F392287

General Info

Members Datasets Scaffolds Average Seq Length
294 181 588 196

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0072181|Ga0495686_0072181_493_1149
Length 218
Sequence MKTDYTKMKILVFDNYDSFTYNLVHLVEKIMHQKVDVYRNDQIPLEQVQEYDKIILSPGPGIPEEAGMLLPLIKEYASTKSILGVCLGHQAIGEAFGGKLVNLSTVYHGVATKIEMVKKKSEAGNQKSEGESPLFKGLPDELEVGRYHSWIVADEGFPKELEVTARDANNYIMALQHKKYDVQGVQFHPESVLTPDGESILRNWLTPKPLKGALGDLI

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
170 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
171 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
172 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
173 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
174 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
175 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
176 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
177 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
178 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
179 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
180 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
181 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.93
Nodule 0
Rhizoplane 0.68
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0072181 3300047472 Bacteria 2123
2 JGI24740J21852_10005751 3300001979 Bacteria 5210
3 JGI25158J39367_1007919 3300002739 Bacteria 1487
4 JGI25159J45721_1018729 3300002987 Bacteria 1385
5 rootH1_10114248 3300003316 Bacteria 1093
6 rootL2_10032237 3300003322 Bacteria 3650
7 rootL2_10032239 3300003322 Bacteria 2459
8 rootH1_10025440 3300003323 Bacteria 2938
9 rootH1_10269340 3300003323 Bacteria 1022
10 Ga0055535_1003449 3300003761 Bacteria 4482
11 Ga0055542_1002114 3300003762 Bacteria 7298
12 Ga0055526_1013667 3300003771 Bacteria 3412
13 Ga0055531_10000131 3300003794 Bacteria 85257
14 Ga0065165_1013969 3300005262 Bacteria 3147
15 Ga0065704_10077961 3300005289 Bacteria 4569
16 Ga0065712_10124065 3300005290 Bacteria 1631
17 Ga0070658_10213864 3300005327 Bacteria 1629
18 Ga0070658_10292397 3300005327 Bacteria 1388
19 Ga0070658_10312273 3300005327 Bacteria 1341
20 Ga0070658_10361981 3300005327 Bacteria 1242
21 Ga0070676_10651333 3300005328 Bacteria 765
22 Ga0070683_100010872 3300005329 Bacteria 7837
23 Ga0070683_100981378 3300005329 Bacteria 811
24 Ga0070690_100077058 3300005330 Bacteria 2176
25 Ga0070670_100060696 3300005331 Bacteria 3246
26 Ga0070666_10351683 3300005335 Bacteria 1054
27 Ga0070680_100610361 3300005336 Bacteria 936
28 Ga0068868_100021587 3300005338 Bacteria 4850
29 Ga0068868_100080631 3300005338 Bacteria 2608
30 Ga0068868_100432454 3300005338 Bacteria 1141
31 Ga0070689_100336521 3300005340 Bacteria 1263
32 Ga0070687_100021871 3300005343 Bacteria 3015
33 Ga0070692_10072452 3300005345 Bacteria 1838
34 Ga0070669_100432500 3300005353 Bacteria 1082
35 Ga0070673_100085452 3300005364 Bacteria 2568
36 Ga0070659_100033996 3300005366 Bacteria 3964
37 Ga0070659_100373613 3300005366 Bacteria 1200
38 Ga0070667_100026086 3300005367 Bacteria 4860
39 Ga0070667_100299102 3300005367 Bacteria 1449
40 Ga0070667_101158727 3300005367 Bacteria 723
41 Ga0070701_10045950 3300005438 Bacteria 2242
42 Ga0070700_100173093 3300005441 Bacteria 1496
43 Ga0070663_100068570 3300005455 Bacteria 2575
44 Ga0070663_100311643 3300005455 Bacteria 1263
45 Ga0070678_100023164 3300005456 Bacteria 4133
46 Ga0070681_10130995 3300005458 Bacteria 2440
47 Ga0070681_10363984 3300005458 Bacteria 1356
48 Ga0070698_100427113 3300005471 Bacteria 1260
49 Ga0070679_100000575 3300005530 Bacteria 31162
50 Ga0070679_100353739 3300005530 Bacteria 1416
51 Ga0070679_100354613 3300005530 Bacteria 1414
52 Ga0070679_100500314 3300005530 Unclassified 1159
53 Ga0068853_100052842 3300005539 Bacteria 3499
54 Ga0070696_100784328 3300005546 Unclassified 783
55 Ga0068855_100019632 3300005563 Bacteria 8119
56 Ga0068855_100053363 3300005563 Bacteria 4756
57 Ga0068855_100071309 3300005563 Bacteria 4040
58 Ga0068855_100493117 3300005563 Bacteria 1332
59 Ga0070664_100081841 3300005564 Bacteria 2783
60 Ga0068857_100001119 3300005577 Bacteria 20854
61 Ga0068857_100151523 3300005577 Bacteria 2101
62 Ga0068854_100088778 3300005578 Bacteria 2296
63 Ga0068856_100177558 3300005614 Bacteria 2142
64 Ga0070702_100141095 3300005615 Bacteria 1535
65 Ga0068852_100002006 3300005616 Bacteria 13883
66 Ga0068852_100033393 3300005616 Bacteria 4271
67 Ga0068852_100079002 3300005616 Bacteria 2913
68 Ga0068852_100815515 3300005616 Unclassified 948
69 Ga0068870_10383480 3300005840 Bacteria 910
70 Ga0068858_100128104 3300005842 Bacteria 2379
71 Ga0068860_100005408 3300005843 Bacteria 12959
72 Ga0081455_10573514 3300005937 Bacteria 741
73 Ga0105240_10000074 3300009093 Bacteria 199611
74 Ga0105240_10007062 3300009093 Bacteria 16373
75 Ga0105240_10085848 3300009093 Bacteria 3856
76 Ga0105240_10088622 3300009093 Bacteria 3786
77 Ga0105240_10570811 3300009093 Bacteria 1249
78 Ga0105247_10003751 3300009101 Bacteria 9849
79 Ga0105241_10000659 3300009174 Bacteria 25872
80 Ga0105241_10498843 3300009174 Bacteria 1085
81 Ga0105237_10004143 3300009545 Bacteria 16893
82 Ga0105237_10079863 3300009545 Bacteria 3261
83 Ga0105238_10255766 3300009551 Bacteria 1730
84 Ga0105238_10870412 3300009551 Bacteria 919
85 Ga0105239_10002752 3300010375 Bacteria 22079
86 Ga0105239_10075461 3300010375 Bacteria 3707
87 Ga0105239_11508169 3300010375 Bacteria 777
88 Ga0105246_10807683 3300011119 Bacteria 833
89 Ga0157373_10064152 3300013100 Bacteria 2600
90 Ga0157373_10135385 3300013100 Bacteria 1732
91 Ga0157371_10001082 3300013102 Bacteria 29495
92 Ga0157371_10021342 3300013102 Bacteria 4755
93 Ga0157371_10035941 3300013102 Bacteria 3548
94 Ga0157371_10171695 3300013102 Bacteria 1549
95 Ga0157371_10462238 3300013102 Bacteria 934
96 Ga0157370_10002385 3300013104 Bacteria 22662
97 Ga0157370_10066079 3300013104 Bacteria 3421
98 Ga0157369_10220360 3300013105 Bacteria 1986
99 Ga0157369_10364147 3300013105 Bacteria 1501
100 Ga0157374_11499529 3300013296 Bacteria 698
101 Ga0157378_10106642 3300013297 Bacteria 2563
102 Ga0163162_10701484 3300013306 Unclassified 1134
103 Ga0163162_10822086 3300013306 Unclassified 1045
104 Ga0163162_11978660 3300013306 Bacteria 668
105 Ga0157372_10000921 3300013307 Bacteria 32008
106 Ga0157372_10056972 3300013307 Bacteria 4368
107 Ga0157372_10089982 3300013307 Bacteria 3488
108 Ga0157372_10176871 3300013307 Bacteria 2470
109 Ga0157372_10238497 3300013307 Bacteria 2110
110 Ga0157372_10274278 3300013307 Bacteria 1960
111 Ga0157372_10447919 3300013307 Bacteria 1505
112 Ga0157372_10504853 3300013307 Bacteria 1410
113 Ga0157372_10641996 3300013307 Bacteria 1236
114 Ga0157372_10715974 3300013307 Bacteria 1164
115 Ga0157372_10738026 3300013307 Bacteria 1145
116 Ga0157375_11514862 3300013308 Bacteria 792
117 Ga0157375_11935643 3300013308 Bacteria 700
118 Ga0157380_10358460 3300014326 Bacteria 1367
119 Ga0157377_10007378 3300014745 Bacteria 5305
120 Ga0157376_11848894 3300014969 Bacteria 640
121 Ga0182005_1000263 3300015265 Bacteria 33328
122 Ga0163161_10684808 3300017792 Bacteria 852
123 Ga0163161_10714296 3300017792 Bacteria 836
124 Ga0209436_100493 3300025208 Bacteria 17414
125 Ga0209436_110061 3300025208 Bacteria 1755
126 Ga0209258_100151 3300025242 Bacteria 160444
127 Ga0209646_1000823 3300025246 Bacteria 10466
128 Ga0209148_1000154 3300025254 Bacteria 145214
129 Ga0209130_1003361 3300025284 Bacteria 6880
130 Ga0207426_1000051 3300025302 Bacteria 391700
131 Ga0207426_1006084 3300025302 Bacteria 5323
132 Ga0209257_1000001 3300025304 Bacteria 2274655
133 Ga0207688_10469257 3300025901 Bacteria 786
134 Ga0207680_10310472 3300025903 Bacteria 1101
135 Ga0207647_10018104 3300025904 Bacteria 4774
136 Ga0207645_10547594 3300025907 Bacteria 785
137 Ga0207705_10001328 3300025909 Bacteria 19794
138 Ga0207705_10122042 3300025909 Bacteria 1934
139 Ga0207705_10189925 3300025909 Bacteria 1553
140 Ga0207705_10242843 3300025909 Bacteria 1372
141 Ga0207707_10183589 3300025912 Bacteria 1826
142 Ga0207707_10327833 3300025912 Bacteria 1321
143 Ga0207695_10004602 3300025913 Bacteria 18731
144 Ga0207695_10201654 3300025913 Bacteria 1903
145 Ga0207695_10307382 3300025913 Bacteria 1476
146 Ga0207695_10334283 3300025913 Bacteria 1403
147 Ga0207671_10003904 3300025914 Bacteria 14529
148 Ga0207671_10008744 3300025914 Bacteria 8532
149 Ga0207660_10063225 3300025917 Bacteria 2668
150 Ga0207657_10027751 3300025919 Bacteria 5179
151 Ga0207657_10054235 3300025919 Bacteria 3468
152 Ga0207657_10255994 3300025919 Bacteria 1394
153 Ga0207657_10751463 3300025919 Unclassified 756
154 Ga0207652_10000051 3300025921 Bacteria 120327
155 Ga0207652_10001600 3300025921 Bacteria 19940
156 Ga0207652_10045752 3300025921 Bacteria 3731
157 Ga0207681_10471660 3300025923 Bacteria 1024
158 Ga0207694_10041538 3300025924 Bacteria 3544
159 Ga0207694_10121183 3300025924 Bacteria 2089
160 Ga0207650_10004151 3300025925 Bacteria 9903
161 Ga0207650_10044181 3300025925 Bacteria 3273
162 Ga0207690_10040579 3300025932 Bacteria 3044
163 Ga0207691_10011421 3300025940 Bacteria 8521
164 Ga0207691_10278548 3300025940 Bacteria 1439
165 Ga0207691_10437781 3300025940 Bacteria 1113
166 Ga0207691_10664846 3300025940 Bacteria 880
167 Ga0207661_10907350 3300025944 Bacteria 811
168 Ga0207667_10000222 3300025949 Bacteria 79873
169 Ga0207667_10015290 3300025949 Bacteria 8725
170 Ga0207667_10085943 3300025949 Bacteria 3256
171 Ga0207667_10162018 3300025949 Bacteria 2300
172 Ga0207667_10396610 3300025949 Bacteria 1405
173 Ga0207651_10148905 3300025960 Bacteria 1819
174 Ga0207640_10011602 3300025981 Bacteria 4993
175 Ga0207640_10099462 3300025981 Bacteria 2036
176 Ga0207658_11116686 3300025986 Bacteria 720
177 Ga0207677_10180206 3300026023 Bacteria 1661
178 Ga0207703_10192734 3300026035 Bacteria 1806
179 Ga0207639_10038837 3300026041 Bacteria 3544
180 Ga0207678_10316402 3300026067 Bacteria 1342
181 Ga0207674_10000672 3300026116 Bacteria 44419
182 Ga0207674_10140593 3300026116 Bacteria 2373
183 Ga0207683_10134950 3300026121 Bacteria 2221
184 Ga0207698_10001082 3300026142 Bacteria 15843
185 Ga0207698_10022184 3300026142 Bacteria 4406
186 Ga0207698_10299104 3300026142 Bacteria 1497
187 Ga0207698_10495989 3300026142 Bacteria 1187
188 Ga0268264_10003860 3300028381 Bacteria 12861
189 Ga0268264_10331372 3300028381 Bacteria 1443
190 Ga0307512_10230171 3300030522 Bacteria 954
191 Ga0307513_10272734 3300031456 Bacteria 1474
192 Ga0307509_10175070 3300031507 Bacteria 2019
193 Ga0307516_10246081 3300031730 Bacteria 1485
194 Ga0307416_100225160 3300032002 Bacteria 1803
195 Ga0307411_10656224 3300032005 Bacteria 909
196 Ga0395899_0011416 3300037312 Bacteria 6800
197 Ga0395899_0076882 3300037312 Bacteria 2436
198 Ga0395899_0100820 3300037312 Bacteria 2084
199 Ga0395900_0020025 3300037418 Bacteria 6822
200 Ga0395900_0053699 3300037418 Bacteria 4147
201 Ga0395900_0053727 3300037418 Bacteria 4146
202 Ga0395900_0210378 3300037418 Bacteria 1964
203 Ga0395900_0288574 3300037418 Bacteria 1630
204 Ga0395900_0487421 3300037418 Bacteria 1184
205 Ga0395898_0001447 3300037466 Bacteria 33615
206 Ga0395898_0191015 3300037466 Bacteria 1956
207 Ga0395898_0368321 3300037466 Bacteria 1370
208 Ga0395898_0672481 3300037466 Bacteria 977
209 Ga0395905_0118595 3300037471 Bacteria 2487
210 Ga0395901_0001349 3300038443 Bacteria 25743
211 Ga0395901_0078098 3300038443 Bacteria 3456
212 Ga0395901_0126737 3300038443 Bacteria 2683
213 Ga0395901_0352159 3300038443 Bacteria 1519
214 Ga0395901_1384734 3300038443 Bacteria 662
215 Ga0439436_0014348 3300041404 Bacteria 2393
216 Ga0451807_2242610 3300041486 Bacteria 706
217 Ga0439431_0001706 3300041997 Bacteria 4842
218 Ga0439445_0017984 3300042004 Bacteria 1751
219 Ga0439449_0016210 3300042007 Bacteria 2802
220 Ga0439457_004462 3300042014 Bacteria 3638
221 Ga0439457_011739 3300042014 Bacteria 1985
222 Ga0439462_0010946 3300042015 Bacteria 2305
223 Ga0466969_0314795 3300044656 Bacteria 708
224 Ga0466972_0000207 3300044658 Bacteria 42277
225 Ga0466972_0007800 3300044658 Bacteria 5371
226 Ga0466972_0094761 3300044658 Bacteria 1414
227 Ga0466965_0237987 3300044683 Bacteria 974
228 Ga0466966_0230345 3300044684 Bacteria 1118
229 Ga0466959_0063184 3300045049 Bacteria 2689
230 Ga0495606_0019321 3300046507 Bacteria 5075
231 Ga0495622_0149156 3300046557 Bacteria 1059
232 Ga0495687_144804 3300047443 Bacteria 821
233 Ga0495686_0011430 3300047472 Bacteria 6255
234 Ga0496114_1252154 3300048917 Bacteria 628
235 Ga0496121_0000020 3300048924 Bacteria 498732
236 Ga0496126_0028741 3300048929 Bacteria 5293
237 Ga0501032_0678552 3300049569 Bacteria 654
238 Ga0501033_0106340 3300049570 Bacteria 2044
239 Ga0501033_0441054 3300049570 Bacteria 905
240 Ga0501034_0053271 3300049571 Bacteria 4075
241 Ga0501034_0077642 3300049571 Bacteria 3326
242 Ga0501034_0195101 3300049571 Bacteria 1985
243 Ga0501036_0019980 3300049572 Bacteria 5623
244 Ga0501038_0122962 3300049574 Bacteria 2138
245 Ga0501038_0237751 3300049574 Bacteria 1447
246 Ga0501043_0157429 3300049579 Bacteria 1776
247 Ga0501046_0075579 3300049580 Bacteria 2611
248 Ga0501047_0027231 3300049581 Bacteria 5506
249 Ga0501047_0108655 3300049581 Bacteria 2656
250 Ga0501047_0161519 3300049581 Bacteria 2112
251 Ga0501073_0006166 3300049589 Bacteria 8948
252 Ga0501249_120450 3300049679 Viruses 640
253 Ga0501256_025654 3300049685 Viruses 641
254 Ga0501080_0665333 3300049742 Bacteria 920
255 Ga0501083_0055458 3300049744 Bacteria 2657
256 Ga0501241_000031 3300049758 Bacteria 52001
257 Ga0501035_0326279 3300049822 Bacteria 1289
258 Ga0501044_0058135 3300049823 Bacteria 3967
259 Ga0501044_0864186 3300049823 Bacteria 781
260 Ga0501045_0552480 3300049824 Bacteria 854
261 nmdc:mga0k408_166493_c1 3300050493 Bacteria 1313
262 Ga0500578_0217519 3300053086 Bacteria 1163
263 Ga0500644_0000283 3300053088 Bacteria 28078
264 Ga0500646_0035984 3300053090 Bacteria 1378
265 Ga0500646_0061877 3300053090 Bacteria 1103
266 Ga0500583_0000059 3300053092 Bacteria 68222
267 Ga0500651_0340926 3300053093 Bacteria 852
268 Ga0500562_000050 3300053108 Bacteria 60058
269 Ga0500569_047184 3300053109 Bacteria 1286
270 Ga0500607_018370 3300053121 Bacteria 3972
271 Ga0500607_116814 3300053121 Bacteria 1298
272 Ga0500658_0006060 3300053134 Bacteria 4494
273 Ga0500559_0063746 3300053136 Bacteria 1648
274 Ga0500559_0128800 3300053136 Bacteria 1181
275 Ga0500568_0001626 3300053139 Bacteria 14158
276 Ga0500577_0020859 3300053142 Bacteria 2150
277 Ga0500589_089139 3300053147 Bacteria 1362
278 Ga0500589_175587 3300053147 Bacteria 847
279 Ga0500616_0009033 3300053153 Bacteria 6104
280 Ga0500622_0000777 3300053156 Bacteria 27709
281 Ga0500622_0040916 3300053156 Bacteria 2413
282 Ga0500634_0017283 3300053161 Bacteria 3862
283 Ga0500661_002180 3300055283 Bacteria 3697
284 2819573628 2818991442 Bacteria 8318214
285 2819680872 2818991460 Bacteria 7595395
286 2821136962 2821136567 Bacteria 8080116
287 2883072584 2883068021 Bacteria 6192739
288 2884795629 2884791551 Bacteria 8511252
289 2896112543 2896109856 Bacteria 7140722
290 2904468296 2904467357 Bacteria 8057758
291 2929178800 2929177148 Bacteria 7883697
292 2929241243 2929239360 Bacteria 7745570
293 2945981204 2945977869 Bacteria 7777518
294 2946019395 2946013367 Bacteria 7766675
295 Ga0495686_0072181
296 JGI24740J21852_10005751
297 JGI25158J39367_1007919
298 JGI25159J45721_1018729
299 rootH1_10114248
300 rootL2_10032237
301 rootL2_10032239
302 rootH1_10025440
303 rootH1_10269340
304 Ga0055535_1003449
305 Ga0055542_1002114
306 Ga0055526_1013667
307 Ga0055531_10000131
308 Ga0065165_1013969
309 Ga0065704_10077961
310 Ga0065712_10124065
311 Ga0070658_10213864
312 Ga0070658_10292397
313 Ga0070658_10312273
314 Ga0070658_10361981
315 Ga0070676_10651333
316 Ga0070683_100010872
317 Ga0070683_100981378
318 Ga0070690_100077058
319 Ga0070670_100060696
320 Ga0070666_10351683
321 Ga0070680_100610361
322 Ga0068868_100021587
323 Ga0068868_100080631
324 Ga0068868_100432454
325 Ga0070689_100336521
326 Ga0070687_100021871
327 Ga0070692_10072452
328 Ga0070669_100432500
329 Ga0070673_100085452
330 Ga0070659_100033996
331 Ga0070659_100373613
332 Ga0070667_100026086
333 Ga0070667_100299102
334 Ga0070667_101158727
335 Ga0070701_10045950
336 Ga0070700_100173093
337 Ga0070663_100068570
338 Ga0070663_100311643
339 Ga0070678_100023164
340 Ga0070681_10130995
341 Ga0070681_10363984
342 Ga0070698_100427113
343 Ga0070679_100000575
344 Ga0070679_100353739
345 Ga0070679_100354613
346 Ga0070679_100500314
347 Ga0068853_100052842
348 Ga0070696_100784328
349 Ga0068855_100019632
350 Ga0068855_100053363
351 Ga0068855_100071309
352 Ga0068855_100493117
353 Ga0070664_100081841
354 Ga0068857_100001119
355 Ga0068857_100151523
356 Ga0068854_100088778
357 Ga0068856_100177558
358 Ga0070702_100141095
359 Ga0068852_100002006
360 Ga0068852_100033393
361 Ga0068852_100079002
362 Ga0068852_100815515
363 Ga0068870_10383480
364 Ga0068858_100128104
365 Ga0068860_100005408
366 Ga0081455_10573514
367 Ga0105240_10000074
368 Ga0105240_10007062
369 Ga0105240_10085848
370 Ga0105240_10088622
371 Ga0105240_10570811
372 Ga0105247_10003751
373 Ga0105241_10000659
374 Ga0105241_10498843
375 Ga0105237_10004143
376 Ga0105237_10079863
377 Ga0105238_10255766
378 Ga0105238_10870412
379 Ga0105239_10002752
380 Ga0105239_10075461
381 Ga0105239_11508169
382 Ga0105246_10807683
383 Ga0157373_10064152
384 Ga0157373_10135385
385 Ga0157371_10001082
386 Ga0157371_10021342
387 Ga0157371_10035941
388 Ga0157371_10171695
389 Ga0157371_10462238
390 Ga0157370_10002385
391 Ga0157370_10066079
392 Ga0157369_10220360
393 Ga0157369_10364147
394 Ga0157374_11499529
395 Ga0157378_10106642
396 Ga0163162_10701484
397 Ga0163162_10822086
398 Ga0163162_11978660
399 Ga0157372_10000921
400 Ga0157372_10056972
401 Ga0157372_10089982
402 Ga0157372_10176871
403 Ga0157372_10238497
404 Ga0157372_10274278
405 Ga0157372_10447919
406 Ga0157372_10504853
407 Ga0157372_10641996
408 Ga0157372_10715974
409 Ga0157372_10738026
410 Ga0157375_11514862
411 Ga0157375_11935643
412 Ga0157380_10358460
413 Ga0157377_10007378
414 Ga0157376_11848894
415 Ga0182005_1000263
416 Ga0163161_10684808
417 Ga0163161_10714296
418 Ga0209436_100493
419 Ga0209436_110061
420 Ga0209258_100151
421 Ga0209646_1000823
422 Ga0209148_1000154
423 Ga0209130_1003361
424 Ga0207426_1000051
425 Ga0207426_1006084
426 Ga0209257_1000001
427 Ga0207688_10469257
428 Ga0207680_10310472
429 Ga0207647_10018104
430 Ga0207645_10547594
431 Ga0207705_10001328
432 Ga0207705_10122042
433 Ga0207705_10189925
434 Ga0207705_10242843
435 Ga0207707_10183589
436 Ga0207707_10327833
437 Ga0207695_10004602
438 Ga0207695_10201654
439 Ga0207695_10307382
440 Ga0207695_10334283
441 Ga0207671_10003904
442 Ga0207671_10008744
443 Ga0207660_10063225
444 Ga0207657_10027751
445 Ga0207657_10054235
446 Ga0207657_10255994
447 Ga0207657_10751463
448 Ga0207652_10000051
449 Ga0207652_10001600
450 Ga0207652_10045752
451 Ga0207681_10471660
452 Ga0207694_10041538
453 Ga0207694_10121183
454 Ga0207650_10004151
455 Ga0207650_10044181
456 Ga0207690_10040579
457 Ga0207691_10011421
458 Ga0207691_10278548
459 Ga0207691_10437781
460 Ga0207691_10664846
461 Ga0207661_10907350
462 Ga0207667_10000222
463 Ga0207667_10015290
464 Ga0207667_10085943
465 Ga0207667_10162018
466 Ga0207667_10396610
467 Ga0207651_10148905
468 Ga0207640_10011602
469 Ga0207640_10099462
470 Ga0207658_11116686
471 Ga0207677_10180206
472 Ga0207703_10192734
473 Ga0207639_10038837
474 Ga0207678_10316402
475 Ga0207674_10000672
476 Ga0207674_10140593
477 Ga0207683_10134950
478 Ga0207698_10001082
479 Ga0207698_10022184
480 Ga0207698_10299104
481 Ga0207698_10495989
482 Ga0268264_10003860
483 Ga0268264_10331372
484 Ga0307512_10230171
485 Ga0307513_10272734
486 Ga0307509_10175070
487 Ga0307516_10246081
488 Ga0307416_100225160
489 Ga0307411_10656224
490 Ga0395899_0011416
491 Ga0395899_0076882
492 Ga0395899_0100820
493 Ga0395900_0020025
494 Ga0395900_0053699
495 Ga0395900_0053727
496 Ga0395900_0210378
497 Ga0395900_0288574
498 Ga0395900_0487421
499 Ga0395898_0001447
500 Ga0395898_0191015
501 Ga0395898_0368321
502 Ga0395898_0672481
503 Ga0395905_0118595
504 Ga0395901_0001349
505 Ga0395901_0078098
506 Ga0395901_0126737
507 Ga0395901_0352159
508 Ga0395901_1384734
509 Ga0439436_0014348
510 Ga0451807_2242610
511 Ga0439431_0001706
512 Ga0439445_0017984
513 Ga0439449_0016210
514 Ga0439457_004462
515 Ga0439457_011739
516 Ga0439462_0010946
517 Ga0466969_0314795
518 Ga0466972_0000207
519 Ga0466972_0007800
520 Ga0466972_0094761
521 Ga0466965_0237987
522 Ga0466966_0230345
523 Ga0466959_0063184
524 Ga0495606_0019321
525 Ga0495622_0149156
526 Ga0495687_144804
527 Ga0495686_0011430
528 Ga0496114_1252154
529 Ga0496121_0000020
530 Ga0496126_0028741
531 Ga0501032_0678552
532 Ga0501033_0106340
533 Ga0501033_0441054
534 Ga0501034_0053271
535 Ga0501034_0077642
536 Ga0501034_0195101
537 Ga0501036_0019980
538 Ga0501038_0122962
539 Ga0501038_0237751
540 Ga0501043_0157429
541 Ga0501046_0075579
542 Ga0501047_0027231
543 Ga0501047_0108655
544 Ga0501047_0161519
545 Ga0501073_0006166
546 Ga0501249_120450
547 Ga0501256_025654
548 Ga0501080_0665333
549 Ga0501083_0055458
550 Ga0501241_000031
551 Ga0501035_0326279
552 Ga0501044_0058135
553 Ga0501044_0864186
554 Ga0501045_0552480
555 nmdc:mga0k408_166493_c1
556 Ga0500578_0217519
557 Ga0500644_0000283
558 Ga0500646_0035984
559 Ga0500646_0061877
560 Ga0500583_0000059
561 Ga0500651_0340926
562 Ga0500562_000050
563 Ga0500569_047184
564 Ga0500607_018370
565 Ga0500607_116814
566 Ga0500658_0006060
567 Ga0500559_0063746
568 Ga0500559_0128800
569 Ga0500568_0001626
570 Ga0500577_0020859
571 Ga0500589_089139
572 Ga0500589_175587
573 Ga0500616_0009033
574 Ga0500622_0000777
575 Ga0500622_0040916
576 Ga0500634_0017283
577 Ga0500661_002180
578 2819573628
579 2819680872
580 2821136962
581 2883072584
582 2884795629
583 2896112543
584 2904468296
585 2929178800
586 2929241243
587 2945981204
588 2946019395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

11

207

0.88

PF07722

Peptidase_C26

Peptidase C26

40

190

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.921 1 187
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9072 3 189
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.907 1 187
8gr1-assembly4.cif.gz_D crystal structure of d110v/k151l mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.8945 3 188
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.8935 3 189
ID Description Score Start End Superfamily
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9357 3 188 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9342 3 189 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9271 1 188 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9268 3 188 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9266 1 189 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A519L8G0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9856 1 105 GO:0000162
GO:0004049
GO:0005829
AF-A0A3D6CJ94-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.981 1 128 GO:0000162
GO:0004049
GO:0005829
AF-A0A1Q3M6T0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9806 1 155 GO:0000162
GO:0004049
GO:0005829
AF-A0A4Q3SID1-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9774 1 105 GO:0000162
GO:0004049
GO:0005829
AF-A0A2D6V3V0-F1-model_v4 deleted 0.976 2 136

Map