F392325

General Info

Members Datasets Scaffolds Average Seq Length
294 177 588 223

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0009108|Ga0501036_0009108_937_1611
Length 224
Sequence MIYALTRLVCLVLFRVVWRPVVVGREHIPATGPLILASNHLSFIDSIVIPLAVPRRVVFLAKAEYWEGRSLASLPRRLFFRTFGAVPVQRDQQSDAQASLDLARQVLDRGDAFGIYPEGTRSRDGRLYRGRTGVGWLSLAADAPVVPVGLVGTDRVQPVGARFPRVHRVRVEFGEPVRPEKYAGLPPGRARREITDAVMDAVAAMTGQERAREYNERVPTATGD

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
164 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2643221615 Nocardioides sp. Root224 Isolate Unclassified
169 2643221641 Nocardioides sp. Root122 Isolate Unclassified
170 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
171 2739367898 Nocardioides sp. CF479 Isolate Unclassified
172 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
173 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
174 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
175 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
176 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
177 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.34
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 0.34
Rhizoplane 16.33
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0009108 3300049572 Bacteria 8165
2 JGI24740J21852_10048802 3300001979 Bacteria 1227
3 Ga0070658_10010457 3300005327 Bacteria 7443
4 Ga0070658_10122060 3300005327 Bacteria 2165
5 Ga0070658_10432203 3300005327 Bacteria 1133
6 Ga0070676_10124647 3300005328 Bacteria 1621
7 Ga0070683_100028731 3300005329 Bacteria 5028
8 Ga0070683_100033039 3300005329 Bacteria 4715
9 Ga0070683_100234649 3300005329 Bacteria 1744
10 Ga0070683_100361879 3300005329 Bacteria 1382
11 Ga0070683_100399994 3300005329 Bacteria 1310
12 Ga0070683_100757837 3300005329 Bacteria 930
13 Ga0068869_100140485 3300005334 Bacteria 1864
14 Ga0070682_100024369 3300005337 Bacteria 3601
15 Ga0070682_100163263 3300005337 Bacteria 1541
16 Ga0068868_100235042 3300005338 Bacteria 1538
17 Ga0070660_100080772 3300005339 Bacteria 2552
18 Ga0070687_100061153 3300005343 Bacteria 1990
19 Ga0070692_10008287 3300005345 Bacteria 4631
20 Ga0070668_100160358 3300005347 Bacteria 1825
21 Ga0070668_100164901 3300005347 Bacteria 1800
22 Ga0070674_100312381 3300005356 Bacteria 1257
23 Ga0070673_100351542 3300005364 Bacteria 1308
24 Ga0070659_100025907 3300005366 Bacteria 4511
25 Ga0070663_100203856 3300005455 Bacteria 1545
26 Ga0070678_100058113 3300005456 Bacteria 2837
27 Ga0070678_100729790 3300005456 Bacteria 895
28 Ga0070681_10077738 3300005458 Bacteria 3276
29 Ga0068867_100210683 3300005459 Bacteria 1561
30 Ga0070679_100016578 3300005530 Bacteria 7113
31 Ga0070684_100099407 3300005535 Bacteria 2597
32 Ga0070684_100651043 3300005535 Bacteria 981
33 Ga0070665_100000482 3300005548 Bacteria 57252
34 Ga0068855_100592840 3300005563 Bacteria 1196
35 Ga0070664_100141646 3300005564 Bacteria 2118
36 Ga0070664_100213468 3300005564 Bacteria 1725
37 Ga0070702_100062975 3300005615 Bacteria 2164
38 Ga0070702_100137765 3300005615 Bacteria 1551
39 Ga0068852_100049491 3300005616 Bacteria 3596
40 Ga0068858_100073573 3300005842 Bacteria 3172
41 Ga0068860_100028125 3300005843 Bacteria 5413
42 Ga0075365_10003089 3300006038 Bacteria 8461
43 Ga0075365_10018836 3300006038 Bacteria 4251
44 Ga0075364_10202025 3300006051 Bacteria 1347
45 Ga0075370_10093510 3300006353 Bacteria 1736
46 Ga0068865_100150495 3300006881 Bacteria 1765
47 Ga0105245_10307828 3300009098 Bacteria 1557
48 Ga0105247_10217487 3300009101 Bacteria 1292
49 Ga0105243_10216361 3300009148 Bacteria 1690
50 Ga0105241_10341423 3300009174 Bacteria 1298
51 Ga0105242_10324397 3300009176 Bacteria 1413
52 Ga0105248_10941979 3300009177 Bacteria 975
53 Ga0105249_10284395 3300009553 Bacteria 1653
54 Ga0105249_10538995 3300009553 Bacteria 1216
55 Ga0105239_10015558 3300010375 Bacteria 8425
56 Ga0105246_10001168 3300011119 Bacteria 15261
57 Ga0105246_10297506 3300011119 Bacteria 1301
58 Ga0105246_10483413 3300011119 Bacteria 1048
59 Ga0157371_10157472 3300013102 Bacteria 1621
60 Ga0157369_10125658 3300013105 Bacteria 2720
61 Ga0157369_10253587 3300013105 Bacteria 1836
62 Ga0157369_10541255 3300013105 Bacteria 1204
63 Ga0163162_10052734 3300013306 Bacteria 4086
64 Ga0163162_10865370 3300013306 Bacteria 1018
65 Ga0157372_10070126 3300013307 Bacteria 3943
66 Ga0157372_10381644 3300013307 Bacteria 1642
67 Ga0157375_10014336 3300013308 Bacteria 7068
68 Ga0157375_10104530 3300013308 Bacteria 2921
69 Ga0157375_10111165 3300013308 Bacteria 2839
70 Ga0157375_10146899 3300013308 Bacteria 2489
71 Ga0157375_10165791 3300013308 Bacteria 2354
72 Ga0157375_10201517 3300013308 Bacteria 2146
73 Ga0163163_10011561 3300014325 Bacteria 8015
74 Ga0163163_10068339 3300014325 Bacteria 3536
75 Ga0182008_10049153 3300014497 Bacteria 2093
76 Ga0157377_10012980 3300014745 Bacteria 4204
77 Ga0157379_10005043 3300014968 Bacteria 11328
78 Ga0206353_10077609 3300020082 Bacteria 3211
79 Ga0207656_10304982 3300025321 Bacteria 789
80 Ga0207647_10012670 3300025904 Bacteria 5860
81 Ga0207647_10100973 3300025904 Bacteria 1712
82 Ga0207705_10821193 3300025909 Bacteria 721
83 Ga0207707_10135482 3300025912 Bacteria 2153
84 Ga0207662_10016419 3300025918 Bacteria 4179
85 Ga0207657_10081236 3300025919 Bacteria 2723
86 Ga0207652_10052632 3300025921 Bacteria 3495
87 Ga0207687_10155190 3300025927 Bacteria 1751
88 Ga0207686_10317512 3300025934 Bacteria 1163
89 Ga0207689_10099725 3300025942 Bacteria 2386
90 Ga0207661_10145439 3300025944 Bacteria 2044
91 Ga0207661_10685974 3300025944 Bacteria 942
92 Ga0207679_10077579 3300025945 Bacteria 2528
93 Ga0207679_10098372 3300025945 Bacteria 2281
94 Ga0207668_10051298 3300025972 Bacteria 2849
95 Ga0207640_10649951 3300025981 Bacteria 898
96 Ga0207677_10136337 3300026023 Bacteria 1872
97 Ga0207703_10105148 3300026035 Bacteria 2399
98 Ga0207678_10307604 3300026067 Bacteria 1363
99 Ga0207708_10137191 3300026075 Bacteria 1916
100 Ga0207648_10549308 3300026089 Bacteria 1061
101 Ga0207674_10006240 3300026116 Bacteria 14050
102 Ga0207683_10527249 3300026121 Bacteria 1092
103 Ga0207683_10686739 3300026121 Bacteria 949
104 Ga0207698_10634364 3300026142 Bacteria 1057
105 Ga0209371_1044272 3300027312 Bacteria 885
106 Ga0268266_10005408 3300028379 Bacteria 11917
107 Ga0268265_10074639 3300028380 Bacteria 2654
108 Ga0268256_1048398 3300030500 Bacteria 910
109 Ga0307408_100217224 3300031548 Bacteria 1558
110 Ga0307405_10058032 3300031731 Bacteria 2434
111 Ga0307410_10887323 3300031852 Bacteria 763
112 Ga0307406_10124698 3300031901 Bacteria 1797
113 Ga0307412_10032365 3300031911 Bacteria 3313
114 Ga0307412_10070922 3300031911 Bacteria 2377
115 Ga0307412_10594922 3300031911 Bacteria 936
116 Ga0307409_100049262 3300031995 Bacteria 3211
117 Ga0307409_100080337 3300031995 Bacteria 2631
118 Ga0307409_100308812 3300031995 Bacteria 1475
119 Ga0307416_100019630 3300032002 Bacteria 4799
120 Ga0307416_100692557 3300032002 Bacteria 1107
121 Ga0307416_101154939 3300032002 Bacteria 880
122 Ga0307415_100046624 3300032126 Bacteria 2912
123 Ga0307415_100601265 3300032126 Bacteria 979
124 Ga0439439_0108189 3300041406 Bacteria 769
125 Ga0439465_0028160 3300041413 Bacteria 1781
126 Ga0451800_0418383 3300041459 Bacteria 2234
127 Ga0451833_1432654 3300041491 Bacteria 1001
128 Ga0451839_1361753 3300041496 Bacteria 1347
129 Ga0439431_0010243 3300041997 Bacteria 2125
130 Ga0439442_055897 3300042002 Bacteria 834
131 Ga0439446_0030878 3300042156 Bacteria 1549
132 Ga0439434_0023552 3300042435 Bacteria 1855
133 Ga0466972_0353539 3300044658 Bacteria 687
134 Ga0466965_0011750 3300044683 Bacteria 4109
135 Ga0466965_0252874 3300044683 Bacteria 945
136 Ga0466966_0010659 3300044684 Bacteria 6110
137 Ga0466961_0162801 3300044693 Bacteria 1390
138 Ga0466961_0305699 3300044693 Bacteria 971
139 Ga0466963_0024250 3300044694 Bacteria 3861
140 Ga0466964_0373779 3300044706 Bacteria 738
141 Ga0466970_0010254 3300044765 Bacteria 4752
142 Ga0466970_0036032 3300044765 Bacteria 2620
143 Ga0466970_0092442 3300044765 Bacteria 1643
144 Ga0466970_0319880 3300044765 Bacteria 877
145 Ga0466957_0036404 3300044842 Bacteria 2958
146 Ga0466957_0105826 3300044842 Bacteria 1778
147 Ga0466960_0004094 3300044901 Bacteria 5668
148 Ga0466960_0026383 3300044901 Bacteria 2639
149 Ga0466960_0098689 3300044901 Bacteria 1500
150 Ga0466960_0130582 3300044901 Bacteria 1325
151 Ga0466960_0247125 3300044901 Bacteria 990
152 Ga0466960_0362788 3300044901 Bacteria 828
153 Ga0466959_0486583 3300045049 Bacteria 835
154 Ga0451576_0223717 3300045051 Bacteria 1965
155 Ga0466958_0039000 3300045836 Bacteria 2852
156 Ga0466967_0000988 3300045976 Bacteria 15473
157 Ga0466967_0005655 3300045976 Bacteria 8705
158 Ga0466967_0249428 3300045976 Bacteria 1695
159 Ga0466967_0696258 3300045976 Bacteria 1006
160 Ga0466967_1095638 3300045976 Bacteria 793
161 Ga0495603_0027566 3300046455 Bacteria 3428
162 Ga0495587_0107433 3300046536 Bacteria 1605
163 Ga0495635_0521066 3300046663 Bacteria 781
164 Ga0495588_0165412 3300046674 Bacteria 1170
165 Ga0495680_0308435 3300047322 Bacteria 1110
166 Ga0496101_0023833 3300048904 Bacteria 4231
167 Ga0496101_0175892 3300048904 Bacteria 1646
168 Ga0496102_0021931 3300048905 Bacteria 5654
169 Ga0496102_0022453 3300048905 Bacteria 5591
170 Ga0496102_0565298 3300048905 Bacteria 1060
171 Ga0496102_0976940 3300048905 Bacteria 767
172 Ga0496103_0121016 3300048906 Bacteria 1667
173 Ga0496104_0037748 3300048907 Bacteria 4516
174 Ga0496104_0219962 3300048907 Bacteria 1811
175 Ga0496105_0001438 3300048908 Bacteria 16760
176 Ga0496105_0180626 3300048908 Bacteria 1728
177 Ga0496106_0093217 3300048909 Bacteria 2327
178 Ga0496106_0157696 3300048909 Bacteria 1793
179 Ga0496107_0100275 3300048910 Bacteria 2122
180 Ga0496107_0129398 3300048910 Bacteria 1863
181 Ga0496107_0180053 3300048910 Bacteria 1569
182 Ga0496107_0190034 3300048910 Bacteria 1525
183 Ga0496108_0091871 3300048911 Bacteria 2580
184 Ga0496108_0151682 3300048911 Bacteria 2000
185 Ga0496108_0255799 3300048911 Bacteria 1524
186 Ga0496108_0314645 3300048911 Bacteria 1364
187 Ga0496109_0006310 3300048912 Bacteria 9982
188 Ga0496109_0019990 3300048912 Bacteria 5912
189 Ga0496109_0180217 3300048912 Bacteria 1984
190 Ga0496109_0188930 3300048912 Bacteria 1935
191 Ga0496109_0201182 3300048912 Bacteria 1873
192 Ga0496110_0002471 3300048913 Bacteria 13846
193 Ga0496110_0050484 3300048913 Bacteria 3652
194 Ga0496110_0061667 3300048913 Bacteria 3311
195 Ga0496110_0494736 3300048913 Bacteria 1113
196 Ga0496111_0022922 3300048914 Bacteria 4377
197 Ga0496111_0218255 3300048914 Bacteria 1417
198 Ga0496111_0481081 3300048914 Bacteria 915
199 Ga0496112_0151734 3300048915 Bacteria 2284
200 Ga0496113_0333419 3300048916 Bacteria 1216
201 Ga0496113_0433574 3300048916 Bacteria 1056
202 Ga0496114_0003170 3300048917 Bacteria 12613
203 Ga0496114_0017733 3300048917 Bacteria 5752
204 Ga0496114_0031249 3300048917 Bacteria 4381
205 Ga0496114_0143836 3300048917 Bacteria 2066
206 Ga0496114_0248963 3300048917 Bacteria 1563
207 Ga0496114_0263942 3300048917 Bacteria 1517
208 Ga0496114_0681306 3300048917 Bacteria 903
209 Ga0496114_0708131 3300048917 Bacteria 883
210 Ga0496115_0003274 3300048918 Bacteria 11620
211 Ga0496115_0014272 3300048918 Bacteria 6016
212 Ga0496115_0095878 3300048918 Bacteria 2428
213 Ga0501031_0158772 3300049568 Bacteria 1478
214 Ga0501032_0164164 3300049569 Bacteria 1458
215 Ga0501034_0011567 3300049571 Bacteria 9139
216 Ga0501034_0066735 3300049571 Bacteria 3611
217 Ga0501036_0004415 3300049572 Bacteria 11356
218 Ga0501036_0045193 3300049572 Bacteria 3732
219 Ga0501036_0139602 3300049572 Bacteria 2046
220 Ga0501037_0167811 3300049573 Bacteria 1562
221 Ga0501039_0133235 3300049575 Bacteria 1951
222 Ga0501040_0060409 3300049576 Bacteria 2605
223 Ga0501040_0209927 3300049576 Bacteria 1384
224 Ga0501040_0391303 3300049576 Bacteria 998
225 Ga0501041_0078691 3300049577 Bacteria 2029
226 Ga0501041_0094236 3300049577 Bacteria 1849
227 Ga0501042_0044106 3300049578 Bacteria 3177
228 Ga0501047_0164835 3300049581 Bacteria 2087
229 Ga0501048_0074249 3300049582 Bacteria 2400
230 Ga0501048_0141422 3300049582 Bacteria 1702
231 Ga0501067_0002438 3300049583 Bacteria 10280
232 Ga0501067_0008273 3300049583 Bacteria 5778
233 Ga0501067_0015586 3300049583 Bacteria 4207
234 Ga0501067_0130913 3300049583 Bacteria 1396
235 Ga0501068_0024682 3300049584 Bacteria 3531
236 Ga0501068_0059811 3300049584 Bacteria 2313
237 Ga0501069_0046982 3300049585 Bacteria 2396
238 Ga0501069_0117540 3300049585 Bacteria 1517
239 Ga0501069_0193949 3300049585 Bacteria 1176
240 Ga0501069_0512450 3300049585 Bacteria 716
241 Ga0501070_0035160 3300049586 Bacteria 4187
242 Ga0501071_0017407 3300049587 Bacteria 4955
243 Ga0501071_0106160 3300049587 Bacteria 2074
244 Ga0501072_0015160 3300049588 Bacteria 5910
245 Ga0501072_0032070 3300049588 Bacteria 4113
246 Ga0501072_0033693 3300049588 Bacteria 4013
247 Ga0501074_0007079 3300049590 Bacteria 8105
248 Ga0501075_0092513 3300049591 Bacteria 2295
249 Ga0501075_0167411 3300049591 Bacteria 1677
250 Ga0501076_0310880 3300049592 Bacteria 1292
251 Ga0501077_0009464 3300049593 Bacteria 6056
252 Ga0501077_0352692 3300049593 Bacteria 939
253 Ga0501079_0029722 3300049741 Bacteria 4198
254 Ga0501079_0089619 3300049741 Bacteria 2382
255 Ga0501079_0167270 3300049741 Bacteria 1715
256 Ga0501080_0016977 3300049742 Bacteria 6721
257 Ga0501080_0043937 3300049742 Bacteria 4160
258 Ga0501081_0224962 3300049743 Bacteria 1365
259 Ga0501081_0599921 3300049743 Bacteria 824
260 Ga0501083_0004804 3300049744 Bacteria 9548
261 Ga0501083_0083735 3300049744 Bacteria 2112
262 Ga0501035_0042685 3300049822 Bacteria 4090
263 Ga0501044_0086230 3300049823 Bacteria 3172
264 Ga0501045_0016487 3300049824 Bacteria 5249
265 nmdc:mga00v17_122442_c1 3300050491 Bacteria 1657
266 nmdc:mga00v17_351871_c1 3300050491 Bacteria 958
267 nmdc:mga0yw44_14401_c1 3300050492 Bacteria 4200
268 nmdc:mga0yw44_20409_c1 3300050492 Bacteria 3677
269 nmdc:mga0yw44_20556_c1 3300050492 Bacteria 3666
270 nmdc:mga0yw44_33318_c1 3300050492 Bacteria 3009
271 nmdc:mga0yw44_45559_c1 3300050492 Bacteria 2630
272 nmdc:mga07m45_90633_c1 3300050496 Bacteria 1751
273 Ga0495595_0044163 3300053084 Bacteria 2047
274 Ga0495619_0109124 3300053085 Bacteria 1889
275 Ga0500644_0133900 3300053088 Bacteria 979
276 Ga0500556_0002842 3300053104 Bacteria 5287
277 Ga0500593_001434 3300053117 Bacteria 8565
278 Ga0500573_0053617 3300053140 Bacteria 2317
279 Ga0500620_077094 3300053155 Bacteria 1152
280 Ga0501084_0038521 3300054114 Bacteria 3996
281 Ga0501084_0064866 3300054114 Bacteria 3055
282 Ga0501084_0098326 3300054114 Bacteria 2457
283 Ga0466962_0166829 3300061719 Bacteria 1071
284 Ga0530510_0067029 3300061734 Bacteria 2604
285 2644092420 2643221615 Bacteria 5487866
286 2644231445 2643221641 Bacteria 4490190
287 2644323320 2643221657 Bacteria 5490246
288 2740167477 2739367898 Bacteria 4367674
289 2774396605 2773857762 Bacteria 5971770
290 2809198269 2808606439 Bacteria 5952208
291 2812353060 2811994878 Bacteria 5992952
292 2857484986 2857481737 Bacteria 4761446
293 2891969313 2891968417 Bacteria 5821697
294 8054614458 8054609563 Bacteria 5170090
295 Ga0501036_0009108
296 JGI24740J21852_10048802
297 Ga0070658_10010457
298 Ga0070658_10122060
299 Ga0070658_10432203
300 Ga0070676_10124647
301 Ga0070683_100028731
302 Ga0070683_100033039
303 Ga0070683_100234649
304 Ga0070683_100361879
305 Ga0070683_100399994
306 Ga0070683_100757837
307 Ga0068869_100140485
308 Ga0070682_100024369
309 Ga0070682_100163263
310 Ga0068868_100235042
311 Ga0070660_100080772
312 Ga0070687_100061153
313 Ga0070692_10008287
314 Ga0070668_100160358
315 Ga0070668_100164901
316 Ga0070674_100312381
317 Ga0070673_100351542
318 Ga0070659_100025907
319 Ga0070663_100203856
320 Ga0070678_100058113
321 Ga0070678_100729790
322 Ga0070681_10077738
323 Ga0068867_100210683
324 Ga0070679_100016578
325 Ga0070684_100099407
326 Ga0070684_100651043
327 Ga0070665_100000482
328 Ga0068855_100592840
329 Ga0070664_100141646
330 Ga0070664_100213468
331 Ga0070702_100062975
332 Ga0070702_100137765
333 Ga0068852_100049491
334 Ga0068858_100073573
335 Ga0068860_100028125
336 Ga0075365_10003089
337 Ga0075365_10018836
338 Ga0075364_10202025
339 Ga0075370_10093510
340 Ga0068865_100150495
341 Ga0105245_10307828
342 Ga0105247_10217487
343 Ga0105243_10216361
344 Ga0105241_10341423
345 Ga0105242_10324397
346 Ga0105248_10941979
347 Ga0105249_10284395
348 Ga0105249_10538995
349 Ga0105239_10015558
350 Ga0105246_10001168
351 Ga0105246_10297506
352 Ga0105246_10483413
353 Ga0157371_10157472
354 Ga0157369_10125658
355 Ga0157369_10253587
356 Ga0157369_10541255
357 Ga0163162_10052734
358 Ga0163162_10865370
359 Ga0157372_10070126
360 Ga0157372_10381644
361 Ga0157375_10014336
362 Ga0157375_10104530
363 Ga0157375_10111165
364 Ga0157375_10146899
365 Ga0157375_10165791
366 Ga0157375_10201517
367 Ga0163163_10011561
368 Ga0163163_10068339
369 Ga0182008_10049153
370 Ga0157377_10012980
371 Ga0157379_10005043
372 Ga0206353_10077609
373 Ga0207656_10304982
374 Ga0207647_10012670
375 Ga0207647_10100973
376 Ga0207705_10821193
377 Ga0207707_10135482
378 Ga0207662_10016419
379 Ga0207657_10081236
380 Ga0207652_10052632
381 Ga0207687_10155190
382 Ga0207686_10317512
383 Ga0207689_10099725
384 Ga0207661_10145439
385 Ga0207661_10685974
386 Ga0207679_10077579
387 Ga0207679_10098372
388 Ga0207668_10051298
389 Ga0207640_10649951
390 Ga0207677_10136337
391 Ga0207703_10105148
392 Ga0207678_10307604
393 Ga0207708_10137191
394 Ga0207648_10549308
395 Ga0207674_10006240
396 Ga0207683_10527249
397 Ga0207683_10686739
398 Ga0207698_10634364
399 Ga0209371_1044272
400 Ga0268266_10005408
401 Ga0268265_10074639
402 Ga0268256_1048398
403 Ga0307408_100217224
404 Ga0307405_10058032
405 Ga0307410_10887323
406 Ga0307406_10124698
407 Ga0307412_10032365
408 Ga0307412_10070922
409 Ga0307412_10594922
410 Ga0307409_100049262
411 Ga0307409_100080337
412 Ga0307409_100308812
413 Ga0307416_100019630
414 Ga0307416_100692557
415 Ga0307416_101154939
416 Ga0307415_100046624
417 Ga0307415_100601265
418 Ga0439439_0108189
419 Ga0439465_0028160
420 Ga0451800_0418383
421 Ga0451833_1432654
422 Ga0451839_1361753
423 Ga0439431_0010243
424 Ga0439442_055897
425 Ga0439446_0030878
426 Ga0439434_0023552
427 Ga0466972_0353539
428 Ga0466965_0011750
429 Ga0466965_0252874
430 Ga0466966_0010659
431 Ga0466961_0162801
432 Ga0466961_0305699
433 Ga0466963_0024250
434 Ga0466964_0373779
435 Ga0466970_0010254
436 Ga0466970_0036032
437 Ga0466970_0092442
438 Ga0466970_0319880
439 Ga0466957_0036404
440 Ga0466957_0105826
441 Ga0466960_0004094
442 Ga0466960_0026383
443 Ga0466960_0098689
444 Ga0466960_0130582
445 Ga0466960_0247125
446 Ga0466960_0362788
447 Ga0466959_0486583
448 Ga0451576_0223717
449 Ga0466958_0039000
450 Ga0466967_0000988
451 Ga0466967_0005655
452 Ga0466967_0249428
453 Ga0466967_0696258
454 Ga0466967_1095638
455 Ga0495603_0027566
456 Ga0495587_0107433
457 Ga0495635_0521066
458 Ga0495588_0165412
459 Ga0495680_0308435
460 Ga0496101_0023833
461 Ga0496101_0175892
462 Ga0496102_0021931
463 Ga0496102_0022453
464 Ga0496102_0565298
465 Ga0496102_0976940
466 Ga0496103_0121016
467 Ga0496104_0037748
468 Ga0496104_0219962
469 Ga0496105_0001438
470 Ga0496105_0180626
471 Ga0496106_0093217
472 Ga0496106_0157696
473 Ga0496107_0100275
474 Ga0496107_0129398
475 Ga0496107_0180053
476 Ga0496107_0190034
477 Ga0496108_0091871
478 Ga0496108_0151682
479 Ga0496108_0255799
480 Ga0496108_0314645
481 Ga0496109_0006310
482 Ga0496109_0019990
483 Ga0496109_0180217
484 Ga0496109_0188930
485 Ga0496109_0201182
486 Ga0496110_0002471
487 Ga0496110_0050484
488 Ga0496110_0061667
489 Ga0496110_0494736
490 Ga0496111_0022922
491 Ga0496111_0218255
492 Ga0496111_0481081
493 Ga0496112_0151734
494 Ga0496113_0333419
495 Ga0496113_0433574
496 Ga0496114_0003170
497 Ga0496114_0017733
498 Ga0496114_0031249
499 Ga0496114_0143836
500 Ga0496114_0248963
501 Ga0496114_0263942
502 Ga0496114_0681306
503 Ga0496114_0708131
504 Ga0496115_0003274
505 Ga0496115_0014272
506 Ga0496115_0095878
507 Ga0501031_0158772
508 Ga0501032_0164164
509 Ga0501034_0011567
510 Ga0501034_0066735
511 Ga0501036_0004415
512 Ga0501036_0045193
513 Ga0501036_0139602
514 Ga0501037_0167811
515 Ga0501039_0133235
516 Ga0501040_0060409
517 Ga0501040_0209927
518 Ga0501040_0391303
519 Ga0501041_0078691
520 Ga0501041_0094236
521 Ga0501042_0044106
522 Ga0501047_0164835
523 Ga0501048_0074249
524 Ga0501048_0141422
525 Ga0501067_0002438
526 Ga0501067_0008273
527 Ga0501067_0015586
528 Ga0501067_0130913
529 Ga0501068_0024682
530 Ga0501068_0059811
531 Ga0501069_0046982
532 Ga0501069_0117540
533 Ga0501069_0193949
534 Ga0501069_0512450
535 Ga0501070_0035160
536 Ga0501071_0017407
537 Ga0501071_0106160
538 Ga0501072_0015160
539 Ga0501072_0032070
540 Ga0501072_0033693
541 Ga0501074_0007079
542 Ga0501075_0092513
543 Ga0501075_0167411
544 Ga0501076_0310880
545 Ga0501077_0009464
546 Ga0501077_0352692
547 Ga0501079_0029722
548 Ga0501079_0089619
549 Ga0501079_0167270
550 Ga0501080_0016977
551 Ga0501080_0043937
552 Ga0501081_0224962
553 Ga0501081_0599921
554 Ga0501083_0004804
555 Ga0501083_0083735
556 Ga0501035_0042685
557 Ga0501044_0086230
558 Ga0501045_0016487
559 nmdc:mga00v17_122442_c1
560 nmdc:mga00v17_351871_c1
561 nmdc:mga0yw44_14401_c1
562 nmdc:mga0yw44_20409_c1
563 nmdc:mga0yw44_20556_c1
564 nmdc:mga0yw44_33318_c1
565 nmdc:mga0yw44_45559_c1
566 nmdc:mga07m45_90633_c1
567 Ga0495595_0044163
568 Ga0495619_0109124
569 Ga0500644_0133900
570 Ga0500556_0002842
571 Ga0500593_001434
572 Ga0500573_0053617
573 Ga0500620_077094
574 Ga0501084_0038521
575 Ga0501084_0064866
576 Ga0501084_0098326
577 Ga0466962_0166829
578 Ga0530510_0067029
579 2644092420
580 2644231445
581 2644323320
582 2740167477
583 2774396605
584 2809198269
585 2812353060
586 2857484986
587 2891969313
588 8054614458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

19

151

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7382 4 209
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7335 4 206
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.7114 2 206
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.6824 3 208
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.6623 2 206
ID Description Score Start End Superfamily
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8962 21 147 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8909 19 145 3.40.50.2000
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8696 24 147 3.40.50.620
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8565 23 145 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8507 21 147 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4R4TK71-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9551 3 216 GO:0003841
GO:0005886
GO:0006654
AF-A0A5D0UJX8-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9492 1 216 GO:0003841
GO:0005886
GO:0006654
AF-A0A7K1LGF8-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9296 18 217 GO:0003841
GO:0005886
GO:0006654
AF-Q0RG51-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) 0.9255 12 216 GO:0003841
GO:0005886
GO:0006654
AF-A0A399Y826-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9247 2 216 GO:0003841
GO:0005886
GO:0006654

Map