F392259

General Info

Members Datasets Scaffolds Average Seq Length
294 177 272 393

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0081795|Ga0495606_0081795_228_1598
Length 436
Sequence MQLFGLNNPLFDSHNFRISECTNFAINNQTDEYEHLNKLFDWNIIYHYSTNMNADTAQIKYIKERHQGLATVLAFALIPLSGFATDIYIPSLPTMAGEMQVSNVQVQLTLSIFLISYGVAQLFIGSVLDSFGRYKICLYALLIFAAASIIIATTHNIYLIYLMRIIHGLTVGAIVVAKRAYFVDLFEGDQLKHYLSLFSIIWSTGPIVAPFIGGYLQTVFGWESNFYFLAGFALVFAVLELLFSGETLKYFTDFQLKKITGIYIEMIKTTSFTLGIVMLGLAYCMVMVYNMTGPFIIEHHFKFSPVIAGYSSLFLGFAWMVGGFIGKATINKPFFKRLMINSLFQVAFVVLMIVSLNFVSNLWSLIFFAFLIHVGAGFTFNNYFTFCLSKFPKNAGIAGGLTXXXTYVIVSFLSYGIVNLIPAKDERNLSRKKDEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
13 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
14 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
15 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
16 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
17 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
18 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
19 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
20 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
21 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
22 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
23 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.52
Metatranscriptomes 0
Isolates 7.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.33
Nodule 0
Rhizoplane 0
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1563179 2162886007 Bacteria 3798
2 JGI24740J21852_10011933 3300001979 Bacteria 3290
3 JGI24739J22299_10039981 3300001989 Bacteria 1567
4 JGI24737J22298_10003887 3300001990 Bacteria 5252
5 JGI24735J21928_10039169 3300002067 Bacteria 1386
6 JGI25162J39368_1000005 3300002737 Bacteria 435925
7 JGI25164J39214_1001779 3300002772 Bacteria 4195
8 JGI25152J39213_1000195 3300002773 Bacteria 40804
9 JGI25150J39212_1000014 3300002774 Bacteria 170955
10 JGI25151J46595_10000042 3300003187 Bacteria 170955
11 JGI25165J46597_1000414 3300003214 Bacteria 44920
12 JGI25153J46596_10000009 3300003215 Bacteria 340925
13 rootH1_10030707 3300003316 Bacteria 4355
14 rootH2_10004791 3300003320 Bacteria 44589
15 rootH2_10017489 3300003320 Bacteria 42255
16 rootH1_10014858 3300003323 Bacteria 9065
17 rootH1_10036600 3300003323 Bacteria 1516
18 rootH1_10046962 3300003323 Bacteria 6574
19 Ga0055536_1000019 3300003781 Bacteria 203087
20 Ga0055528_1001869 3300003790 Bacteria 11986
21 Ga0055530_10000770 3300003791 Bacteria 26722
22 Ga0055530_10010606 3300003791 Unclassified 3384
23 Ga0055531_10023381 3300003794 Bacteria 2320
24 Ga0065165_1000525 3300005262 Bacteria 58607
25 Ga0065714_10002332 3300005288 Bacteria 27770
26 Ga0065714_10003557 3300005288 Bacteria 12994
27 Ga0065714_10064866 3300005288 Bacteria 16626
28 Ga0065704_10000199 3300005289 Bacteria 297176
29 Ga0070683_100004733 3300005329 Bacteria 11255
30 Ga0070682_100049101 3300005337 Unclassified 2630
31 Ga0068868_100006643 3300005338 Bacteria 8204
32 Ga0070671_100125097 3300005355 Bacteria 2164
33 Ga0070673_100027101 3300005364 Bacteria 4244
34 Ga0070659_100071114 3300005366 Unclassified 2765
35 Ga0070667_100017480 3300005367 Bacteria 5944
36 Ga0070663_100005782 3300005455 Bacteria 7383
37 Ga0070678_100080461 3300005456 Bacteria 2467
38 Ga0070662_100003304 3300005457 Bacteria 10047
39 Ga0068867_100000368 3300005459 Bacteria 30054
40 Ga0070679_100097519 3300005530 Unclassified 2927
41 Ga0070679_100189987 3300005530 Bacteria 2023
42 Ga0068853_100018348 3300005539 Bacteria 5790
43 Ga0068853_100289234 3300005539 Bacteria 1512
44 Ga0070665_100000032 3300005548 Bacteria 333352
45 Ga0068855_100039409 3300005563 Bacteria 5609
46 Ga0068855_100109184 3300005563 Bacteria 3178
47 Ga0068855_100283645 3300005563 Unclassified 1838
48 Ga0068852_100001179 3300005616 Bacteria 17313
49 Ga0068859_100043205 3300005617 Bacteria 4529
50 Ga0068860_100007161 3300005843 Bacteria 11159
51 Ga0075366_10000183 3300006195 Bacteria 27481
52 Ga0075366_10013264 3300006195 Bacteria 4687
53 Ga0075366_10058626 3300006195 Bacteria 2287
54 Ga0097621_100000780 3300006237 Bacteria 22337
55 Ga0068871_100000296 3300006358 Bacteria 34815
56 Ga0068871_100050462 3300006358 Bacteria 3365
57 Ga0068865_100000025 3300006881 Bacteria 94590
58 Ga0097620_100043205 3300006931 Bacteria 4529
59 Ga0105240_10000134 3300009093 Bacteria 151778
60 Ga0105240_10000547 3300009093 Bacteria 69491
61 Ga0105240_10000908 3300009093 Bacteria 52921
62 Ga0105240_10009185 3300009093 Bacteria 14021
63 Ga0105240_10038369 3300009093 Bacteria 6144
64 Ga0105241_10041870 3300009174 Unclassified 3462
65 Ga0105241_10137366 3300009174 Bacteria 1987
66 Ga0105242_10025292 3300009176 Bacteria 4697
67 Ga0105237_10000107 3300009545 Bacteria 117149
68 Ga0105237_10002672 3300009545 Bacteria 21880
69 Ga0105237_10010864 3300009545 Bacteria 9660
70 Ga0105237_10013163 3300009545 Bacteria 8679
71 Ga0105238_10019438 3300009551 Bacteria 6918
72 Ga0105238_10255335 3300009551 Bacteria 1732
73 Ga0105239_10000005 3300010375 Bacteria 496066
74 Ga0105239_10000012 3300010375 Bacteria 332279
75 Ga0105239_10000200 3300010375 Bacteria 87728
76 Ga0105239_10000285 3300010375 Bacteria 74551
77 Ga0105239_10001053 3300010375 Bacteria 38389
78 Ga0105239_10031586 3300010375 Bacteria 5822
79 Ga0105239_10055444 3300010375 Unclassified 4347
80 Ga0105239_10057526 3300010375 Bacteria 4265
81 Ga0157373_10000018 3300013100 Bacteria 169293
82 Ga0157373_10000345 3300013100 Bacteria 37575
83 Ga0157373_10000944 3300013100 Bacteria 22511
84 Ga0157373_10033645 3300013100 Unclassified 3686
85 Ga0157371_10000851 3300013102 Bacteria 34883
86 Ga0157371_10001828 3300013102 Bacteria 21446
87 Ga0157371_10002144 3300013102 Bacteria 19234
88 Ga0157371_10003345 3300013102 Bacteria 14614
89 Ga0157371_10004718 3300013102 Bacteria 11776
90 Ga0157371_10004795 3300013102 Bacteria 11646
91 Ga0157370_10001458 3300013104 Bacteria 29239
92 Ga0157370_10001617 3300013104 Bacteria 27842
93 Ga0157370_10005140 3300013104 Bacteria 14752
94 Ga0157370_10011523 3300013104 Bacteria 9235
95 Ga0157370_10012015 3300013104 Bacteria 9021
96 Ga0157370_10013401 3300013104 Bacteria 8446
97 Ga0157370_10110126 3300013104 Bacteria 2574
98 Ga0157370_10115499 3300013104 Bacteria 2507
99 Ga0157370_10159390 3300013104 Unclassified 2100
100 Ga0157370_10198883 3300013104 Bacteria 1859
101 Ga0157370_10207569 3300013104 Bacteria 1816
102 Ga0157370_10216316 3300013104 Unclassified 1775
103 Ga0157370_10262346 3300013104 Bacteria 1596
104 Ga0157370_10361357 3300013104 Bacteria 1338
105 Ga0157369_10000031 3300013105 Bacteria 203214
106 Ga0157369_10000495 3300013105 Bacteria 52125
107 Ga0157369_10050968 3300013105 Bacteria 4481
108 Ga0157369_10055778 3300013105 Bacteria 4265
109 Ga0157369_10295047 3300013105 Unclassified 1687
110 Ga0157378_10030417 3300013297 Unclassified 4771
111 Ga0157378_10047065 3300013297 Bacteria 3834
112 Ga0163162_10000088 3300013306 Bacteria 85462
113 Ga0163162_10000093 3300013306 Bacteria 82738
114 Ga0163162_10000404 3300013306 Bacteria 39585
115 Ga0157372_10000048 3300013307 Bacteria 142757
116 Ga0157372_10000376 3300013307 Bacteria 49449
117 Ga0157372_10000631 3300013307 Bacteria 38536
118 Ga0157372_10005097 3300013307 Bacteria 13966
119 Ga0157372_10017203 3300013307 Bacteria 7761
120 Ga0157372_10134312 3300013307 Unclassified 2849
121 Ga0157372_10145292 3300013307 Bacteria 2735
122 Ga0157372_10467548 3300013307 Bacteria 1470
123 Ga0157375_10002837 3300013308 Bacteria 15004
124 Ga0157375_10051287 3300013308 Bacteria 4051
125 Ga0157375_10132540 3300013308 Bacteria 2613
126 Ga0163163_10052071 3300014325 Bacteria 4037
127 Ga0182008_10000157 3300014497 Bacteria 53598
128 Ga0182008_10000213 3300014497 Bacteria 45587
129 Ga0182006_1002093 3300015261 Bacteria 11148
130 Ga0182006_1002189 3300015261 Bacteria 10835
131 Ga0182006_1006848 3300015261 Bacteria 5260
132 Ga0182006_1007364 3300015261 Bacteria 5042
133 Ga0182007_10000002 3300015262 Bacteria 564661
134 Ga0183373_1004 3300015682 Bacteria 537398
135 Ga0163161_10001255 3300017792 Bacteria 18992
136 Ga0163161_10001554 3300017792 Bacteria 16943
137 Ga0163161_10001837 3300017792 Bacteria 15500
138 Ga0163161_10003961 3300017792 Bacteria 10388
139 Ga0209436_103127 3300025208 Bacteria 4550
140 Ga0207427_100098 3300025231 Bacteria 122817
141 Ga0209437_100008 3300025233 Bacteria 921142
142 Ga0209437_100030 3300025233 Bacteria 532466
143 Ga0209437_100043 3300025233 Bacteria 440454
144 Ga0207425_1000023 3300025245 Bacteria 341339
145 Ga0209026_1000499 3300025250 Bacteria 28538
146 Ga0209026_1001979 3300025250 Bacteria 8185
147 Ga0209129_1000032 3300025258 Bacteria 341150
148 Ga0209233_1000024 3300025261 Bacteria 695418
149 Ga0209233_1005911 3300025261 Unclassified 4007
150 Ga0209673_1000014 3300025273 Bacteria 537082
151 Ga0209673_1000018 3300025273 Bacteria 458281
152 Ga0209130_1003318 3300025284 Bacteria 6947
153 Ga0209676_1000009 3300025292 Bacteria 981719
154 Ga0209025_1000047 3300025294 Bacteria 341150
155 Ga0209564_1009444 3300025295 Bacteria 4640
156 Ga0209758_1000145 3300025297 Bacteria 170553
157 Ga0209758_1006206 3300025297 Bacteria 8729
158 Ga0209758_1015433 3300025297 Bacteria 3955
159 Ga0209050_1000094 3300025298 Bacteria 242893
160 Ga0209050_1011398 3300025298 Bacteria 4222
161 Ga0207426_1000700 3300025302 Bacteria 39724
162 Ga0207426_1002884 3300025302 Bacteria 10177
163 Ga0209257_1002608 3300025304 Bacteria 17446
164 Ga0207647_10002461 3300025904 Bacteria 14035
165 Ga0207647_10038514 3300025904 Bacteria 3022
166 Ga0207645_10000576 3300025907 Bacteria 30417
167 Ga0207695_10000010 3300025913 Bacteria 981919
168 Ga0207695_10000067 3300025913 Bacteria 330915
169 Ga0207695_10000462 3300025913 Bacteria 88318
170 Ga0207695_10008488 3300025913 Bacteria 12845
171 Ga0207695_10009078 3300025913 Bacteria 12349
172 Ga0207695_10030533 3300025913 Bacteria 5931
173 Ga0207671_10001285 3300025914 Bacteria 29512
174 Ga0207671_10002981 3300025914 Bacteria 17366
175 Ga0207671_10003820 3300025914 Bacteria 14742
176 Ga0207671_10008468 3300025914 Bacteria 8719
177 Ga0207671_10033431 3300025914 Bacteria 3826
178 Ga0207660_10022343 3300025917 Bacteria 4261
179 Ga0207660_10049206 3300025917 Unclassified 2986
180 Ga0207690_10039632 3300025932 Unclassified 3075
181 Ga0207706_10007848 3300025933 Bacteria 9849
182 Ga0207704_10009471 3300025938 Bacteria 4701
183 Ga0207667_10005684 3300025949 Bacteria 15203
184 Ga0207667_10030149 3300025949 Bacteria 5870
185 Ga0207667_10354018 3300025949 Bacteria 1497
186 Ga0207651_10017974 3300025960 Bacteria 4194
187 Ga0207677_10004718 3300026023 Bacteria 7343
188 Ga0207639_10051127 3300026041 Bacteria 3142
189 Ga0207678_10017407 3300026067 Bacteria 6312
190 Ga0207641_10032690 3300026088 Bacteria 4320
191 Ga0207683_10061322 3300026121 Bacteria 3310
192 Ga0207698_10038268 3300026142 Bacteria 3542
193 Ga0268266_10000030 3300028379 Bacteria 417120
194 Ga0268264_10005041 3300028381 Bacteria 11178
195 Ga0307515_10000172 3300028794 Bacteria 159265
196 Ga0307515_10000174 3300028794 Bacteria 157501
197 Ga0307511_10000502 3300030521 Bacteria 42121
198 Ga0307408_100003028 3300031548 Bacteria 11606
199 Ga0307508_10001280 3300031616 Bacteria 28544
200 Ga0307405_10000015 3300031731 Bacteria 206299
201 Ga0307407_10000027 3300031903 Bacteria 107307
202 Ga0307412_10000017 3300031911 Bacteria 294698
203 Ga0307412_10009029 3300031911 Bacteria 5711
204 Ga0307409_100047082 3300031995 Bacteria 3270
205 Ga0307416_100000002 3300032002 Bacteria 509907
206 Ga0307414_10000287 3300032004 Bacteria 29644
207 Ga0307414_10000375 3300032004 Bacteria 24537
208 Ga0307414_10001513 3300032004 Bacteria 12079
209 Ga0307414_10112676 3300032004 Bacteria 2074
210 Ga0307510_10000190 3300033180 Bacteria 53134
211 Ga0395899_0000001 3300037312 Bacteria 1750322
212 Ga0395899_0000522 3300037312 Bacteria 42283
213 Ga0395899_0001130 3300037312 Bacteria 23618
214 Ga0395900_0000115 3300037418 Bacteria 138474
215 Ga0395898_0008980 3300037466 Bacteria 10527
216 Ga0395905_0000045 3300037471 Bacteria 241370
217 Ga0395901_0000254 3300038443 Bacteria 66508
218 Ga0466965_0038449 3300044683 Bacteria 2351
219 Ga0466958_0170848 3300045836 Bacteria 1376
220 Ga0495627_002665 3300046453 Bacteria 8374
221 Ga0495650_0000050 3300046471 Bacteria 318894
222 Ga0495585_0000248 3300046492 Bacteria 56018
223 Ga0495585_0012954 3300046492 Bacteria 4899
224 Ga0495583_0030137 3300046506 Bacteria 2646
225 Ga0495606_0000581 3300046507 Bacteria 58129
226 Ga0495606_0009743 3300046507 Bacteria 8083
227 Ga0495606_0015025 3300046507 Bacteria 5998
228 Ga0495606_0081795 3300046507 Bacteria 2007
229 Ga0495610_0000614 3300046512 Bacteria 35222
230 Ga0495610_0000768 3300046512 Bacteria 30249
231 Ga0495610_0002306 3300046512 Bacteria 16113
232 Ga0495616_0001449 3300046513 Bacteria 16512
233 Ga0495616_0001533 3300046513 Bacteria 15925
234 Ga0495648_0003343 3300046524 Bacteria 14149
235 Ga0495609_0019184 3300046538 Bacteria 3166
236 Ga0495633_0000005 3300046558 Bacteria 357644
237 Ga0495633_0000161 3300046558 Bacteria 87685
238 Ga0495668_0000179 3300046616 Bacteria 94559
239 Ga0495611_0000582 3300046648 Bacteria 21094
240 Ga0495625_0000077 3300046660 Bacteria 163166
241 Ga0495625_0001645 3300046660 Bacteria 26251
242 Ga0495625_0050791 3300046660 Bacteria 2974
243 Ga0495661_0000114 3300046665 Bacteria 95935
244 Ga0495661_0029803 3300046665 Bacteria 3479
245 Ga0495671_0026131 3300046692 Bacteria 3029
246 Ga0495649_0000011 3300046694 Bacteria 416695
247 Ga0495660_0046417 3300046810 Bacteria 2382
248 Ga0495687_013346 3300047443 Bacteria 4297
249 Ga0495686_0003145 3300047472 Bacteria 14569
250 Ga0496122_0001661 3300048925 Bacteria 34502
251 Ga0496123_0073246 3300048926 Unclassified 2126
252 Ga0501032_0008747 3300049569 Bacteria 7375
253 Ga0501034_0072752 3300049571 Unclassified 3446
254 Ga0501034_0177994 3300049571 Bacteria 2092
255 Ga0501038_0073498 3300049574 Unclassified 2895
256 Ga0501043_0029605 3300049579 Unclassified 4303
257 Ga0501047_0009501 3300049581 Bacteria 9190
258 Ga0501047_0080584 3300049581 Bacteria 3129
259 Ga0501067_0092255 3300049583 Unclassified 1681
260 Ga0501073_0037634 3300049589 Bacteria 3433
261 Ga0501249_000014 3300049679 Bacteria 137700
262 Ga0501035_0017935 3300049822 Bacteria 6528
263 Ga0501044_0014493 3300049823 Bacteria 8506
264 nmdc:mga0k408_34089_c1 3300050493 Bacteria 2913
265 nmdc:mga0k408_420_c1 3300050493 Bacteria 18783
266 nmdc:mga0k408_619_c1 3300050493 Bacteria 19558
267 Ga0500651_0005022 3300053093 Bacteria 7505
268 Ga0500608_001843 3300053122 Bacteria 7552
269 Ga0500614_005374 3300053123 Bacteria 2689
270 Ga0500618_000310 3300053125 Bacteria 36035
271 Ga0500622_0000269 3300053156 Bacteria 53310
272 Ga0500624_000660 3300053157 Bacteria 8961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100003304 Ga0070662_1000033045 330
2 3300013307 Ga0157372_10017203 Ga0157372_100172034 330
3 3300025933 Ga0207706_10007848 Ga0207706_100078485 330
4 3300013104 Ga0157370_10013401 Ga0157370_100134015 332
5 3300013306 Ga0163162_10000088 Ga0163162_1000008813 334
6 3300005539 Ga0068853_100018348 Ga0068853_1000183486 337
7 3300005548 Ga0070665_100000032 Ga0070665_10000003211 337
8 3300026041 Ga0207639_10051127 Ga0207639_100511273 337
9 3300028379 Ga0268266_10000030 Ga0268266_10000030316 337
10 3300013100 Ga0157373_10000944 Ga0157373_100009445 339
11 3300013102 Ga0157371_10004718 Ga0157371_100047183 339
12 3300013307 Ga0157372_10000376 Ga0157372_1000037615 339
13 3300013105 Ga0157369_10055778 Ga0157369_100557784 341
14 3300005367 Ga0070667_100017480 Ga0070667_1000174806 344
15 3300005617 Ga0068859_100043205 Ga0068859_1000432052 344
16 3300005843 Ga0068860_100007161 Ga0068860_10000716112 344
17 3300006931 Ga0097620_100043205 Ga0097620_1000432056 344
18 3300009093 Ga0105240_10009185 Ga0105240_100091858 344
19 3300013104 Ga0157370_10005140 Ga0157370_100051405 344
20 3300013297 Ga0157378_10047065 Ga0157378_100470653 344
21 3300025913 Ga0207695_10008488 Ga0207695_100084888 344
22 3300028381 Ga0268264_10005041 Ga0268264_1000504111 344
23 3300010375 Ga0105239_10031586 Ga0105239_100315869 345
24 3300025913 Ga0207695_10009078 Ga0207695_100090784 345
25 3300025250 Ga0209026_1000499 Ga0209026_10004998 348
26 3300046492 Ga0495585_0000248 Ga0495585_0000248_2772_3998 348
27 3300010375 Ga0105239_10057526 Ga0105239_100575264 349
28 3300025904 Ga0207647_10038514 Ga0207647_100385142 349
29 3300005563 Ga0068855_100039409 Ga0068855_1000394096 350
30 3300009093 Ga0105240_10038369 Ga0105240_100383695 350
31 3300025913 Ga0207695_10030533 Ga0207695_100305335 350
32 3300025949 Ga0207667_10005684 Ga0207667_1000568414 350
33 3300049583 Ga0501067_0092255 Ga0501067_0092255_17_1225 350
34 3300003320 rootH2_10017489 rootH2_1001748930 351
35 3300046512 Ga0495610_0000614 Ga0495610_0000614_18466_19692 351
36 3300046648 Ga0495611_0000582 Ga0495611_0000582_6143_7363 351
37 3300046665 Ga0495661_0029803 Ga0495661_0029803_1389_2615 351
38 3300005355 Ga0070671_100125097 Ga0070671_1001250973 352
39 3300013308 Ga0157375_10132540 Ga0157375_101325403 352
40 3300014325 Ga0163163_10052071 Ga0163163_100520711 352
41 3300026088 Ga0207641_10032690 Ga0207641_100326903 352
42 3300005338 Ga0068868_100006643 Ga0068868_1000066437 353
43 3300005364 Ga0070673_100027101 Ga0070673_1000271014 353
44 3300005456 Ga0070678_100080461 Ga0070678_1000804611 353
45 3300005459 Ga0068867_100000368 Ga0068867_10000036810 353
46 3300005539 Ga0068853_100289234 Ga0068853_1002892341 353
47 3300005616 Ga0068852_100001179 Ga0068852_1000011792 353
48 3300006237 Ga0097621_100000780 Ga0097621_10000078021 353
49 3300006358 Ga0068871_100000296 Ga0068871_10000029616 353
50 3300006881 Ga0068865_100000025 Ga0068865_10000002566 353
51 3300009176 Ga0105242_10025292 Ga0105242_100252923 353
52 3300009545 Ga0105237_10002672 Ga0105237_1000267216 353
53 3300009551 Ga0105238_10019438 Ga0105238_100194388 353
54 3300025907 Ga0207645_10000576 Ga0207645_100005767 353
55 3300025914 Ga0207671_10033431 Ga0207671_100334313 353
56 3300025938 Ga0207704_10009471 Ga0207704_100094714 353
57 3300025960 Ga0207651_10017974 Ga0207651_100179743 353
58 3300026023 Ga0207677_10004718 Ga0207677_100047186 353
59 3300026121 Ga0207683_10061322 Ga0207683_100613224 353
60 3300026142 Ga0207698_10038268 Ga0207698_100382682 353
61 3300013297 Ga0157378_10030417 Ga0157378_100304176 354
62 3300013307 Ga0157372_10134312 Ga0157372_101343122 354
63 3300049581 Ga0501047_0080584 Ga0501047_0080584_570_1940 354
64 3300006358 Ga0068871_100050462 Ga0068871_1000504622 355
65 3300003323 rootH1_10046962 rootH1_100469622 356
66 3300003781 Ga0055536_1000019 Ga0055536_1000019116 356
67 3300003791 Ga0055530_10000770 Ga0055530_1000077022 356
68 3300025292 Ga0209676_1000009 Ga0209676_100000967 356
69 3300025298 Ga0209050_1000094 Ga0209050_100009467 356
70 3300031731 Ga0307405_10000015 Ga0307405_1000001597 356
71 3300033180 Ga0307510_10000190 Ga0307510_1000019012 356
72 3300003323 rootH1_10014858 rootH1_100148585 357
73 3300013307 Ga0157372_10145292 Ga0157372_101452923 357
74 3300031903 Ga0307407_10000027 Ga0307407_1000002733 357
75 3300031995 Ga0307409_100047082 Ga0307409_1000470822 357
76 3300032002 Ga0307416_100000002 Ga0307416_10000000259 357
77 3300001990 JGI24737J22298_10003887 JGI24737J22298_100038876 358
78 3300002067 JGI24735J21928_10039169 JGI24735J21928_100391691 358
79 3300009093 Ga0105240_10000134 Ga0105240_10000134140 358
80 3300010375 Ga0105239_10000200 Ga0105239_1000020072 358
81 3300013104 Ga0157370_10011523 Ga0157370_100115232 358
82 3300013306 Ga0163162_10000093 Ga0163162_1000009335 358
83 3300013307 Ga0157372_10467548 Ga0157372_104675481 358
84 3300015261 Ga0182006_1006848 Ga0182006_10068482 358
85 3300025261 Ga0209233_1005911 Ga0209233_10059112 358
86 3300025904 Ga0207647_10002461 Ga0207647_100024612 358
87 3300025913 Ga0207695_10000010 Ga0207695_10000010250 358
88 3300046506 Ga0495583_0030137 Ga0495583_0030137_735_1961 358
89 3300046665 Ga0495661_0000114 Ga0495661_0000114_90533_91759 358
90 3300003320 rootH2_10004791 rootH2_1000479121 359
91 3300013102 Ga0157371_10000851 Ga0157371_1000085123 359
92 3300017792 Ga0163161_10001255 Ga0163161_1000125513 359
93 3300046507 Ga0495606_0081795 Ga0495606_0081795_228_1598 359
94 3300046512 Ga0495610_0000768 Ga0495610_0000768_16578_17795 359
95 3300049679 Ga0501249_000014 Ga0501249_000014_119607_120824 359
96 3300013308 Ga0157375_10002837 Ga0157375_100028377 360
97 3300047443 Ga0495687_013346 Ga0495687_013346_1500_2726 360
98 3300049569 Ga0501032_0008747 Ga0501032_0008747_6047_7273 360
99 3300049571 Ga0501034_0072752 Ga0501034_0072752_1016_2242 360
100 3300049574 Ga0501038_0073498 Ga0501038_0073498_103_1329 360
101 3300049579 Ga0501043_0029605 Ga0501043_0029605_868_2094 360
102 3300049581 Ga0501047_0009501 Ga0501047_0009501_4804_6030 360
103 3300049822 Ga0501035_0017935 Ga0501035_0017935_4390_5616 360
104 3300049823 Ga0501044_0014493 Ga0501044_0014493_103_1329 360
105 3300005288 Ga0065714_10064866 Ga0065714_1006486611 362
106 3300013104 Ga0157370_10001458 Ga0157370_100014587 362
107 3300014497 Ga0182008_10000213 Ga0182008_100002138 362
108 3300015261 Ga0182006_1002093 Ga0182006_10020936 362
109 3300017792 Ga0163161_10001554 Ga0163161_1000155413 362
110 3300017792 Ga0163161_10001837 Ga0163161_100018377 362
111 3300013102 Ga0157371_10004795 Ga0157371_100047954 363
112 3300013104 Ga0157370_10012015 Ga0157370_100120155 363
113 3300013104 Ga0157370_10115499 Ga0157370_101154992 363
114 3300013104 Ga0157370_10198883 Ga0157370_101988831 363
115 3300017792 Ga0163161_10003961 Ga0163161_100039615 363
116 3300046538 Ga0495609_0019184 Ga0495609_0019184_293_1516 363
117 3300048925 Ga0496122_0001661 Ga0496122_0001661_31647_32849 363
118 3300048926 Ga0496123_0073246 Ga0496123_0073246_119_1321 363
119 3300013105 Ga0157369_10000031 Ga0157369_1000003140 364
120 3300015262 Ga0182007_10000002 Ga0182007_1000000271 364
121 3300031548 Ga0307408_100003028 Ga0307408_1000030287 364
122 3300031911 Ga0307412_10009029 Ga0307412_100090293 364
123 3300001989 JGI24739J22299_10039981 JGI24739J22299_100399811 365
124 3300005262 Ga0065165_1000525 Ga0065165_100052547 365
125 3300013100 Ga0157373_10033645 Ga0157373_100336453 365
126 3300025297 Ga0209758_1006206 Ga0209758_10062068 365
127 3300032004 Ga0307414_10112676 Ga0307414_101126762 365
128 3300046507 Ga0495606_0000581 Ga0495606_0000581_21818_23044 365
129 3300046513 Ga0495616_0001533 Ga0495616_0001533_8539_9765 365
130 3300046660 Ga0495625_0000077 Ga0495625_0000077_35482_36708 365
131 3300046692 Ga0495671_0026131 Ga0495671_0026131_584_1810 365
132 3300046694 Ga0495649_0000011 Ga0495649_0000011_128510_129736 365
133 3300003323 rootH1_10036600 rootH1_100366001 366
134 3300013104 Ga0157370_10361357 Ga0157370_103613571 366
135 3300013306 Ga0163162_10000404 Ga0163162_100004045 366
136 3300013308 Ga0157375_10051287 Ga0157375_100512872 366
137 3300046513 Ga0495616_0001449 Ga0495616_0001449_2805_4040 366
138 3300002773 JGI25152J39213_1000195 JGI25152J39213_100019533 367
139 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001466 367
140 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004266 367
141 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000966 367
142 3300013104 Ga0157370_10001617 Ga0157370_1000161712 367
143 3300015682 Ga0183373_1004 Ga0183373_1004403 367
144 3300025245 Ga0207425_1000023 Ga0207425_100002365 367
145 3300025258 Ga0209129_1000032 Ga0209129_1000032208 367
146 3300025294 Ga0209025_1000047 Ga0209025_1000047208 367
147 3300025297 Ga0209758_1000145 Ga0209758_100014565 367
148 3300046453 Ga0495627_002665 Ga0495627_002665_1065_2282 368
149 3300046558 Ga0495633_0000005 Ga0495633_0000005_76393_77610 368
150 3300049571 Ga0501034_0177994 Ga0501034_0177994_43_1251 368
151 3300049589 Ga0501073_0037634 Ga0501073_0037634_1906_3114 368
152 iso_pu_bacteria 2738541283 2738754008 368
153 3300003316 rootH1_10030707 rootH1_100307073 369
154 3300037312 Ga0395899_0001130 Ga0395899_0001130_5047_6423 369
155 3300037418 Ga0395900_0000115 Ga0395900_0000115_56015_57391 369
156 3300037466 Ga0395898_0008980 Ga0395898_0008980_8128_9504 369
157 3300037471 Ga0395905_0000045 Ga0395905_0000045_55821_57197 369
158 3300038443 Ga0395901_0000254 Ga0395901_0000254_5634_7010 369
159 3300046471 Ga0495650_0000050 Ga0495650_0000050_230460_231686 369
160 3300053125 Ga0500618_000310 Ga0500618_000310_29636_30859 369
161 3300009545 Ga0105237_10000107 Ga0105237_1000010722 370
162 3300013105 Ga0157369_10000495 Ga0157369_100004955 370
163 3300025914 Ga0207671_10002981 Ga0207671_100029817 370
164 3300032004 Ga0307414_10001513 Ga0307414_100015139 370
165 3300047472 Ga0495686_0003145 Ga0495686_0003145_4261_5457 371
166 iso_pu_bacteria 2896109856 2896114261 371
167 iso_pu_bacteria 2929177148 2929180451 372
168 iso_pu_bacteria 2945977869 2945982834 372
169 iso_pu_bacteria 2946013367 2946017773 372
170 3300001979 JGI24740J21852_10011933 JGI24740J21852_100119333 373
171 3300005455 Ga0070663_100005782 Ga0070663_1000057823 373
172 3300010375 Ga0105239_10000005 Ga0105239_10000005408 373
173 3300013102 Ga0157371_10002144 Ga0157371_100021443 373
174 3300013104 Ga0157370_10207569 Ga0157370_102075692 373
175 3300013307 Ga0157372_10000048 Ga0157372_10000048107 373
176 3300026067 Ga0207678_10017407 Ga0207678_100174075 373
177 3300037312 Ga0395899_0000001 Ga0395899_0000001_484759_485970 373
178 3300037312 Ga0395899_0000522 Ga0395899_0000522_16690_17907 373
179 3300045836 Ga0466958_0170848 Ga0466958_0170848_22_1239 373
180 3300046507 Ga0495606_0009743 Ga0495606_0009743_5334_6545 373
181 3300046507 Ga0495606_0015025 Ga0495606_0015025_3088_4305 373
182 3300046810 Ga0495660_0046417 Ga0495660_0046417_901_2118 373
183 3300053156 Ga0500622_0000269 Ga0500622_0000269_12257_13471 374
184 3300053157 Ga0500624_000660 Ga0500624_000660_6772_8004 374
185 iso_pu_bacteria 2852627209 2852628400 374
186 iso_pu_bacteria 2919186247 2919186641 374
187 iso_pu_bacteria 2939664404 2939666089 374
188 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005123 375
189 3300006195 Ga0075366_10058626 Ga0075366_100586261 375
190 3300009093 Ga0105240_10000908 Ga0105240_1000090843 375
191 3300009551 Ga0105238_10255335 Ga0105238_102553352 375
192 3300010375 Ga0105239_10001053 Ga0105239_100010535 375
193 3300010375 Ga0105239_10055444 Ga0105239_100554445 375
194 3300025233 Ga0209437_100043 Ga0209437_100043275 375
195 3300025250 Ga0209026_1001979 Ga0209026_10019793 375
196 3300025913 Ga0207695_10000462 Ga0207695_1000046232 375
197 3300044683 Ga0466965_0038449 Ga0466965_0038449_342_1568 375
198 3300050493 nmdc:mga0k408_34089_c1 nmdc:mga0k408_34089_c1_1549_2787 375
199 iso_pu_bacteria 2585427687 2586206286 375
200 iso_pu_bacteria 2738541302 2738856167 375
201 iso_pu_bacteria 2739367651 2739588275 375
202 iso_pu_bacteria 2739367656 2739613754 375
203 iso_pu_bacteria 2818991437 2819546250 375
204 iso_pu_bacteria 2842722452 2842723920 375
205 iso_pu_bacteria 2842909656 2842912349 375
206 iso_pu_bacteria 2849281842 2849282783 375
207 iso_pu_bacteria 2904445276 2904446522 375
208 3300005337 Ga0070682_100049101 Ga0070682_1000491012 376
209 3300005530 Ga0070679_100097519 Ga0070679_1000975192 376
210 3300005530 Ga0070679_100189987 Ga0070679_1001899872 376
211 3300009174 Ga0105241_10041870 Ga0105241_100418702 376
212 3300009174 Ga0105241_10137366 Ga0105241_101373662 376
213 3300013104 Ga0157370_10216316 Ga0157370_102163161 376
214 3300013105 Ga0157369_10295047 Ga0157369_102950471 376
215 3300025917 Ga0207660_10022343 Ga0207660_100223434 376
216 3300025917 Ga0207660_10049206 Ga0207660_100492062 376
217 3300025949 Ga0207667_10354018 Ga0207667_103540182 376
218 iso_pu_bacteria 2857627736 2857629308 376
219 iso_pu_bacteria 2977232053 2977235832 376
220 3300005288 Ga0065714_10002332 Ga0065714_100023327 377
221 3300015261 Ga0182006_1002189 Ga0182006_10021894 377
222 iso_pu_bacteria 2739367663 2739648526 377
223 3300032004 Ga0307414_10000375 Ga0307414_1000037518 378
224 3300003790 Ga0055528_1001869 Ga0055528_10018697 379
225 3300003791 Ga0055530_10010606 Ga0055530_100106061 379
226 3300003794 Ga0055531_10023381 Ga0055531_100233812 379
227 3300014497 Ga0182008_10000157 Ga0182008_1000015739 379
228 3300025273 Ga0209673_1000014 Ga0209673_1000014274 379
229 3300025273 Ga0209673_1000018 Ga0209673_1000018222 379
230 3300025295 Ga0209564_1009444 Ga0209564_10094444 379
231 3300025297 Ga0209758_1015433 Ga0209758_10154332 379
232 3300025298 Ga0209050_1011398 Ga0209050_10113984 379
233 3300025302 Ga0207426_1002884 Ga0207426_10028843 379
234 3300025304 Ga0209257_1002608 Ga0209257_10026082 379
235 3300046512 Ga0495610_0002306 Ga0495610_0002306_11804_13024 379
236 iso_pu_bacteria 2945997725 2945999335 379
237 iso_pu_bacteria 2954016120 2954021732 379
238 3300005366 Ga0070659_100071114 Ga0070659_1000711142 380
239 3300005563 Ga0068855_100283645 Ga0068855_1002836452 380
240 3300006195 Ga0075366_10013264 Ga0075366_100132644 380
241 3300025932 Ga0207690_10039632 Ga0207690_100396322 380
242 3300031616 Ga0307508_10001280 Ga0307508_100012803 380
243 3300050493 nmdc:mga0k408_420_c1 nmdc:mga0k408_420_c1_2510_3739 380
244 3300053122 Ga0500608_001843 Ga0500608_001843_2928_4151 380
245 3300002772 JGI25164J39214_1001779 JGI25164J39214_10017792 381
246 3300003214 JGI25165J46597_1000414 JGI25165J46597_100041412 381
247 3300006195 Ga0075366_10000183 Ga0075366_1000018313 381
248 3300009545 Ga0105237_10010864 Ga0105237_100108646 381
249 3300010375 Ga0105239_10000012 Ga0105239_10000012231 381
250 3300013307 Ga0157372_10005097 Ga0157372_100050972 381
251 3300025231 Ga0207427_100098 Ga0207427_10009840 381
252 3300025233 Ga0209437_100008 Ga0209437_100008280 381
253 3300025261 Ga0209233_1000024 Ga0209233_1000024379 381
254 3300025914 Ga0207671_10008468 Ga0207671_100084685 381
255 3300028794 Ga0307515_10000172 Ga0307515_1000017243 381
256 3300028794 Ga0307515_10000174 Ga0307515_1000017475 381
257 3300046492 Ga0495585_0012954 Ga0495585_0012954_1475_2698 381
258 3300046524 Ga0495648_0003343 Ga0495648_0003343_8054_9277 381
259 3300046558 Ga0495633_0000161 Ga0495633_0000161_46252_47475 381
260 3300046616 Ga0495668_0000179 Ga0495668_0000179_73673_74896 381
261 3300046660 Ga0495625_0001645 Ga0495625_0001645_5381_6604 381
262 3300050493 nmdc:mga0k408_619_c1 nmdc:mga0k408_619_c1_12035_13258 381
263 3300053123 Ga0500614_005374 Ga0500614_005374_793_2016 381
264 3300005329 Ga0070683_100004733 Ga0070683_1000047335 382
265 3300005563 Ga0068855_100109184 Ga0068855_1001091842 382
266 3300009545 Ga0105237_10013163 Ga0105237_100131633 382
267 3300010375 Ga0105239_10000285 Ga0105239_1000028516 382
268 3300013100 Ga0157373_10000018 Ga0157373_1000001853 382
269 3300013307 Ga0157372_10000631 Ga0157372_1000063110 382
270 3300025208 Ga0209436_103127 Ga0209436_1031274 382
271 3300025233 Ga0209437_100030 Ga0209437_100030258 382
272 3300025284 Ga0209130_1003318 Ga0209130_10033183 382
273 3300025302 Ga0207426_1000700 Ga0207426_10007003 382
274 3300025914 Ga0207671_10001285 Ga0207671_100012859 382
275 3300025914 Ga0207671_10003820 Ga0207671_100038207 382
276 3300025949 Ga0207667_10030149 Ga0207667_100301493 382
277 3300030521 Ga0307511_10000502 Ga0307511_1000050220 382
278 3300046660 Ga0495625_0050791 Ga0495625_0050791_1247_2485 382
279 3300009093 Ga0105240_10000547 Ga0105240_1000054737 384
280 3300025913 Ga0207695_10000067 Ga0207695_10000067222 384
281 2162886007 SwRhRL2b_contig_1563179 SwRhRL2b_0558.00002420 386
282 3300005288 Ga0065714_10003557 Ga0065714_100035578 386
283 3300005289 Ga0065704_10000199 Ga0065704_1000019967 386
284 3300013100 Ga0157373_10000345 Ga0157373_1000034513 386
285 3300013102 Ga0157371_10001828 Ga0157371_100018287 386
286 3300013102 Ga0157371_10003345 Ga0157371_100033453 386
287 3300013104 Ga0157370_10110126 Ga0157370_101101262 386
288 3300013104 Ga0157370_10159390 Ga0157370_101593902 386
289 3300013104 Ga0157370_10262346 Ga0157370_102623461 386
290 3300013105 Ga0157369_10050968 Ga0157369_100509684 386
291 3300015261 Ga0182006_1007364 Ga0182006_10073643 386
292 3300031911 Ga0307412_10000017 Ga0307412_10000017133 386
293 3300032004 Ga0307414_10000287 Ga0307414_100002874 386
294 3300053093 Ga0500651_0005022 Ga0500651_0005022_3950_5188 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

27

255

0.84

PF07690

MFS_1

Major Facilitator Superfamily

74

415

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.7955 25 377
7eeb-assembly1.cif.gz_L structure of the catspermasome 0.7919 25 384
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.789 24 377
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7876 16 374
6oom-assembly2.cif.gz_A-2 protein a 0.7836 21 377
ID Description Score Start End Superfamily
af_P25744_212_408_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9197 24 194 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.913 22 197 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9128 24 211 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9116 24 217 1.20.1250.20
af_P9WJX7_21_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.911 24 203 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2W5E6C3-F1-model_v4 MFS transporter 0.9859 13 205 GO:0005886
GO:0015385
GO:1990961
AF-A0A2W5E6C3-F1-model_v4 MFS transporter 0.9758 13 205 GO:0005886
GO:0015385
GO:1990961
AF-A0A520H4W5-F1-model_v4 MFS transporter 0.9652 13 226 GO:0005886
GO:0015385
GO:1990961
AF-A0A520I7V3-F1-model_v4 MFS transporter 0.9526 15 236 GO:0005886
GO:0015385
GO:1990961
AF-A0A520H4W5-F1-model_v4 MFS transporter 0.9479 13 226 GO:0005886
GO:0015385
GO:1990961

Feature Viewer

pLDDT pTM Quality
81.18 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map