F392361

General Info

Members Datasets Scaffolds Average Seq Length
294 184 588 232

Family's Representative Sequence

Representative Sequence 3300053084|Ga0495595_0032389|Ga0495595_0032389_1357_2097
Length 246
Sequence VLETRPPALENWPGELHRHPKKSSVTYPTRIHLAEWLQAEATRAAADFGRYRLLDIGCGRKPYYPYFAAGAREYVGVDIDIDNPYADLLGPVEDLPVEDASFEVVLCTQVLEHAGDPDQAISELHRVTAPGGRVLVSTHGVQVYHPAPEDHWRWTHTGLQLLFLRNGDWASVDVRPAGGTATCLAAMTGIYVDMLFRRVHLTPVAKGLVWTLNTTGAGLDRRVAGLRATQPGSIFLNYHVVAEKPS

Samples

Sample ID Description Type Environment
1 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.08
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495595_0032389 3300053084 Bacteria 2355
2 JGI25406J46586_10116894 3300003203 Unclassified 787
3 Ga0070658_10207038 3300005327 Bacteria 1656
4 Ga0070683_100026996 3300005329 Bacteria 5176
5 Ga0070683_100396113 3300005329 Unclassified 1317
6 Ga0070670_100002063 3300005331 Bacteria 16454
7 Ga0070670_100095340 3300005331 Bacteria 2559
8 Ga0068869_100245474 3300005334 Bacteria 1428
9 Ga0068868_100018432 3300005338 Bacteria 5220
10 Ga0068868_100103231 3300005338 Bacteria 2309
11 Ga0070668_100145695 3300005347 Bacteria 1912
12 Ga0070669_100111047 3300005353 Bacteria 2080
13 Ga0070675_100271488 3300005354 Unclassified 1488
14 Ga0070675_100326491 3300005354 Bacteria 1356
15 Ga0070673_100051872 3300005364 Bacteria 3215
16 Ga0070688_100042525 3300005365 Bacteria 2796
17 Ga0070714_100066115 3300005435 Bacteria 3116
18 Ga0070713_100697918 3300005436 Bacteria 969
19 Ga0070701_10109682 3300005438 Unclassified 1540
20 Ga0070708_100003619 3300005445 Bacteria 12124
21 Ga0070678_100039023 3300005456 Bacteria 3347
22 Ga0070681_10012716 3300005458 Bacteria 8355
23 Ga0068867_100133853 3300005459 Bacteria 1930
24 Ga0070685_10033340 3300005466 Bacteria 2892
25 Ga0070706_100108153 3300005467 Bacteria 2587
26 Ga0070698_100482983 3300005471 Bacteria 1176
27 Ga0070699_100195741 3300005518 Unclassified 1797
28 Ga0070684_100170915 3300005535 Bacteria 1974
29 Ga0070697_100237014 3300005536 Bacteria 1558
30 Ga0070697_100291088 3300005536 Archaea 1403
31 Ga0070696_100274945 3300005546 Bacteria 1282
32 Ga0070665_100220745 3300005548 Bacteria 1896
33 Ga0070665_100271538 3300005548 Bacteria 1698
34 Ga0070704_100495198 3300005549 Bacteria 1060
35 Ga0068855_100036852 3300005563 Bacteria 5818
36 Ga0070664_100323597 3300005564 Bacteria 1398
37 Ga0070664_100377639 3300005564 Unclassified 1293
38 Ga0068857_100301165 3300005577 Unclassified 1478
39 Ga0070702_100042182 3300005615 Bacteria 2564
40 Ga0070702_100145156 3300005615 Bacteria 1516
41 Ga0068864_100113650 3300005618 Bacteria 2414
42 Ga0068870_10000993 3300005840 Bacteria 11195
43 Ga0068858_100207591 3300005842 Bacteria 1853
44 Ga0081539_10001397 3300005985 Bacteria 41577
45 Ga0081539_10194077 3300005985 Bacteria 943
46 Ga0070712_100613599 3300006175 Bacteria 922
47 Ga0075428_100447933 3300006844 Bacteria 1383
48 Ga0075434_100076233 3300006871 Bacteria 3348
49 Ga0068865_100174733 3300006881 Bacteria 1649
50 Ga0068865_100542343 3300006881 Bacteria 976
51 Ga0111539_10040908 3300009094 Bacteria 5577
52 Ga0111539_10060372 3300009094 Bacteria 4494
53 Ga0111539_10945230 3300009094 Bacteria 1002
54 Ga0105245_10049130 3300009098 Bacteria 3776
55 Ga0105245_10053001 3300009098 Bacteria 3640
56 Ga0105245_10364786 3300009098 Bacteria 1434
57 Ga0105245_10911442 3300009098 Unclassified 921
58 Ga0114129_10037070 3300009147 Bacteria 6884
59 Ga0114129_10081939 3300009147 Bacteria 4484
60 Ga0114129_10526973 3300009147 Bacteria 1540
61 Ga0114129_10600701 3300009147 Unclassified 1426
62 Ga0105243_10028304 3300009148 Bacteria 4301
63 Ga0105243_10082747 3300009148 Bacteria 2624
64 Ga0105246_10258874 3300011119 Bacteria 1385
65 Ga0105246_10292468 3300011119 Unclassified 1311
66 Ga0105246_10296067 3300011119 Unclassified 1304
67 Ga0157369_10014660 3300013105 Bacteria 8843
68 Ga0157374_10392014 3300013296 Bacteria 1384
69 Ga0157378_10247634 3300013297 Bacteria 1705
70 Ga0157375_10060813 3300013308 Bacteria 3748
71 Ga0163163_10014952 3300014325 Bacteria 7152
72 Ga0157380_10115794 3300014326 Bacteria 2261
73 Ga0157377_10100148 3300014745 Bacteria 1725
74 Ga0206353_11932018 3300020082 Unclassified 787
75 Ga0207688_10005138 3300025901 Bacteria 7111
76 Ga0207643_10005454 3300025908 Bacteria 6802
77 Ga0207643_10024949 3300025908 Bacteria 3301
78 Ga0207662_10051411 3300025918 Bacteria 2452
79 Ga0207681_10364449 3300025923 Unclassified 1160
80 Ga0207650_10001301 3300025925 Bacteria 18107
81 Ga0207659_10086243 3300025926 Bacteria 2334
82 Ga0207659_10205639 3300025926 Bacteria 1575
83 Ga0207687_10212025 3300025927 Unclassified 1520
84 Ga0207687_10249768 3300025927 Bacteria 1410
85 Ga0207686_10127855 3300025934 Bacteria 1739
86 Ga0207709_10614136 3300025935 Bacteria 862
87 Ga0207670_10052900 3300025936 Bacteria 2733
88 Ga0207669_10377226 3300025937 Unclassified 1104
89 Ga0207704_10504271 3300025938 Bacteria 976
90 Ga0207689_10113215 3300025942 Bacteria 2230
91 Ga0207661_10007977 3300025944 Bacteria 7549
92 Ga0207679_10203448 3300025945 Bacteria 1655
93 Ga0207667_10260201 3300025949 Bacteria 1774
94 Ga0207658_10010860 3300025986 Bacteria 6196
95 Ga0207677_10080082 3300026023 Bacteria 2338
96 Ga0207703_10204410 3300026035 Bacteria 1757
97 Ga0207703_10274546 3300026035 Bacteria 1528
98 Ga0207708_10007020 3300026075 Bacteria 8324
99 Ga0207708_10459863 3300026075 Bacteria 1061
100 Ga0207676_10090276 3300026095 Bacteria 2514
101 Ga0207675_100061498 3300026118 Bacteria 3505
102 Ga0207683_10021461 3300026121 Bacteria 5529
103 Ga0268266_10136223 3300028379 Unclassified 2200
104 Ga0268266_10288453 3300028379 Bacteria 1528
105 Ga0268265_10249695 3300028380 Bacteria 1571
106 Ga0265319_1085671 3300028563 Bacteria 997
107 Ga0265334_10058454 3300028573 Bacteria 1459
108 Ga0265318_10063180 3300028577 Bacteria 1378
109 Ga0265318_10073747 3300028577 Bacteria 1264
110 Ga0265322_10027149 3300028654 Bacteria 1636
111 Ga0265338_10003780 3300028800 Bacteria 21040
112 Ga0265330_10008535 3300031235 Bacteria 4929
113 Ga0265325_10024395 3300031241 Bacteria 3292
114 Ga0265329_10098812 3300031242 Bacteria 928
115 Ga0265339_10053344 3300031249 Bacteria 2199
116 Ga0265327_10020609 3300031251 Bacteria 4008
117 Ga0307408_100184654 3300031548 Bacteria 1675
118 Ga0307408_100309410 3300031548 Bacteria 1327
119 Ga0265313_10017287 3300031595 Bacteria 4104
120 Ga0265314_10028526 3300031711 Bacteria 4160
121 Ga0307413_10514386 3300031824 Bacteria 964
122 Ga0307409_100501750 3300031995 Bacteria 1182
123 Ga0307416_100218582 3300032002 Bacteria 1825
124 Ga0307416_100332193 3300032002 Bacteria 1528
125 Ga0307415_100096050 3300032126 Bacteria 2159
126 Ga0307415_100252078 3300032126 Bacteria 1435
127 Ga0373936_0101486 3300035113 Bacteria 1214
128 Ga0373945_0001452 3300035116 Bacteria 7229
129 Ga0373935_0178512 3300035692 Bacteria 1457
130 Ga0373947_0109151 3300035725 Bacteria 1746
131 Ga0395899_0301444 3300037312 Bacteria 1084
132 Ga0395899_0412321 3300037312 Unclassified 892
133 Ga0395900_0002210 3300037418 Bacteria 21742
134 Ga0395900_0103004 3300037418 Bacteria 2932
135 Ga0395900_0194906 3300037418 Bacteria 2053
136 Ga0395898_0010731 3300037466 Bacteria 9569
137 Ga0395898_0058153 3300037466 Bacteria 3765
138 Ga0395898_0104064 3300037466 Bacteria 2723
139 Ga0395898_0108859 3300037466 Bacteria 2657
140 Ga0395898_0159790 3300037466 Bacteria 2155
141 Ga0395898_0442753 3300037466 Bacteria 1238
142 Ga0395905_0005593 3300037471 Bacteria 12803
143 Ga0395905_0151436 3300037471 Bacteria 2182
144 Ga0395905_0155020 3300037471 Bacteria 2154
145 Ga0395901_0038605 3300038443 Bacteria 4939
146 Ga0395901_0044887 3300038443 Bacteria 4584
147 Ga0395901_0096253 3300038443 Bacteria 3102
148 Ga0395901_0134015 3300038443 Bacteria 2603
149 Ga0395901_0167878 3300038443 Bacteria 2303
150 Ga0395901_0259174 3300038443 Bacteria 1810
151 Ga0436365_0440132 3300039437 Bacteria 834
152 Ga0436365_1744980 3300039437 Bacteria 10527
153 Ga0439439_0032505 3300041406 Unclassified 1332
154 Ga0439461_0038448 3300041410 Unclassified 1026
155 Ga0451839_0009381 3300041496 Unclassified 757
156 Ga0439431_0007253 3300041997 Bacteria 2469
157 Ga0439433_0004750 3300041999 Bacteria 2918
158 Ga0439457_019825 3300042014 Bacteria 1494
159 Ga0439462_0008296 3300042015 Unclassified 2615
160 Ga0439434_0010386 3300042435 Unclassified 2744
161 Ga0466963_0057755 3300044694 Bacteria 2585
162 Ga0466964_0039685 3300044706 Bacteria 1898
163 Ga0466964_0071446 3300044706 Bacteria 1469
164 Ga0466968_0179279 3300044735 Bacteria 985
165 Ga0466957_0182636 3300044842 Bacteria 1371
166 Ga0466960_0144226 3300044901 Bacteria 1267
167 Ga0466959_0169296 3300045049 Bacteria 1533
168 Ga0466958_0242848 3300045836 Bacteria 1151
169 Ga0466967_0014242 3300045976 Bacteria 6186
170 Ga0466967_0023987 3300045976 Bacteria 5008
171 Ga0466967_0033399 3300045976 Bacteria 4355
172 Ga0466967_0219233 3300045976 Bacteria 1807
173 Ga0466967_0630810 3300045976 Bacteria 1059
174 Ga0495592_0133413 3300046454 Bacteria 1734
175 Ga0495603_0149390 3300046455 Unclassified 1358
176 Ga0495582_0069744 3300046473 Bacteria 1944
177 Ga0495596_0037817 3300046500 Bacteria 1908
178 Ga0495608_0105774 3300046511 Bacteria 1812
179 Ga0495630_0011821 3300046517 Bacteria 6326
180 Ga0495644_0061607 3300046523 Bacteria 1410
181 Ga0495665_0177997 3300046531 Bacteria 1106
182 Ga0495640_0286241 3300046533 Bacteria 1026
183 Ga0495586_0139213 3300046535 Bacteria 1361
184 Ga0495656_0034351 3300046615 Bacteria 2076
185 Ga0495634_0063042 3300046642 Bacteria 2461
186 Ga0495674_0096016 3300047319 Bacteria 2527
187 Ga0495676_0060346 3300047321 Bacteria 2973
188 Ga0495602_0506964 3300048088 Unclassified 843
189 Ga0496100_0309390 3300048903 Bacteria 1184
190 Ga0496102_0116188 3300048905 Bacteria 2497
191 Ga0496105_0200016 3300048908 Bacteria 1631
192 Ga0496109_0159750 3300048912 Bacteria 2111
193 Ga0496109_0388631 3300048912 Bacteria 1318
194 Ga0496110_0239725 3300048913 Bacteria 1650
195 Ga0496110_0722669 3300048913 Bacteria 898
196 Ga0496111_0292870 3300048914 Unclassified 1207
197 Ga0496112_0041322 3300048915 Bacteria 4511
198 Ga0496112_0054780 3300048915 Bacteria 3919
199 Ga0496114_0026754 3300048917 Bacteria 4725
200 Ga0496115_0003038 3300048918 Bacteria 12054
201 Ga0501031_0004327 3300049568 Bacteria 9193
202 Ga0501031_0017795 3300049568 Bacteria 4621
203 Ga0501031_0117789 3300049568 Bacteria 1735
204 Ga0501032_0016670 3300049569 Bacteria 5164
205 Ga0501032_0038613 3300049569 Bacteria 3251
206 Ga0501032_0175663 3300049569 Bacteria 1403
207 Ga0501033_0013287 3300049570 Bacteria 6273
208 Ga0501033_0065211 3300049570 Bacteria 2679
209 Ga0501033_0069067 3300049570 Bacteria 2598
210 Ga0501034_0293543 3300049571 Bacteria 1563
211 Ga0501036_0011894 3300049572 Bacteria 7215
212 Ga0501036_0072679 3300049572 Bacteria 2907
213 Ga0501037_0025898 3300049573 Bacteria 4332
214 Ga0501037_0043760 3300049573 Bacteria 3290
215 Ga0501038_0001069 3300049574 Bacteria 24728
216 Ga0501038_0033506 3300049574 Bacteria 4525
217 Ga0501039_0001777 3300049575 Bacteria 15936
218 Ga0501039_0018129 3300049575 Bacteria 5402
219 Ga0501039_0413951 3300049575 Bacteria 1059
220 Ga0501040_0001407 3300049576 Bacteria 15213
221 Ga0501040_0017272 3300049576 Bacteria 4787
222 Ga0501040_0146017 3300049576 Bacteria 1668
223 Ga0501041_0000917 3300049577 Bacteria 15968
224 Ga0501042_0000335 3300049578 Bacteria 23606
225 Ga0501042_0036733 3300049578 Bacteria 3475
226 Ga0501043_0021199 3300049579 Bacteria 5094
227 Ga0501043_0023572 3300049579 Bacteria 4827
228 Ga0501046_0005444 3300049580 Bacteria 11379
229 Ga0501046_0005549 3300049580 Bacteria 11270
230 Ga0501046_0027432 3300049580 Bacteria 4645
231 Ga0501048_0001508 3300049582 Bacteria 17622
232 Ga0501048_0011077 3300049582 Bacteria 6722
233 Ga0501067_0065726 3300049583 Bacteria 2008
234 Ga0501068_0002271 3300049584 Bacteria 10235
235 Ga0501068_0012083 3300049584 Bacteria 4887
236 Ga0501069_0040071 3300049585 Bacteria 2589
237 Ga0501069_0161187 3300049585 Bacteria 1291
238 Ga0501070_0032512 3300049586 Bacteria 4366
239 Ga0501070_0034136 3300049586 Bacteria 4255
240 Ga0501070_0180395 3300049586 Bacteria 1738
241 Ga0501071_0005476 3300049587 Bacteria 8165
242 Ga0501071_0005999 3300049587 Bacteria 7872
243 Ga0501071_0044577 3300049587 Bacteria 3181
244 Ga0501071_0162731 3300049587 Bacteria 1668
245 Ga0501072_0002733 3300049588 Bacteria 13237
246 Ga0501072_0021873 3300049588 Bacteria 4960
247 Ga0501072_0040424 3300049588 Bacteria 3661
248 Ga0501073_0026764 3300049589 Bacteria 4130
249 Ga0501074_0003925 3300049590 Bacteria 10598
250 Ga0501074_0006500 3300049590 Bacteria 8443
251 Ga0501074_0048612 3300049590 Bacteria 3064
252 Ga0501074_0279700 3300049590 Bacteria 1186
253 Ga0501075_0000685 3300049591 Bacteria 20948
254 Ga0501075_0018498 3300049591 Bacteria 5044
255 Ga0501075_0151629 3300049591 Bacteria 1766
256 Ga0501075_0441418 3300049591 Bacteria 992
257 Ga0501076_0001727 3300049592 Bacteria 14779
258 Ga0501076_0049987 3300049592 Bacteria 3307
259 Ga0501077_0038274 3300049593 Bacteria 3053
260 Ga0501077_0049413 3300049593 Bacteria 2673
261 Ga0501077_0176769 3300049593 Bacteria 1356
262 Ga0501079_0001256 3300049741 Bacteria 17797
263 Ga0501079_0039530 3300049741 Bacteria 3638
264 Ga0501080_0040274 3300049742 Bacteria 4358
265 Ga0501080_0265949 3300049742 Bacteria 1561
266 Ga0501080_0410386 3300049742 Bacteria 1218
267 Ga0501081_0000420 3300049743 Bacteria 23450
268 Ga0501081_0005599 3300049743 Bacteria 8111
269 Ga0501081_0318591 3300049743 Bacteria 1142
270 Ga0501083_0023429 3300049744 Bacteria 4282
271 Ga0501083_0037481 3300049744 Bacteria 3302
272 Ga0501083_0144714 3300049744 Bacteria 1556
273 Ga0501035_0017501 3300049822 Bacteria 6611
274 Ga0501035_0027069 3300049822 Bacteria 5242
275 Ga0501035_0124019 3300049822 Bacteria 2256
276 Ga0501044_0014862 3300049823 Bacteria 8392
277 Ga0501045_0000260 3300049824 Bacteria 30596
278 Ga0501045_0000969 3300049824 Bacteria 18772
279 Ga0501045_0008008 3300049824 Bacteria 7359
280 nmdc:mga05p37_192580_c1 3300050507 Bacteria 2474
281 nmdc:mga05p37_45197_c1 3300050507 Bacteria 5418
282 nmdc:mga08y16_175651_c1 3300050511 Bacteria 2224
283 nmdc:mga08y16_537112_c1 3300050511 Bacteria 1184
284 nmdc:mga0n895_391842_c1 3300050512 Bacteria 1405
285 Ga0501084_0002292 3300054114 Bacteria 15376
286 Ga0501084_0032428 3300054114 Bacteria 4370
287 Ga0590071_002685 3300059421 Bacteria 4463
288 Ga0501082_0006233 3300060353 Bacteria 10355
289 Ga0501082_0093619 3300060353 Bacteria 2596
290 Ga0501082_0112200 3300060353 Bacteria 2360
291 Ga0530510_0002839 3300061734 Bacteria 11922
292 Ga0530510_0004106 3300061734 Bacteria 10050
293 Ga0530510_0045485 3300061734 Bacteria 3171
294 Ga0530510_0218732 3300061734 Bacteria 1416
295 Ga0495595_0032389
296 JGI25406J46586_10116894
297 Ga0070658_10207038
298 Ga0070683_100026996
299 Ga0070683_100396113
300 Ga0070670_100002063
301 Ga0070670_100095340
302 Ga0068869_100245474
303 Ga0068868_100018432
304 Ga0068868_100103231
305 Ga0070668_100145695
306 Ga0070669_100111047
307 Ga0070675_100271488
308 Ga0070675_100326491
309 Ga0070673_100051872
310 Ga0070688_100042525
311 Ga0070714_100066115
312 Ga0070713_100697918
313 Ga0070701_10109682
314 Ga0070708_100003619
315 Ga0070678_100039023
316 Ga0070681_10012716
317 Ga0068867_100133853
318 Ga0070685_10033340
319 Ga0070706_100108153
320 Ga0070698_100482983
321 Ga0070699_100195741
322 Ga0070684_100170915
323 Ga0070697_100237014
324 Ga0070697_100291088
325 Ga0070696_100274945
326 Ga0070665_100220745
327 Ga0070665_100271538
328 Ga0070704_100495198
329 Ga0068855_100036852
330 Ga0070664_100323597
331 Ga0070664_100377639
332 Ga0068857_100301165
333 Ga0070702_100042182
334 Ga0070702_100145156
335 Ga0068864_100113650
336 Ga0068870_10000993
337 Ga0068858_100207591
338 Ga0081539_10001397
339 Ga0081539_10194077
340 Ga0070712_100613599
341 Ga0075428_100447933
342 Ga0075434_100076233
343 Ga0068865_100174733
344 Ga0068865_100542343
345 Ga0111539_10040908
346 Ga0111539_10060372
347 Ga0111539_10945230
348 Ga0105245_10049130
349 Ga0105245_10053001
350 Ga0105245_10364786
351 Ga0105245_10911442
352 Ga0114129_10037070
353 Ga0114129_10081939
354 Ga0114129_10526973
355 Ga0114129_10600701
356 Ga0105243_10028304
357 Ga0105243_10082747
358 Ga0105246_10258874
359 Ga0105246_10292468
360 Ga0105246_10296067
361 Ga0157369_10014660
362 Ga0157374_10392014
363 Ga0157378_10247634
364 Ga0157375_10060813
365 Ga0163163_10014952
366 Ga0157380_10115794
367 Ga0157377_10100148
368 Ga0206353_11932018
369 Ga0207688_10005138
370 Ga0207643_10005454
371 Ga0207643_10024949
372 Ga0207662_10051411
373 Ga0207681_10364449
374 Ga0207650_10001301
375 Ga0207659_10086243
376 Ga0207659_10205639
377 Ga0207687_10212025
378 Ga0207687_10249768
379 Ga0207686_10127855
380 Ga0207709_10614136
381 Ga0207670_10052900
382 Ga0207669_10377226
383 Ga0207704_10504271
384 Ga0207689_10113215
385 Ga0207661_10007977
386 Ga0207679_10203448
387 Ga0207667_10260201
388 Ga0207658_10010860
389 Ga0207677_10080082
390 Ga0207703_10204410
391 Ga0207703_10274546
392 Ga0207708_10007020
393 Ga0207708_10459863
394 Ga0207676_10090276
395 Ga0207675_100061498
396 Ga0207683_10021461
397 Ga0268266_10136223
398 Ga0268266_10288453
399 Ga0268265_10249695
400 Ga0265319_1085671
401 Ga0265334_10058454
402 Ga0265318_10063180
403 Ga0265318_10073747
404 Ga0265322_10027149
405 Ga0265338_10003780
406 Ga0265330_10008535
407 Ga0265325_10024395
408 Ga0265329_10098812
409 Ga0265339_10053344
410 Ga0265327_10020609
411 Ga0307408_100184654
412 Ga0307408_100309410
413 Ga0265313_10017287
414 Ga0265314_10028526
415 Ga0307413_10514386
416 Ga0307409_100501750
417 Ga0307416_100218582
418 Ga0307416_100332193
419 Ga0307415_100096050
420 Ga0307415_100252078
421 Ga0373936_0101486
422 Ga0373945_0001452
423 Ga0373935_0178512
424 Ga0373947_0109151
425 Ga0395899_0301444
426 Ga0395899_0412321
427 Ga0395900_0002210
428 Ga0395900_0103004
429 Ga0395900_0194906
430 Ga0395898_0010731
431 Ga0395898_0058153
432 Ga0395898_0104064
433 Ga0395898_0108859
434 Ga0395898_0159790
435 Ga0395898_0442753
436 Ga0395905_0005593
437 Ga0395905_0151436
438 Ga0395905_0155020
439 Ga0395901_0038605
440 Ga0395901_0044887
441 Ga0395901_0096253
442 Ga0395901_0134015
443 Ga0395901_0167878
444 Ga0395901_0259174
445 Ga0436365_0440132
446 Ga0436365_1744980
447 Ga0439439_0032505
448 Ga0439461_0038448
449 Ga0451839_0009381
450 Ga0439431_0007253
451 Ga0439433_0004750
452 Ga0439457_019825
453 Ga0439462_0008296
454 Ga0439434_0010386
455 Ga0466963_0057755
456 Ga0466964_0039685
457 Ga0466964_0071446
458 Ga0466968_0179279
459 Ga0466957_0182636
460 Ga0466960_0144226
461 Ga0466959_0169296
462 Ga0466958_0242848
463 Ga0466967_0014242
464 Ga0466967_0023987
465 Ga0466967_0033399
466 Ga0466967_0219233
467 Ga0466967_0630810
468 Ga0495592_0133413
469 Ga0495603_0149390
470 Ga0495582_0069744
471 Ga0495596_0037817
472 Ga0495608_0105774
473 Ga0495630_0011821
474 Ga0495644_0061607
475 Ga0495665_0177997
476 Ga0495640_0286241
477 Ga0495586_0139213
478 Ga0495656_0034351
479 Ga0495634_0063042
480 Ga0495674_0096016
481 Ga0495676_0060346
482 Ga0495602_0506964
483 Ga0496100_0309390
484 Ga0496102_0116188
485 Ga0496105_0200016
486 Ga0496109_0159750
487 Ga0496109_0388631
488 Ga0496110_0239725
489 Ga0496110_0722669
490 Ga0496111_0292870
491 Ga0496112_0041322
492 Ga0496112_0054780
493 Ga0496114_0026754
494 Ga0496115_0003038
495 Ga0501031_0004327
496 Ga0501031_0017795
497 Ga0501031_0117789
498 Ga0501032_0016670
499 Ga0501032_0038613
500 Ga0501032_0175663
501 Ga0501033_0013287
502 Ga0501033_0065211
503 Ga0501033_0069067
504 Ga0501034_0293543
505 Ga0501036_0011894
506 Ga0501036_0072679
507 Ga0501037_0025898
508 Ga0501037_0043760
509 Ga0501038_0001069
510 Ga0501038_0033506
511 Ga0501039_0001777
512 Ga0501039_0018129
513 Ga0501039_0413951
514 Ga0501040_0001407
515 Ga0501040_0017272
516 Ga0501040_0146017
517 Ga0501041_0000917
518 Ga0501042_0000335
519 Ga0501042_0036733
520 Ga0501043_0021199
521 Ga0501043_0023572
522 Ga0501046_0005444
523 Ga0501046_0005549
524 Ga0501046_0027432
525 Ga0501048_0001508
526 Ga0501048_0011077
527 Ga0501067_0065726
528 Ga0501068_0002271
529 Ga0501068_0012083
530 Ga0501069_0040071
531 Ga0501069_0161187
532 Ga0501070_0032512
533 Ga0501070_0034136
534 Ga0501070_0180395
535 Ga0501071_0005476
536 Ga0501071_0005999
537 Ga0501071_0044577
538 Ga0501071_0162731
539 Ga0501072_0002733
540 Ga0501072_0021873
541 Ga0501072_0040424
542 Ga0501073_0026764
543 Ga0501074_0003925
544 Ga0501074_0006500
545 Ga0501074_0048612
546 Ga0501074_0279700
547 Ga0501075_0000685
548 Ga0501075_0018498
549 Ga0501075_0151629
550 Ga0501075_0441418
551 Ga0501076_0001727
552 Ga0501076_0049987
553 Ga0501077_0038274
554 Ga0501077_0049413
555 Ga0501077_0176769
556 Ga0501079_0001256
557 Ga0501079_0039530
558 Ga0501080_0040274
559 Ga0501080_0265949
560 Ga0501080_0410386
561 Ga0501081_0000420
562 Ga0501081_0005599
563 Ga0501081_0318591
564 Ga0501083_0023429
565 Ga0501083_0037481
566 Ga0501083_0144714
567 Ga0501035_0017501
568 Ga0501035_0027069
569 Ga0501035_0124019
570 Ga0501044_0014862
571 Ga0501045_0000260
572 Ga0501045_0000969
573 Ga0501045_0008008
574 nmdc:mga05p37_192580_c1
575 nmdc:mga05p37_45197_c1
576 nmdc:mga08y16_175651_c1
577 nmdc:mga08y16_537112_c1
578 nmdc:mga0n895_391842_c1
579 Ga0501084_0002292
580 Ga0501084_0032428
581 Ga0590071_002685
582 Ga0501082_0006233
583 Ga0501082_0093619
584 Ga0501082_0112200
585 Ga0530510_0002839
586 Ga0530510_0004106
587 Ga0530510_0045485
588 Ga0530510_0218732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

54

136

0.93

PF13649

Methyltransf_25

Methyltransferase domain

86

132

0.93

PF13847

Methyltransf_31

Methyltransferase domain

88

161

0.9

PF13489

Methyltransf_23

Methyltransferase domain

29

169

0.82

PF08242

Methyltransf_12

Methyltransferase domain

54

134

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y8c-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824 0.8722 44 129
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.8257 31 129
8k76-assembly1.cif.gz_B crystal structure of s-adenosylmethionine-dependent methyltransferase from fusobacterium nucleatum 0.7747 34 128
7ux6-assembly1.cif.gz_B crystal structure of mfng, an l- and d-tyrosine o-methyltransferase from the marformycin biosynthesis pathway of streptomyces drozdowiczii, with sah bound at 1.35 a resolution (p212121 - form i) 0.7664 27 128
7cpx-assembly1.cif.gz_A lovastatin nonaketide synthase 0.7496 23 163
ID Description Score Start End Superfamily
af_P75672_56_184_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9027 60 123 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8479 30 129 3.40.50.150
af_A0A1D6EZM8_172_271_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8343 85 129 3.40.50.150
af_Q54BE2_28_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8313 44 129 3.40.50.150
af_O61833_6_236_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8299 28 127 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W1LEB6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9503 6 235 GO:0008757
GO:0032259
AF-A0A2V2SPU9-F1-model_v4 deleted 0.9432 1 234
AF-A0A2V2SPU9-F1-model_v4 deleted 0.9353 1 234
AF-A0A7W1LEB6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9343 6 235 GO:0008757
GO:0032259
AF-A0A537ZVA2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9291 1 235 GO:0008757
GO:0032259

Map