022885 3300036401 Bacteria 5620
226 Ga0373937_0053778 3300036401 Bacteria 3693
227 Ga0373937_0094169 3300036401 Bacteria 2777
228 Ga0373925_0000106 3300037068 Bacteria 89944
229 Ga0436364_0730380 3300037853 Bacteria 13085
230 Ga0436365_1756439 3300039437 Bacteria 5291
231 Ga0451793_0087291 3300041452 Bacteria 2369
232 Ga0495592_0052692 3300046454 Bacteria 3020
233 Ga0495651_0074523 3300046462 Bacteria 2575
234 Ga0495580_0017870 3300046472 Bacteria 5290
235 Ga0495662_0034626 3300046476 Unclassified 2437
236 Ga0495664_0038727 3300046477 Bacteria 2815
237 Ga0495608_0071527 3300046511 Bacteria 2263
238 Ga0495618_0015136 3300046514 Bacteria 4705
239 Ga0495628_0039175 3300046516 Bacteria 3791
240 Ga0495628_0125623 3300046516 Unclassified 1966
241 Ga0495586_0020914 3300046535 Bacteria 3487
242 Ga0495587_0000365 3300046536 Bacteria 32561
243 Ga0495622_0003202 3300046557 Bacteria 7755
244 Ga0495634_0037419 3300046642 Bacteria 3315
245 Ga0495657_0002931 3300046675 Bacteria 14155
246 Ga0495658_0011774 3300046683 Unclassified 4409
247 Ga0495613_0004335 3300046689 Bacteria 10626
248 Ga0495613_0016449 3300046689 Bacteria 5509
249 Ga0495613_0028151 3300046689 Bacteria 4180
250 Ga0495613_0052397 3300046689 Unclassified 3006
251 Ga0495674_0061668 3300047319 Unclassified 3267
252 Ga0495674_0080861 3300047319 Bacteria 2788
253 Ga0495684_0000024 3300047471 Bacteria 129369
254 Ga0495684_0070309 3300047471 Bacteria 2661
255 Ga0495602_0000797 3300048088 Bacteria 30094
256 Ga0496101_0001146 3300048904 Bacteria 15848
257 Ga0496104_0045823 3300048907 Bacteria 4114
258 Ga0496110_0106410 3300048913 Bacteria 2517
259 Ga0496112_0024577 3300048915 Bacteria 5773
260 Ga0496112_0057823 3300048915 Bacteria 3819
261 Ga0496114_0000363 3300048917 Bacteria 33231
262 Ga0501033_0005131 3300049570 Bacteria 10415
263 Ga0501034_0059534 3300049571 Unclassified 3836
264 Ga0501040_0024704 3300049576 Bacteria 4035
265 Ga0501076_0036677 3300049592 Bacteria 3842
266 Ga0501080_0038375 3300049742 Bacteria 4472
267 Ga0501035_0033402 3300049822 Bacteria 4679
268 Ga0501044_0004436 3300049823 Bacteria 15703
269 nmdc:mga05p37_169335_c1 3300050507 Unclassified 2665
270 nmdc:mga05p37_22032_c1 3300050507 Bacteria 7721
271 nmdc:mga05p37_30012_c1 3300050507 Bacteria 6635
272 nmdc:mga05p37_38477_c1 3300050507 Bacteria 5868
273 nmdc:mga09592_103368_c1 3300050508 Bacteria 2441
274 nmdc:mga09592_10703_c1 3300050508 Bacteria 7467
275 nmdc:mga06r32_12641_c1 3300050510 Bacteria 7628
276 nmdc:mga06r32_88781_c1 3300050510 Unclassified 3018
277 nmdc:mga08y16_1017_c1 3300050511 Bacteria 27488
278 nmdc:mga08y16_11851_c1 3300050511 Bacteria 9158
279 nmdc:mga08y16_1273_c1 3300050511 Bacteria 25029
280 nmdc:mga08y16_13454_c1 3300050511 Bacteria 8610
281 nmdc:mga08y16_141494_c1 3300050511 Bacteria 2501
282 nmdc:mga08y16_50980_c1 3300050511 Unclassified 4330
283 nmdc:mga0n895_150_c1 3300050512 Bacteria 42831
284 nmdc:mga0n895_19274_c1 3300050512 Bacteria 6337
285 nmdc:mga0n895_99698_c1 3300050512 Bacteria 2913
286 nmdc:mga0rr50_12_c1 3300050513 Bacteria 215691
287 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
288 nmdc:mga0rr50_30429_c1 3300050513 Unclassified 3822
289 nmdc:mga08x19_1208_c1 3300050514 Bacteria 16115
290 nmdc:mga08x19_166_c1 3300050514 Bacteria 54784
291 nmdc:mga0a205_18589_c1 3300050515 Bacteria 6538
292 nmdc:mga0a205_18959_c2 3300050515 Bacteria 5268
293 Ga0495601_0015767 3300053077 Bacteria 4572
294 Ga0500595_003694 3300053119 Bacteria 7067
295 Ga0500573_0000003 3300053140 Bacteria 355643
296 Ga0070705_100017503
297 JGI25406J46586_10005535
298 Ga0065712_10072840
299 Ga0065712_10078011
300 Ga0070676_10001351
301 Ga0070670_100015425
302 Ga0068869_100005733
303 Ga0070666_10005341
304 Ga0070691_10009139
305 Ga0070675_100003784
306 Ga0070675_100016260
307 Ga0070675_100016498
308 Ga0070671_100012656
309 Ga0070673_100011191
310 Ga0070688_100039978
311 Ga0070667_100011139
312 Ga0070667_100059525
313 Ga0070714_100013818
314 Ga0070713_100007267
315 Ga0070713_100024747
316 Ga0070694_100017158
317 Ga0070708_100029332
318 Ga0070678_100004431
319 Ga0070706_100033815
320 Ga0070706_100107550
321 Ga0070707_100017471
322 Ga0070707_100045874
323 Ga0070698_100004895
324 Ga0070699_100004180
325 Ga0070679_100035875
326 Ga0070684_100063286
327 Ga0070684_100138290
328 Ga0070697_100022001
329 Ga0070672_100013765
330 Ga0070672_100065216
331 Ga0070686_100006072
332 Ga0070686_100011735
333 Ga0070695_100005693
334 Ga0070696_100018678
335 Ga0070665_100008583
336 Ga0070665_100083683
337 Ga0070704_100045839
338 Ga0068855_100035460
339 Ga0070664_100021042
340 Ga0070664_100021699
341 Ga0070664_100084383
342 Ga0068854_100032359
343 Ga0068852_100125326
344 Ga0068859_100033505
345 Ga0068859_100133194
346 Ga0068864_100008394
347 Ga0068864_100028669
348 Ga0068864_100049282
349 Ga0068864_100112559
350 Ga0068851_10021146
351 Ga0068863_100005972
352 Ga0068863_100015355
353 Ga0068860_100011370
354 Ga0068860_100050042
355 Ga0068860_100103876
356 Ga0081539_10000134
357 Ga0081539_10001280
358 Ga0081539_10003338
359 Ga0097621_100000466
360 Ga0097621_100001289
361 Ga0097621_100026463
362 Ga0097621_100033412
363 Ga0097621_100042783
364 Ga0097621_100053724
365 Ga0097621_100059109
366 Ga0068871_100000283
367 Ga0068871_100000996
368 Ga0068871_100005546
369 Ga0068871_100012825
370 Ga0068871_100014758
371 Ga0068871_100020196
372 Ga0068871_100045236
373 Ga0068871_100108211
374 Ga0075428_100024242
375 Ga0075428_100031290
376 Ga0075431_100015959
377 Ga0075431_100016708
378 Ga0075433_10047697
379 Ga0075434_100000153
380 Ga0075434_100002564
381 Ga0075434_100006881
382 Ga0068865_100001368
383 Ga0068865_100003776
384 Ga0068865_100003830
385 Ga0068865_100008452
386 Ga0075436_100060711
387 Ga0097620_100033506
388 Ga0097620_100133199
389 Ga0075435_100000010
390 Ga0075435_100000243
391 Ga0105240_10128526
392 Ga0105240_10144913
393 Ga0111539_10002931
394 Ga0111539_10007363
395 Ga0105245_10000192
396 Ga0105245_10006180
397 Ga0105245_10064095
398 Ga0114129_10010317
399 Ga0114129_10012468
400 Ga0114129_10041891
401 Ga0114129_10078219
402 Ga0105241_10028979
403 Ga0105241_10035682
404 Ga0105242_10003527
405 Ga0105248_10000600
406 Ga0105248_10002583
407 Ga0105248_10015774
408 Ga0105248_10028702
409 Ga0105248_10087344
410 Ga0105248_10145301
411 Ga0105238_10001055
412 Ga0105238_10020189
413 Ga0105238_10041619
414 Ga0105249_10005217
415 Ga0105239_10029975
416 Ga0105246_10022347
417 Ga0157371_10083285
418 Ga0157370_10006028
419 Ga0157374_10038843
420 Ga0157378_10002679
421 Ga0163162_10030614
422 Ga0157372_10012651
423 Ga0157375_10009539
424 Ga0163163_10000205
425 Ga0163163_10000629
426 Ga0163163_10014495
427 Ga0163163_10028285
428 Ga0163163_10107480
429 Ga0157379_10007456
430 Ga0157376_10056469
431 Ga0207680_10005926
432 Ga0207684_10080570
433 Ga0207695_10006546
434 Ga0207695_10143904
435 Ga0207663_10020780
436 Ga0207657_10068196
437 Ga0207646_10023591
438 Ga0207694_10018545
439 Ga0207694_10074772
440 Ga0207650_10010824
441 Ga0207650_10011321
442 Ga0207650_10046485
443 Ga0207687_10002182
444 Ga0207687_10011438
445 Ga0207687_10026143
446 Ga0207687_10063469
447 Ga0207700_10028982
448 Ga0207644_10059352
449 Ga0207706_10103486
450 Ga0207686_10006396
451 Ga0207686_10007540
452 Ga0207686_10039417
453 Ga0207709_10053779
454 Ga0207704_10003431
455 Ga0207704_10006354
456 Ga0207691_10008888
457 Ga0207691_10021430
458 Ga0207691_10022723
459 Ga0207691_10028833
460 Ga0207711_10000383
461 Ga0207711_10020714
462 Ga0207711_10055002
463 Ga0207711_10096130
464 Ga0207711_10101238
465 Ga0207689_10003712
466 Ga0207661_10022768
467 Ga0207661_10046045
468 Ga0207679_10009290
469 Ga0207667_10004565
470 Ga0207651_10069435
471 Ga0207712_10051773
472 Ga0207640_10040460
473 Ga0207703_10007927
474 Ga0207639_10035480
475 Ga0207702_10086032
476 Ga0207641_10016394
477 Ga0207648_10004620
478 Ga0207648_10004794
479 Ga0207648_10017466
480 Ga0207648_10026276
481 Ga0207676_10015696
482 Ga0207676_10019530
483 Ga0207676_10051873
484 Ga0207676_10091986
485 Ga0207674_10000496
486 Ga0207674_10049750
487 Ga0207675_100031450
488 Ga0207675_100100383
489 Ga0207683_10001405
490 Ga0207683_10011006
491 Ga0207428_10005034
492 Ga0207428_10016054
493 Ga0268266_10010951
494 Ga0268264_10031733
495 Ga0268264_10055105
496 Ga0268264_10120744
497 Ga0265334_10004667
498 Ga0265318_10000603
499 Ga0265332_10005362
500 Ga0265328_10016227
501 Ga0265325_10001367
502 Ga0265313_10011103
503 Ga0265313_10019098
504 Ga0265314_10025847
505 Ga0265314_10049286
506 Ga0307516_10021835
507 Ga0307410_10027295
508 Ga0307411_10043586
509 Ga0373938_0004707
510 Ga0373940_0004001
511 Ga0373932_0003195
512 Ga0373954_0017734
513 Ga0373960_0002081
514 Ga0373946_0011039
515 Ga0373927_0000461
516 Ga0373933_0014295
517 Ga0373947_0003616
518 Ga0373937_0003859
519 Ga0373937_0017997
520 Ga0373937_0022885
521 Ga0373937_0053778
522 Ga0373937_0094169
523 Ga0373925_0000106
524 Ga0436364_0730380
525 Ga0436365_1756439
526 Ga0451793_0087291
527 Ga0495592_0052692
528 Ga0495651_0074523
529 Ga0495580_0017870
530 Ga0495662_0034626
531 Ga0495664_0038727
532 Ga0495608_0071527
533 Ga0495618_0015136
534 Ga0495628_0039175
535 Ga0495628_0125623
536 Ga0495586_0020914
537 Ga0495587_0000365
538 Ga0495622_0003202
539 Ga0495634_0037419
540 Ga0495657_0002931
541 Ga0495658_0011774
542 Ga0495613_0004335
543 Ga0495613_0016449
544 Ga0495613_0028151
545 Ga0495613_0052397
546 Ga0495674_0061668
547 Ga0495674_0080861
548 Ga0495684_0000024
549 Ga0495684_0070309
550 Ga0495602_0000797
551 Ga0496101_0001146
552 Ga0496104_0045823
553 Ga0496110_0106410
554 Ga0496112_0024577
555 Ga0496112_0057823
556 Ga0496114_0000363
557 Ga0501033_0005131
558 Ga0501034_0059534
559 Ga0501040_0024704
560 Ga0501076_0036677
561 Ga0501080_0038375
562 Ga0501035_0033402
563 Ga0501044_0004436
564 nmdc:mga05p37_169335_c1
565 nmdc:mga05p37_22032_c1
566 nmdc:mga05p37_30012_c1
567 nmdc:mga05p37_38477_c1
568 nmdc:mga09592_103368_c1
569 nmdc:mga09592_10703_c1
570 nmdc:mga06r32_12641_c1
571 nmdc:mga06r32_88781_c1
572 nmdc:mga08y16_1017_c1
573 nmdc:mga08y16_11851_c1
574 nmdc:mga08y16_1273_c1
575 nmdc:mga08y16_13454_c1
576 nmdc:mga08y16_141494_c1
577 nmdc:mga08y16_50980_c1
578 nmdc:mga0n895_150_c1
579 nmdc:mga0n895_19274_c1
580 nmdc:mga0n895_99698_c1
581 nmdc:mga0rr50_12_c1
582 nmdc:mga0rr50_18_c1
583 nmdc:mga0rr50_30429_c1
584 nmdc:mga08x19_1208_c1
585 nmdc:mga08x19_166_c1
586 nmdc:mga0a205_18589_c1
587 nmdc:mga0a205_18959_c2
588 Ga0495601_0015767
589 Ga0500595_003694
590 Ga0500573_0000003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bq9-assembly2.cif.gz_B crystal structure of the fn5 and fn6 domains of neo1, form 1 0.7462 34 141
7y8i-assembly1.cif.gz_A crystal structure of sdscam fniii3 domain, isoform alpha7 0.7416 33 143
7y8i-assembly3.cif.gz_C crystal structure of sdscam fniii3 domain, isoform alpha7 0.7237 33 143
7y8i-assembly1.cif.gz_A crystal structure of sdscam fniii3 domain, isoform alpha7 0.7172 33 143
4gh7-assembly1.cif.gz_B crystal structure of anticalin n7a in complex with oncofetal fibronectin fragment fn7b8 0.7169 34 140
ID Description Score Start End Superfamily
af_A0A0G2JXZ9_406_497_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7696 33 144 2.60.40.10
af_Q9HD43_477_563_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7695 34 140 2.60.40.10
af_Q9HD43_477_563_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7538 34 140 2.60.40.10
4bq9B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7521 34 143 2.60.40.10
af_Q80X19_628_717_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7509 36 143 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7C3C581-F1-model_v4 Uncharacterized protein 0.9742 404 657
AF-A0A3D3US39-F1-model_v4 Uncharacterized protein 0.9704 35 112
AF-A0A7C2JX68-F1-model_v4 TonB-dependent receptor 0.9629 475 658
AF-A0A7C2JX68-F1-model_v4 TonB-dependent receptor 0.9527 475 658
AF-A0A2W4P0M4-F1-model_v4 Right-handed parallel beta-helix repeat-containing protein 0.9474 288 658

Map