F392157

General Info

Members Datasets Scaffolds Average Seq Length
294 190 588 151

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000171|Ga0265327_1000017150
Length 145
Sequence MSRLQLALNVSDLEEAVVFYSSLFGVAPAKVRPGYANFAVADPPLKLVLFEGGDPGTVNHLGVEVGSAQEVAEAASTLAGRGRAGDLEEATTCCFAVQDKVWVDGPDGARWEIYTVLADAEPEDGAGPGCCGVTGDAGSPATTCC

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
176 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
177 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
178 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
179 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
180 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
181 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
182 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
183 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
184 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
185 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
186 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
187 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
188 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
189 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
190 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 0.68
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.19
Nodule 0.34
Rhizoplane 11.9
Rhizosphere 55.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000171 3300031251 Bacteria 139992
2 Ga0055540_1001853 3300003792 Bacteria 11910
3 Ga0068868_101150780 3300005338 Bacteria 716
4 Ga0070668_100007685 3300005347 Bacteria 8000
5 Ga0070668_100108707 3300005347 Bacteria 2206
6 Ga0070668_101656306 3300005347 Bacteria 587
7 Ga0070668_101986551 3300005347 Bacteria 536
8 Ga0070674_100213724 3300005356 Bacteria 1496
9 Ga0070674_100219690 3300005356 Bacteria 1478
10 Ga0070667_100254451 3300005367 Bacteria 1571
11 Ga0070667_101122837 3300005367 Bacteria 735
12 Ga0070709_10430746 3300005434 Bacteria 990
13 Ga0070714_100039504 3300005435 Bacteria 3973
14 Ga0070713_100050173 3300005436 Bacteria 3445
15 Ga0070678_101048599 3300005456 Bacteria 751
16 Ga0070685_10188278 3300005466 Bacteria 1333
17 Ga0068853_100040641 3300005539 Bacteria 3969
18 Ga0070665_102017283 3300005548 Bacteria 582
19 Ga0070704_101251526 3300005549 Bacteria 678
20 Ga0070702_100487926 3300005615 Bacteria 902
21 Ga0070702_100612325 3300005615 Bacteria 818
22 Ga0068864_100119037 3300005618 Bacteria 2359
23 Ga0068866_10310798 3300005718 Bacteria 988
24 Ga0068861_100044555 3300005719 Bacteria 3336
25 Ga0068870_10118740 3300005840 Bacteria 1520
26 Ga0068863_100662004 3300005841 Bacteria 1036
27 Ga0068860_100067200 3300005843 Bacteria 3407
28 Ga0068860_101855033 3300005843 Bacteria 624
29 Ga0068862_100115844 3300005844 Bacteria 2357
30 Ga0068862_100426406 3300005844 Bacteria 1246
31 Ga0068862_100816206 3300005844 Bacteria 912
32 Ga0081455_10009934 3300005937 Bacteria 9733
33 Ga0075365_10009500 3300006038 Bacteria 5595
34 Ga0075365_10068525 3300006038 Bacteria 2384
35 Ga0075365_10071111 3300006038 Bacteria 2342
36 Ga0075365_10104426 3300006038 Bacteria 1943
37 Ga0075365_10468164 3300006038 Bacteria 890
38 Ga0075365_10866080 3300006038 Bacteria 637
39 Ga0075368_10003351 3300006042 Bacteria 5337
40 Ga0075363_100005517 3300006048 Bacteria 5639
41 Ga0075363_100008757 3300006048 Bacteria 4729
42 Ga0075363_100058725 3300006048 Bacteria 2067
43 Ga0075363_100806324 3300006048 Bacteria 571
44 Ga0075364_10013784 3300006051 Bacteria 4980
45 Ga0075364_10017222 3300006051 Bacteria 4510
46 Ga0075364_10021114 3300006051 Bacteria 4101
47 Ga0075364_10038815 3300006051 Bacteria 3085
48 Ga0075364_10158537 3300006051 Bacteria 1527
49 Ga0075364_10283105 3300006051 Bacteria 1128
50 Ga0075364_10296725 3300006051 Bacteria 1100
51 Ga0075364_10453945 3300006051 Bacteria 876
52 Ga0070716_100047585 3300006173 Bacteria 2420
53 Ga0075362_10070845 3300006177 Bacteria 1592
54 Ga0075362_10149291 3300006177 Bacteria 1121
55 Ga0075362_10253348 3300006177 Bacteria 866
56 Ga0075362_10462670 3300006177 Bacteria 645
57 Ga0075362_10619761 3300006177 Bacteria 560
58 Ga0075367_10024310 3300006178 Bacteria 3416
59 Ga0075369_10005828 3300006186 Bacteria 4629
60 Ga0075369_10077023 3300006186 Bacteria 1475
61 Ga0075369_10142602 3300006186 Bacteria 1093
62 Ga0075369_10310120 3300006186 Bacteria 737
63 Ga0075366_10366651 3300006195 Bacteria 885
64 Ga0097621_100670409 3300006237 Bacteria 953
65 Ga0097621_101664286 3300006237 Bacteria 607
66 Ga0075370_10006186 3300006353 Bacteria 6006
67 Ga0075370_10012719 3300006353 Bacteria 4455
68 Ga0075370_10035680 3300006353 Bacteria 2792
69 Ga0075431_100031655 3300006847 Bacteria 5448
70 Ga0075429_100236502 3300006880 Bacteria 1600
71 Ga0111539_10963313 3300009094 Bacteria 992
72 Ga0105245_10179017 3300009098 Bacteria 2024
73 Ga0114129_10073935 3300009147 Bacteria 4748
74 Ga0105243_10001107 3300009148 Bacteria 24469
75 Ga0105248_10026505 3300009177 Bacteria 6448
76 Ga0105249_10012101 3300009553 Bacteria 7596
77 Ga0099796_10457885 3300010159 Bacteria 568
78 Ga0105239_10278431 3300010375 Bacteria 1883
79 Ga0105239_10691909 3300010375 Bacteria 1166
80 Ga0157347_1023099 3300012502 Bacteria 740
81 Ga0157369_10107966 3300013105 Bacteria 2961
82 Ga0157378_11196431 3300013297 Bacteria 799
83 Ga0163162_10010920 3300013306 Bacteria 8841
84 Ga0163162_10013796 3300013306 Bacteria 7892
85 Ga0163162_10091564 3300013306 Bacteria 3124
86 Ga0163162_10224447 3300013306 Bacteria 2008
87 Ga0163162_10287177 3300013306 Bacteria 1777
88 Ga0157375_10350553 3300013308 Bacteria 1642
89 Ga0157375_11309436 3300013308 Bacteria 852
90 Ga0157375_12538404 3300013308 Bacteria 612
91 Ga0163163_10275702 3300014325 Bacteria 1733
92 Ga0163163_10540527 3300014325 Bacteria 1228
93 Ga0157380_11409797 3300014326 Bacteria 747
94 Ga0157380_12152565 3300014326 Bacteria 621
95 Ga0157379_10101409 3300014968 Bacteria 2584
96 Ga0157379_10300980 3300014968 Bacteria 1462
97 Ga0157379_10875383 3300014968 Bacteria 851
98 Ga0163161_10600864 3300017792 Bacteria 907
99 Ga0163161_10615558 3300017792 Bacteria 897
100 Ga0163161_10752551 3300017792 Bacteria 815
101 Ga0206353_11302026 3300020082 Bacteria 611
102 Ga0224712_10681718 3300022467 Bacteria 505
103 Ga0209673_1025554 3300025273 Bacteria 1960
104 Ga0209051_1007271 3300025303 Bacteria 6082
105 Ga0209051_1027462 3300025303 Bacteria 2268
106 Ga0207692_10598583 3300025898 Bacteria 708
107 Ga0207642_10381944 3300025899 Bacteria 838
108 Ga0207693_10274786 3300025915 Bacteria 1320
109 Ga0207663_10545802 3300025916 Bacteria 906
110 Ga0207694_10236823 3300025924 Bacteria 1491
111 Ga0207687_10077901 3300025927 Bacteria 2385
112 Ga0207687_10234622 3300025927 Bacteria 1451
113 Ga0207700_10130889 3300025928 Bacteria 2048
114 Ga0207664_10317944 3300025929 Bacteria 1373
115 Ga0207644_10235212 3300025931 Bacteria 1457
116 Ga0207686_10040934 3300025934 Bacteria 2821
117 Ga0207709_10001501 3300025935 Bacteria 16125
118 Ga0207669_10365949 3300025937 Bacteria 1119
119 Ga0207669_10458698 3300025937 Bacteria 1011
120 Ga0207665_10098777 3300025939 Bacteria 2034
121 Ga0207711_10019752 3300025941 Bacteria 5613
122 Ga0207711_11115153 3300025941 Bacteria 730
123 Ga0207667_11558625 3300025949 Bacteria 630
124 Ga0207712_10192799 3300025961 Bacteria 1610
125 Ga0207668_10073640 3300025972 Bacteria 2448
126 Ga0207668_10105309 3300025972 Bacteria 2105
127 Ga0207668_10484990 3300025972 Bacteria 1061
128 Ga0207658_10499468 3300025986 Bacteria 1083
129 Ga0207677_10194074 3300026023 Bacteria 1608
130 Ga0207703_11453726 3300026035 Bacteria 659
131 Ga0207703_12000545 3300026035 Bacteria 556
132 Ga0207678_10160199 3300026067 Bacteria 1922
133 Ga0207708_10205324 3300026075 Bacteria 1573
134 Ga0207641_10060669 3300026088 Bacteria 3224
135 Ga0207641_10548354 3300026088 Bacteria 1127
136 Ga0207675_100060418 3300026118 Bacteria 3538
137 Ga0207675_100877171 3300026118 Bacteria 913
138 Ga0207683_11088907 3300026121 Bacteria 741
139 Ga0209813_10034306 3300027866 Bacteria 1514
140 Ga0207428_10229297 3300027907 Bacteria 1390
141 Ga0268265_10520342 3300028380 Bacteria 1124
142 Ga0268264_10022160 3300028381 Bacteria 5185
143 Ga0268264_10801919 3300028381 Bacteria 941
144 Ga0265327_10001738 3300031251 Bacteria 25803
145 Ga0307410_10065528 3300031852 Bacteria 2499
146 Ga0307409_100026472 3300031995 Bacteria 4091
147 Ga0307409_100800995 3300031995 Bacteria 950
148 Ga0307416_100087489 3300032002 Bacteria 2660
149 Ga0307411_11885146 3300032005 Bacteria 556
150 Ga0307415_100718743 3300032126 Bacteria 903
151 Ga0436361_1069879 3300039447 Bacteria 787
152 Ga0439465_0007876 3300041413 Bacteria 3376
153 Ga0451791_1907940 3300041451 Bacteria 664
154 Ga0451795_0998279 3300041456 Bacteria 500
155 Ga0451802_1966894 3300041460 Bacteria 737
156 Ga0439431_0001207 3300041997 Bacteria 5645
157 Ga0439448_0008030 3300042005 Bacteria 3078
158 Ga0439434_0309451 3300042435 Bacteria 547
159 Ga0439435_0042717 3300042436 Bacteria 1273
160 Ga0466972_0058649 3300044658 Bacteria 1848
161 Ga0466965_0043723 3300044683 Bacteria 2212
162 Ga0466968_0141008 3300044735 Bacteria 1102
163 Ga0466970_0090480 3300044765 Bacteria 1660
164 Ga0466970_0118870 3300044765 Bacteria 1447
165 Ga0466957_0062617 3300044842 Bacteria 2285
166 Ga0466959_0118246 3300045049 Bacteria 1886
167 Ga0466959_0288968 3300045049 Bacteria 1124
168 Ga0466967_0782397 3300045976 Bacteria 947
169 Ga0495638_0008294 3300046460 Bacteria 7377
170 Ga0495638_0042989 3300046460 Bacteria 2852
171 Ga0495638_0657265 3300046460 Bacteria 509
172 Ga0495594_0324673 3300046499 Bacteria 877
173 Ga0495640_0116987 3300046533 Bacteria 1736
174 Ga0495668_0033846 3300046616 Bacteria 2870
175 Ga0495625_0103826 3300046660 Bacteria 1949
176 Ga0495669_0154923 3300046684 Bacteria 1086
177 Ga0495649_0599177 3300046694 Bacteria 544
178 Ga0495674_0185092 3300047319 Bacteria 1733
179 Ga0495672_0072624 3300047320 Bacteria 1943
180 Ga0495672_0505203 3300047320 Bacteria 537
181 Ga0495677_0039916 3300047445 Bacteria 1716
182 Ga0495686_0007829 3300047472 Bacteria 7948
183 Ga0495686_0242887 3300047472 Bacteria 1015
184 Ga0495626_0375944 3300048091 Bacteria 552
185 Ga0496100_0004030 3300048903 Bacteria 7735
186 Ga0496100_0018261 3300048903 Bacteria 4157
187 Ga0496100_0204556 3300048903 Bacteria 1441
188 Ga0496101_0015101 3300048904 Bacteria 5197
189 Ga0496101_0113889 3300048904 Bacteria 2038
190 Ga0496101_0510473 3300048904 Bacteria 950
191 Ga0496101_0702007 3300048904 Bacteria 799
192 Ga0496102_0014590 3300048905 Bacteria 6829
193 Ga0496102_0207519 3300048905 Bacteria 1847
194 Ga0496102_0358266 3300048905 Bacteria 1373
195 Ga0496103_0104217 3300048906 Bacteria 1797
196 Ga0496103_0118186 3300048906 Bacteria 1688
197 Ga0496104_0035969 3300048907 Bacteria 4626
198 Ga0496105_0062762 3300048908 Bacteria 3066
199 Ga0496105_1077590 3300048908 Bacteria 598
200 Ga0496106_0010557 3300048909 Bacteria 6820
201 Ga0496107_0118828 3300048910 Bacteria 1946
202 Ga0496108_0175836 3300048911 Bacteria 1853
203 Ga0496108_0196149 3300048911 Bacteria 1751
204 Ga0496108_0733539 3300048911 Bacteria 855
205 Ga0496108_1052503 3300048911 Bacteria 693
206 Ga0496109_0112252 3300048912 Bacteria 2535
207 Ga0496109_0623544 3300048912 Bacteria 1015
208 Ga0496109_1421114 3300048912 Bacteria 629
209 Ga0496110_0245380 3300048913 Bacteria 1630
210 Ga0496112_0023895 3300048915 Bacteria 5847
211 Ga0496112_0311395 3300048915 Bacteria 1519
212 Ga0496112_1527961 3300048915 Bacteria 581
213 Ga0496113_0001061 3300048916 Bacteria 14835
214 Ga0496113_0207978 3300048916 Bacteria 1557
215 Ga0496114_0004326 3300048917 Bacteria 10993
216 Ga0496115_0009097 3300048918 Bacteria 7371
217 Ga0496117_0093743 3300048920 Bacteria 1925
218 Ga0496118_0003661 3300048921 Bacteria 19087
219 Ga0496120_0259848 3300048923 Bacteria 811
220 Ga0496122_0002846 3300048925 Bacteria 23684
221 Ga0496123_0000284 3300048926 Bacteria 99532
222 Ga0496125_0188020 3300048928 Bacteria 1367
223 Ga0496126_0002829 3300048929 Bacteria 22724
224 Ga0501032_0000484 3300049569 Bacteria 32268
225 Ga0501034_0042968 3300049571 Bacteria 4575
226 Ga0501037_0000213 3300049573 Bacteria 51760
227 Ga0501037_0254244 3300049573 Bacteria 1229
228 Ga0501038_0000083 3300049574 Bacteria 80545
229 Ga0501038_0073056 3300049574 Bacteria 2905
230 Ga0501039_0000068 3300049575 Bacteria 79387
231 Ga0501039_0093923 3300049575 Bacteria 2338
232 Ga0501043_0000562 3300049579 Bacteria 33187
233 Ga0501070_0000868 3300049586 Bacteria 27496
234 Ga0501077_0625916 3300049593 Bacteria 691
235 nmdc:mga03683_34061_c1 3300050489 Bacteria 2059
236 nmdc:mga03683_58568_c1 3300050489 Bacteria 1623
237 nmdc:mga03683_96660_c1 3300050489 Bacteria 643
238 nmdc:mga03n38_103631_c1 3300050490 Bacteria 1376
239 nmdc:mga03n38_145752_c1 3300050490 Bacteria 1187
240 nmdc:mga03n38_173394_c1 3300050490 Bacteria 1100
241 nmdc:mga00v17_117120_c1 3300050491 Bacteria 1694
242 nmdc:mga00v17_201558_c1 3300050491 Bacteria 1286
243 nmdc:mga00v17_257950_c1 3300050491 Bacteria 1131
244 nmdc:mga00v17_265351_c1 3300050491 Bacteria 1114
245 nmdc:mga00v17_39144_c1 3300050491 Bacteria 2838
246 nmdc:mga00v17_463240_c1 3300050491 Bacteria 823
247 nmdc:mga00v17_8846_c1 3300050491 Bacteria 5428
248 nmdc:mga0yw44_105990_c1 3300050492 Bacteria 1796
249 nmdc:mga0yw44_249625_c1 3300050492 Bacteria 1181
250 nmdc:mga0yw44_30689_c1 3300050492 Bacteria 3118
251 nmdc:mga0yw44_87628_c1 3300050492 Bacteria 1962
252 nmdc:mga0k408_205128_c1 3300050493 Bacteria 1177
253 nmdc:mga06z11_286536_c1 3300050494 Bacteria 977
254 nmdc:mga06z11_819796_c1 3300050494 Bacteria 567
255 nmdc:mga07m45_6789_c1 3300050496 Bacteria 5814
256 nmdc:mga07m45_68393_c1 3300050496 Bacteria 2019
257 nmdc:mga07m45_83079_c1 3300050496 Bacteria 1830
258 nmdc:mga05p37_107031_c1 3300050507 Bacteria 3440
259 nmdc:mga09592_255348_c1 3300050508 Bacteria 1519
260 nmdc:mga06r32_25903_c1 3300050510 Bacteria 5461
261 nmdc:mga08y16_1097947_c1 3300050511 Bacteria 771
262 nmdc:mga0sz30_170893_c1 3300050516 Bacteria 964
263 nmdc:mga0sz30_265766_c1 3300050516 Bacteria 764
264 nmdc:mga0sz30_45316_c1 3300050516 Bacteria 1304
265 Ga0500610_0105530 3300053079 Bacteria 1453
266 Ga0495655_0075513 3300053083 Bacteria 952
267 Ga0500578_0518213 3300053086 Bacteria 668
268 Ga0500643_013716 3300053087 Bacteria 2848
269 Ga0500556_0002835 3300053104 Bacteria 5299
270 Ga0500556_0020586 3300053104 Bacteria 2113
271 Ga0500562_009305 3300053108 Bacteria 2484
272 Ga0500658_0303456 3300053134 Bacteria 734
273 Ga0500564_133308 3300053138 Bacteria 1073
274 Ga0500588_0167771 3300053146 Bacteria 802
275 Ga0500616_0015272 3300053153 Bacteria 4396
276 Ga0500627_0050717 3300053158 Bacteria 1808
277 Ga0500611_113850 3300053727 Bacteria 714
278 Ga0500645_000020 3300053730 Bacteria 134162
279 2644639775 2643221715 Bacteria 6671032
280 2738667816 2738541264 Bacteria 5935393
281 2738705655 2738541274 Bacteria 6909446
282 2739146886 2738541356 Bacteria 5935017
283 2739206179 2738543005 Bacteria 5278128
284 2739235468 2738543011 Bacteria 5731169
285 2739332472 2738543028 Bacteria 6917070
286 2744953805 2744054611 Bacteria 5611514
287 2842137771 2842134933 Bacteria 5847019
288 2842892635 2842888712 Bacteria 4279094
289 2889301532 2889300758 Bacteria 5690814
290 2902811113 2902810491 Bacteria 6794147
291 2928146622 2928142448 Bacteria 5288925
292 2929215745 2929212328 Bacteria 7708288
293 2932398851 2932398195 Bacteria 3847976
294 2939747741 2939743619 Bacteria 5762299
295 Ga0265327_10000171
296 Ga0055540_1001853
297 Ga0068868_101150780
298 Ga0070668_100007685
299 Ga0070668_100108707
300 Ga0070668_101656306
301 Ga0070668_101986551
302 Ga0070674_100213724
303 Ga0070674_100219690
304 Ga0070667_100254451
305 Ga0070667_101122837
306 Ga0070709_10430746
307 Ga0070714_100039504
308 Ga0070713_100050173
309 Ga0070678_101048599
310 Ga0070685_10188278
311 Ga0068853_100040641
312 Ga0070665_102017283
313 Ga0070704_101251526
314 Ga0070702_100487926
315 Ga0070702_100612325
316 Ga0068864_100119037
317 Ga0068866_10310798
318 Ga0068861_100044555
319 Ga0068870_10118740
320 Ga0068863_100662004
321 Ga0068860_100067200
322 Ga0068860_101855033
323 Ga0068862_100115844
324 Ga0068862_100426406
325 Ga0068862_100816206
326 Ga0081455_10009934
327 Ga0075365_10009500
328 Ga0075365_10068525
329 Ga0075365_10071111
330 Ga0075365_10104426
331 Ga0075365_10468164
332 Ga0075365_10866080
333 Ga0075368_10003351
334 Ga0075363_100005517
335 Ga0075363_100008757
336 Ga0075363_100058725
337 Ga0075363_100806324
338 Ga0075364_10013784
339 Ga0075364_10017222
340 Ga0075364_10021114
341 Ga0075364_10038815
342 Ga0075364_10158537
343 Ga0075364_10283105
344 Ga0075364_10296725
345 Ga0075364_10453945
346 Ga0070716_100047585
347 Ga0075362_10070845
348 Ga0075362_10149291
349 Ga0075362_10253348
350 Ga0075362_10462670
351 Ga0075362_10619761
352 Ga0075367_10024310
353 Ga0075369_10005828
354 Ga0075369_10077023
355 Ga0075369_10142602
356 Ga0075369_10310120
357 Ga0075366_10366651
358 Ga0097621_100670409
359 Ga0097621_101664286
360 Ga0075370_10006186
361 Ga0075370_10012719
362 Ga0075370_10035680
363 Ga0075431_100031655
364 Ga0075429_100236502
365 Ga0111539_10963313
366 Ga0105245_10179017
367 Ga0114129_10073935
368 Ga0105243_10001107
369 Ga0105248_10026505
370 Ga0105249_10012101
371 Ga0099796_10457885
372 Ga0105239_10278431
373 Ga0105239_10691909
374 Ga0157347_1023099
375 Ga0157369_10107966
376 Ga0157378_11196431
377 Ga0163162_10010920
378 Ga0163162_10013796
379 Ga0163162_10091564
380 Ga0163162_10224447
381 Ga0163162_10287177
382 Ga0157375_10350553
383 Ga0157375_11309436
384 Ga0157375_12538404
385 Ga0163163_10275702
386 Ga0163163_10540527
387 Ga0157380_11409797
388 Ga0157380_12152565
389 Ga0157379_10101409
390 Ga0157379_10300980
391 Ga0157379_10875383
392 Ga0163161_10600864
393 Ga0163161_10615558
394 Ga0163161_10752551
395 Ga0206353_11302026
396 Ga0224712_10681718
397 Ga0209673_1025554
398 Ga0209051_1007271
399 Ga0209051_1027462
400 Ga0207692_10598583
401 Ga0207642_10381944
402 Ga0207693_10274786
403 Ga0207663_10545802
404 Ga0207694_10236823
405 Ga0207687_10077901
406 Ga0207687_10234622
407 Ga0207700_10130889
408 Ga0207664_10317944
409 Ga0207644_10235212
410 Ga0207686_10040934
411 Ga0207709_10001501
412 Ga0207669_10365949
413 Ga0207669_10458698
414 Ga0207665_10098777
415 Ga0207711_10019752
416 Ga0207711_11115153
417 Ga0207667_11558625
418 Ga0207712_10192799
419 Ga0207668_10073640
420 Ga0207668_10105309
421 Ga0207668_10484990
422 Ga0207658_10499468
423 Ga0207677_10194074
424 Ga0207703_11453726
425 Ga0207703_12000545
426 Ga0207678_10160199
427 Ga0207708_10205324
428 Ga0207641_10060669
429 Ga0207641_10548354
430 Ga0207675_100060418
431 Ga0207675_100877171
432 Ga0207683_11088907
433 Ga0209813_10034306
434 Ga0207428_10229297
435 Ga0268265_10520342
436 Ga0268264_10022160
437 Ga0268264_10801919
438 Ga0265327_10001738
439 Ga0307410_10065528
440 Ga0307409_100026472
441 Ga0307409_100800995
442 Ga0307416_100087489
443 Ga0307411_11885146
444 Ga0307415_100718743
445 Ga0436361_1069879
446 Ga0439465_0007876
447 Ga0451791_1907940
448 Ga0451795_0998279
449 Ga0451802_1966894
450 Ga0439431_0001207
451 Ga0439448_0008030
452 Ga0439434_0309451
453 Ga0439435_0042717
454 Ga0466972_0058649
455 Ga0466965_0043723
456 Ga0466968_0141008
457 Ga0466970_0090480
458 Ga0466970_0118870
459 Ga0466957_0062617
460 Ga0466959_0118246
461 Ga0466959_0288968
462 Ga0466967_0782397
463 Ga0495638_0008294
464 Ga0495638_0042989
465 Ga0495638_0657265
466 Ga0495594_0324673
467 Ga0495640_0116987
468 Ga0495668_0033846
469 Ga0495625_0103826
470 Ga0495669_0154923
471 Ga0495649_0599177
472 Ga0495674_0185092
473 Ga0495672_0072624
474 Ga0495672_0505203
475 Ga0495677_0039916
476 Ga0495686_0007829
477 Ga0495686_0242887
478 Ga0495626_0375944
479 Ga0496100_0004030
480 Ga0496100_0018261
481 Ga0496100_0204556
482 Ga0496101_0015101
483 Ga0496101_0113889
484 Ga0496101_0510473
485 Ga0496101_0702007
486 Ga0496102_0014590
487 Ga0496102_0207519
488 Ga0496102_0358266
489 Ga0496103_0104217
490 Ga0496103_0118186
491 Ga0496104_0035969
492 Ga0496105_0062762
493 Ga0496105_1077590
494 Ga0496106_0010557
495 Ga0496107_0118828
496 Ga0496108_0175836
497 Ga0496108_0196149
498 Ga0496108_0733539
499 Ga0496108_1052503
500 Ga0496109_0112252
501 Ga0496109_0623544
502 Ga0496109_1421114
503 Ga0496110_0245380
504 Ga0496112_0023895
505 Ga0496112_0311395
506 Ga0496112_1527961
507 Ga0496113_0001061
508 Ga0496113_0207978
509 Ga0496114_0004326
510 Ga0496115_0009097
511 Ga0496117_0093743
512 Ga0496118_0003661
513 Ga0496120_0259848
514 Ga0496122_0002846
515 Ga0496123_0000284
516 Ga0496125_0188020
517 Ga0496126_0002829
518 Ga0501032_0000484
519 Ga0501034_0042968
520 Ga0501037_0000213
521 Ga0501037_0254244
522 Ga0501038_0000083
523 Ga0501038_0073056
524 Ga0501039_0000068
525 Ga0501039_0093923
526 Ga0501043_0000562
527 Ga0501070_0000868
528 Ga0501077_0625916
529 nmdc:mga03683_34061_c1
530 nmdc:mga03683_58568_c1
531 nmdc:mga03683_96660_c1
532 nmdc:mga03n38_103631_c1
533 nmdc:mga03n38_145752_c1
534 nmdc:mga03n38_173394_c1
535 nmdc:mga00v17_117120_c1
536 nmdc:mga00v17_201558_c1
537 nmdc:mga00v17_257950_c1
538 nmdc:mga00v17_265351_c1
539 nmdc:mga00v17_39144_c1
540 nmdc:mga00v17_463240_c1
541 nmdc:mga00v17_8846_c1
542 nmdc:mga0yw44_105990_c1
543 nmdc:mga0yw44_249625_c1
544 nmdc:mga0yw44_30689_c1
545 nmdc:mga0yw44_87628_c1
546 nmdc:mga0k408_205128_c1
547 nmdc:mga06z11_286536_c1
548 nmdc:mga06z11_819796_c1
549 nmdc:mga07m45_6789_c1
550 nmdc:mga07m45_68393_c1
551 nmdc:mga07m45_83079_c1
552 nmdc:mga05p37_107031_c1
553 nmdc:mga09592_255348_c1
554 nmdc:mga06r32_25903_c1
555 nmdc:mga08y16_1097947_c1
556 nmdc:mga0sz30_170893_c1
557 nmdc:mga0sz30_265766_c1
558 nmdc:mga0sz30_45316_c1
559 Ga0500610_0105530
560 Ga0495655_0075513
561 Ga0500578_0518213
562 Ga0500643_013716
563 Ga0500556_0002835
564 Ga0500556_0020586
565 Ga0500562_009305
566 Ga0500658_0303456
567 Ga0500564_133308
568 Ga0500588_0167771
569 Ga0500616_0015272
570 Ga0500627_0050717
571 Ga0500611_113850
572 Ga0500645_000020
573 2644639775
574 2738667816
575 2738705655
576 2739146886
577 2739206179
578 2739235468
579 2739332472
580 2744953805
581 2842137771
582 2842892635
583 2889301532
584 2902811113
585 2928146622
586 2929215745
587 2932398851
588 2939747741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9464 1 116
6xck-assembly3.cif.gz_A crystal structure of c-as lyase with mutation k105e 0.9361 1 116
5d4f-assembly1.cif.gz_A crystal structure of c-as lyase with fe(iii) 0.9343 1 116
6xa0-assembly1.cif.gz_B crystal structure of c-as lyase with mutation k105r with ni(ii) 0.9332 1 116
5c68-assembly1.cif.gz_A crystal structure of c-as lyase at 1.46 angstroms resolution 0.9318 1 116
ID Description Score Start End Superfamily
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8987 5 52 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8928 5 50 3.30.720.120
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.876 1 118 3.10.180.10
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8685 1 118 3.10.180.10
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7928 7 50 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A6I3FET5-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9906 1 80 GO:0046686
GO:0051213
AF-A0A5E4RUQ9-F1-model_v4 Cadmium-induced protein CadI 0.9882 3 50
AF-A0A3N4T8U0-F1-model_v4 deleted 0.9796 3 52
AF-A0A2S9GBP2-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9755 5 89 GO:0046686
GO:0051213
AF-A0A7C9U2G7-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9735 3 51 GO:0046686

Map