F392152

General Info

Members Datasets Scaffolds Average Seq Length
294 192 588 193

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10002419|Ga0265760_100024197
Length 219
Sequence VGTTAFGCPLSEAQLAFVLQSWVGRPTLIMRIVAGKYRSRQLKSLPGLDVRPTADRLRETLFNVLTAGNPSAMEGTVWVDLFAGTGAVGIEALGRGASMVHFVESSGRSAELIRKNLASLEIGTGFQILKQDSIRALRALESSGMTADFVFLDPPYDAEGAYRQTLETLSKSRLLRPESIIIAEHQKKFDPGESFQSLVRYRTLEQGDAALSFYRRVST

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
149 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 24.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10002419 3300031090 Bacteria 5452
2 JGI24752J21851_1005072 3300001976 Unclassified 1723
3 JGI24747J21853_1006917 3300001978 Bacteria 1083
4 JGI24034J26672_10000666 3300002239 Bacteria 4416
5 JGI24751J29686_10001679 3300002459 Bacteria 4553
6 rootH1_10213659 3300003323 Unclassified 1053
7 Ga0065712_10097901 3300005290 Bacteria 2136
8 Ga0065707_10308970 3300005295 Unclassified 988
9 Ga0070658_10187718 3300005327 Bacteria 1741
10 Ga0070676_10083261 3300005328 Bacteria 1945
11 Ga0070683_100005690 3300005329 Bacteria 10410
12 Ga0070690_100004767 3300005330 Bacteria 7566
13 Ga0070670_100017432 3300005331 Bacteria 6160
14 Ga0070677_10015741 3300005333 Bacteria 2682
15 Ga0068869_100000542 3300005334 Bacteria 21123
16 Ga0068868_100051123 3300005338 Bacteria 3249
17 Ga0068868_100342716 3300005338 Unclassified 1278
18 Ga0070660_100014554 3300005339 Bacteria 5672
19 Ga0070689_100136297 3300005340 Bacteria 1971
20 Ga0070661_100005140 3300005344 Bacteria 9012
21 Ga0070668_100011172 3300005347 Bacteria 6686
22 Ga0070669_100022993 3300005353 Bacteria 4460
23 Ga0070669_100286405 3300005353 Bacteria 1321
24 Ga0070675_100113890 3300005354 Bacteria 2291
25 Ga0070674_100277762 3300005356 Unclassified 1326
26 Ga0070673_100091614 3300005364 Bacteria 2485
27 Ga0070688_100000617 3300005365 Bacteria 17791
28 Ga0070659_100012421 3300005366 Bacteria 6315
29 Ga0070667_100250283 3300005367 Bacteria 1584
30 Ga0070713_100029774 3300005436 Unclassified 4327
31 Ga0070713_100085373 3300005436 Bacteria 2704
32 Ga0070708_100015481 3300005445 Bacteria 6302
33 Ga0070708_100076339 3300005445 Bacteria 3026
34 Ga0070708_100137789 3300005445 Bacteria 2262
35 Ga0070708_100327889 3300005445 Bacteria 1442
36 Ga0070708_100829467 3300005445 Unclassified 869
37 Ga0070663_100009895 3300005455 Bacteria 5927
38 Ga0070678_100066855 3300005456 Unclassified 2673
39 Ga0070681_10617108 3300005458 Unclassified 999
40 Ga0068867_100031069 3300005459 Bacteria 3855
41 Ga0068867_100471898 3300005459 Unclassified 1073
42 Ga0070685_10001498 3300005466 Bacteria 12310
43 Ga0070685_10151739 3300005466 Bacteria 1469
44 Ga0070706_100019937 3300005467 Bacteria 6182
45 Ga0070706_100050441 3300005467 Bacteria 3841
46 Ga0070706_101026528 3300005467 Unclassified 760
47 Ga0070707_100011821 3300005468 Bacteria 8151
48 Ga0070707_100021640 3300005468 Bacteria 6079
49 Ga0070707_100112772 3300005468 Unclassified 2638
50 Ga0070707_100927425 3300005468 Bacteria 836
51 Ga0070698_100149526 3300005471 Bacteria 2283
52 Ga0070699_100008909 3300005518 Bacteria 8691
53 Ga0070699_100361029 3300005518 Unclassified 1309
54 Ga0070684_100003517 3300005535 Bacteria 11772
55 Ga0070697_100012550 3300005536 Bacteria 6637
56 Ga0070697_100024609 3300005536 Bacteria 4795
57 Ga0070697_100057705 3300005536 Unclassified 3158
58 Ga0070697_100157232 3300005536 Bacteria 1919
59 Ga0070697_100202217 3300005536 Bacteria 1689
60 Ga0070672_100013959 3300005543 Bacteria 5683
61 Ga0070686_100009065 3300005544 Bacteria 5581
62 Ga0070665_100251742 3300005548 Bacteria 1767
63 Ga0070704_100244081 3300005549 Bacteria 1471
64 Ga0070704_100396748 3300005549 Unclassified 1176
65 Ga0070664_100015138 3300005564 Bacteria 6299
66 Ga0068857_100000556 3300005577 Bacteria 27260
67 Ga0068854_100450748 3300005578 Unclassified 1074
68 Ga0068856_100014945 3300005614 Bacteria 7496
69 Ga0070702_100086094 3300005615 Unclassified 1895
70 Ga0068859_100009906 3300005617 Bacteria 9626
71 Ga0068859_100165646 3300005617 Bacteria 2290
72 Ga0068866_10020785 3300005718 Unclassified 3013
73 Ga0068866_10037950 3300005718 Unclassified 2369
74 Ga0068866_10244670 3300005718 Bacteria 1094
75 Ga0068861_100205497 3300005719 Bacteria 1656
76 Ga0068861_101103703 3300005719 Unclassified 762
77 Ga0068851_10007835 3300005834 Bacteria 4918
78 Ga0068870_10002556 3300005840 Bacteria 7605
79 Ga0068863_100013974 3300005841 Bacteria 7738
80 Ga0068863_100071852 3300005841 Bacteria 3274
81 Ga0068863_100179464 3300005841 Bacteria 2033
82 Ga0068863_100192841 3300005841 Bacteria 1958
83 Ga0068858_100004958 3300005842 Bacteria 13041
84 Ga0068858_100364424 3300005842 Bacteria 1385
85 Ga0068860_100042278 3300005843 Unclassified 4353
86 Ga0068860_100203454 3300005843 Bacteria 1919
87 Ga0081540_1214878 3300005983 Bacteria 689
88 Ga0070717_10002152 3300006028 Bacteria 13812
89 Ga0070717_10040457 3300006028 Unclassified 3796
90 Ga0070717_10196404 3300006028 Bacteria 1765
91 Ga0070717_10206987 3300006028 Bacteria 1721
92 Ga0070716_100110451 3300006173 Bacteria 1703
93 Ga0070716_100320604 3300006173 Unclassified 1086
94 Ga0070712_100000309 3300006175 Bacteria 27477
95 Ga0070712_100023403 3300006175 Bacteria 4081
96 Ga0070712_100053020 3300006175 Unclassified 2831
97 Ga0097621_100409236 3300006237 Bacteria 1215
98 Ga0068871_100299906 3300006358 Unclassified 1410
99 Ga0075434_100000359 3300006871 Bacteria 33102
100 Ga0068865_100158656 3300006881 Unclassified 1723
101 Ga0075436_100240543 3300006914 Unclassified 1287
102 Ga0075436_100438255 3300006914 Unclassified 950
103 Ga0097620_100009906 3300006931 Bacteria 9626
104 Ga0097620_100165630 3300006931 Bacteria 2290
105 Ga0075435_100002795 3300007076 Bacteria 11665
106 Ga0105240_10124351 3300009093 Bacteria 3102
107 Ga0105245_10187165 3300009098 Bacteria 1981
108 Ga0105245_10815065 3300009098 Bacteria 972
109 Ga0105247_10003131 3300009101 Bacteria 10913
110 Ga0114129_10004652 3300009147 Bacteria 19376
111 Ga0114129_10171915 3300009147 Unclassified 2953
112 Ga0105241_10007141 3300009174 Bacteria 8221
113 Ga0105242_10046231 3300009176 Bacteria 3531
114 Ga0105248_10054588 3300009177 Unclassified 4481
115 Ga0105237_10083723 3300009545 Unclassified 3180
116 Ga0105238_10325544 3300009551 Bacteria 1523
117 Ga0105249_10014167 3300009553 Bacteria 7048
118 Ga0105239_10007481 3300010375 Bacteria 12534
119 Ga0105239_10063933 3300010375 Bacteria 4040
120 Ga0105239_11378114 3300010375 Bacteria 814
121 Ga0105246_10013190 3300011119 Bacteria 5175
122 Ga0105246_10207530 3300011119 Bacteria 1527
123 Ga0157373_10047574 3300013100 Bacteria 3059
124 Ga0157374_10028468 3300013296 Bacteria 5047
125 Ga0157374_10073183 3300013296 Unclassified 3235
126 Ga0157378_10032626 3300013297 Bacteria 4602
127 Ga0163162_10000822 3300013306 Bacteria 28869
128 Ga0163162_10056082 3300013306 Bacteria 3969
129 Ga0157372_10055567 3300013307 Bacteria 4422
130 Ga0157372_10751083 3300013307 Unclassified 1134
131 Ga0157375_10025708 3300013308 Bacteria 5477
132 Ga0157375_10042807 3300013308 Bacteria 4386
133 Ga0157375_10471553 3300013308 Bacteria 1420
134 Ga0163163_10049872 3300014325 Bacteria 4121
135 Ga0163163_10602813 3300014325 Bacteria 1161
136 Ga0163163_11594621 3300014325 Unclassified 714
137 Ga0157380_10056941 3300014326 Bacteria 3111
138 Ga0157380_10388107 3300014326 Bacteria 1320
139 Ga0182008_10043372 3300014497 Bacteria 2239
140 Ga0182008_10200655 3300014497 Bacteria 1015
141 Ga0157379_10237328 3300014968 Bacteria 1653
142 Ga0157379_10359984 3300014968 Bacteria 1333
143 Ga0157379_10636480 3300014968 Unclassified 998
144 Ga0157376_10036127 3300014969 Unclassified 4000
145 Ga0157376_10083493 3300014969 Bacteria 2748
146 Ga0157376_10409658 3300014969 Bacteria 1313
147 Ga0182006_1037474 3300015261 Bacteria 1921
148 Ga0182007_10015624 3300015262 Bacteria 2825
149 Ga0224570_100665 3300022730 Bacteria 2720
150 Ga0224572_1007209 3300024225 Unclassified 2032
151 Ga0224572_1032460 3300024225 Bacteria 994
152 Ga0228598_1000447 3300024227 Bacteria 8399
153 Ga0228598_1000914 3300024227 Bacteria 6392
154 Ga0207697_10005179 3300025315 Bacteria 6087
155 Ga0207656_10218663 3300025321 Unclassified 925
156 Ga0207692_10011115 3300025898 Bacteria 3816
157 Ga0207642_10041565 3300025899 Unclassified 2014
158 Ga0207642_10244623 3300025899 Unclassified 1015
159 Ga0207710_10170539 3300025900 Unclassified 1064
160 Ga0207688_10002810 3300025901 Bacteria 9451
161 Ga0207647_10000813 3300025904 Bacteria 24219
162 Ga0207699_10011233 3300025906 Unclassified 4515
163 Ga0207699_10169592 3300025906 Bacteria 1459
164 Ga0207699_10329638 3300025906 Bacteria 1073
165 Ga0207699_10478559 3300025906 Bacteria 896
166 Ga0207645_10002635 3300025907 Bacteria 13985
167 Ga0207643_10001249 3300025908 Bacteria 14938
168 Ga0207705_10705514 3300025909 Unclassified 784
169 Ga0207684_10002015 3300025910 Bacteria 20938
170 Ga0207684_10033148 3300025910 Unclassified 4393
171 Ga0207684_10091863 3300025910 Bacteria 2587
172 Ga0207684_10839657 3300025910 Unclassified 775
173 Ga0207654_10593672 3300025911 Bacteria 790
174 Ga0207695_10474823 3300025913 Unclassified 1133
175 Ga0207671_10247572 3300025914 Unclassified 1401
176 Ga0207693_10006665 3300025915 Bacteria 9539
177 Ga0207693_10176137 3300025915 Unclassified 1683
178 Ga0207660_10212666 3300025917 Unclassified 1515
179 Ga0207657_10010924 3300025919 Bacteria 9034
180 Ga0207649_10001140 3300025920 Bacteria 16078
181 Ga0207652_11277416 3300025921 Unclassified 636
182 Ga0207646_10001576 3300025922 Bacteria 27888
183 Ga0207646_10054478 3300025922 Unclassified 3577
184 Ga0207646_10055866 3300025922 Bacteria 3530
185 Ga0207646_10166264 3300025922 Bacteria 1991
186 Ga0207694_10776934 3300025924 Unclassified 809
187 Ga0207650_10000150 3300025925 Bacteria 83380
188 Ga0207659_10069555 3300025926 Bacteria 2564
189 Ga0207687_10317052 3300025927 Unclassified 1261
190 Ga0207687_10552580 3300025927 Bacteria 966
191 Ga0207700_10060232 3300025928 Unclassified 2874
192 Ga0207700_10096738 3300025928 Bacteria 2345
193 Ga0207700_10558563 3300025928 Unclassified 1016
194 Ga0207700_10646911 3300025928 Unclassified 942
195 Ga0207664_10605642 3300025929 Bacteria 984
196 Ga0207644_10072480 3300025931 Bacteria 2522
197 Ga0207690_10013253 3300025932 Bacteria 4950
198 Ga0207706_10004536 3300025933 Bacteria 13031
199 Ga0207670_10127305 3300025936 Bacteria 1860
200 Ga0207665_10013840 3300025939 Bacteria 5305
201 Ga0207665_10168233 3300025939 Bacteria 1581
202 Ga0207691_10005259 3300025940 Bacteria 12493
203 Ga0207691_10197568 3300025940 Bacteria 1752
204 Ga0207711_10236012 3300025941 Bacteria 1676
205 Ga0207689_10003567 3300025942 Bacteria 14224
206 Ga0207689_10009453 3300025942 Bacteria 8417
207 Ga0207661_10001443 3300025944 Bacteria 16030
208 Ga0207679_10001208 3300025945 Bacteria 16415
209 Ga0207667_10407409 3300025949 Bacteria 1384
210 Ga0207668_10092758 3300025972 Bacteria 2223
211 Ga0207640_10241793 3300025981 Unclassified 1395
212 Ga0207658_10301355 3300025986 Bacteria 1381
213 Ga0207658_10392427 3300025986 Bacteria 1218
214 Ga0207677_10021611 3300026023 Bacteria 3935
215 Ga0207677_10150798 3300026023 Bacteria 1793
216 Ga0207677_10700000 3300026023 Unclassified 899
217 Ga0207703_10004444 3300026035 Bacteria 11519
218 Ga0207703_10172537 3300026035 Bacteria 1903
219 Ga0207703_10966973 3300026035 Bacteria 816
220 Ga0207678_10005661 3300026067 Bacteria 11168
221 Ga0207702_10171169 3300026078 Bacteria 1991
222 Ga0207641_10000147 3300026088 Bacteria 99902
223 Ga0207641_10022531 3300026088 Bacteria 5184
224 Ga0207641_10136805 3300026088 Bacteria 2206
225 Ga0207648_10006258 3300026089 Bacteria 11853
226 Ga0207648_10107830 3300026089 Bacteria 2445
227 Ga0207676_10002739 3300026095 Bacteria 12543
228 Ga0207674_10000432 3300026116 Bacteria 54683
229 Ga0207675_100051008 3300026118 Bacteria 3861
230 Ga0207675_100151788 3300026118 Bacteria 2205
231 Ga0207683_10005098 3300026121 Bacteria 11271
232 Ga0207683_10590783 3300026121 Bacteria 1027
233 Ga0265356_1000415 3300028017 Bacteria 7719
234 Ga0265355_1005291 3300028036 Bacteria 989
235 Ga0268266_10017397 3300028379 Bacteria 6133
236 Ga0268266_10461686 3300028379 Bacteria 1208
237 Ga0268264_10166736 3300028381 Bacteria 1989
238 Ga0268264_10279415 3300028381 Unclassified 1563
239 Ga0265762_1001172 3300030760 Bacteria 4744
240 Ga0265762_1006453 3300030760 Bacteria 2098
241 Ga0265770_1061605 3300030878 Unclassified 699
242 Ga0265760_10000214 3300031090 Bacteria 15581
243 Ga0265330_10040413 3300031235 Bacteria 2071
244 Ga0265325_10292010 3300031241 Unclassified 729
245 Ga0265340_10049206 3300031247 Bacteria 2048
246 Ga0265314_10006225 3300031711 Bacteria 10597
247 Ga0373934_0162723 3300035086 Unclassified 915
248 Ga0373956_0118741 3300035119 Bacteria 1234
249 Ga0373943_0326201 3300035170 Bacteria 876
250 Ga0373933_0030706 3300035724 Bacteria 3112
251 Ga0373937_0203689 3300036401 Unclassified 1860
252 Ga0373937_0251359 3300036401 Bacteria 1667
253 Ga0373937_0382366 3300036401 Bacteria 1335
254 Ga0373937_0948502 3300036401 Unclassified 809
255 Ga0373925_0057445 3300037068 Bacteria 2916
256 Ga0373925_0292660 3300037068 Unclassified 1313
257 Ga0436363_0359536 3300039450 Unclassified 1069
258 Ga0436363_1504976 3300039450 Bacteria 1255
259 Ga0451577_0097060 3300042876 Bacteria 2632
260 Ga0453683_0019988 3300044673 Bacteria 4282
261 Ga0466963_0460664 3300044694 Bacteria 897
262 Ga0453684_0000429 3300044712 Bacteria 171513
263 Ga0453684_0189811 3300044712 Bacteria 2405
264 Ga0451576_0011790 3300045051 Bacteria 9900
265 Ga0451576_0243391 3300045051 Bacteria 1879
266 Ga0451576_0378118 3300045051 Bacteria 1484
267 Ga0451576_0661834 3300045051 Unclassified 1097
268 Ga0466967_0485284 3300045976 Bacteria 1211
269 Ga0495629_0008206 3300046459 Bacteria 7679
270 Ga0495580_0011463 3300046472 Bacteria 6859
271 Ga0495580_0074536 3300046472 Bacteria 2368
272 Ga0495582_0318429 3300046473 Unclassified 895
273 Ga0495642_0109372 3300046528 Bacteria 1181
274 Ga0495621_0104045 3300046539 Bacteria 1083
275 Ga0495657_0251973 3300046675 Unclassified 1063
276 Ga0495657_0269528 3300046675 Bacteria 1021
277 Ga0495684_0734183 3300047471 Unclassified 651
278 Ga0496100_0037155 3300048903 Bacteria 3077
279 Ga0496102_0202520 3300048905 Bacteria 1871
280 Ga0496104_0267212 3300048907 Bacteria 1623
281 Ga0496105_0042673 3300048908 Bacteria 3740
282 Ga0496106_0204828 3300048909 Unclassified 1571
283 Ga0496108_0000051 3300048911 Bacteria 131546
284 Ga0496109_0000105 3300048912 Bacteria 87116
285 Ga0496110_0005502 3300048913 Bacteria 9937
286 Ga0496111_0013479 3300048914 Bacteria 5565
287 Ga0496112_0000050 3300048915 Bacteria 83676
288 Ga0496112_0069774 3300048915 Bacteria 3471
289 Ga0496113_0000254 3300048916 Bacteria 25129
290 Ga0496115_0130883 3300048918 Bacteria 2068
291 Ga0496126_0003413 3300048929 Bacteria 20084
292 Ga0501083_0024832 3300049744 Bacteria 4151
293 nmdc:mga05p37_117344_c1 3300050507 Bacteria 3270
294 nmdc:mga05p37_36099_c1 3300050507 Bacteria 6064
295 Ga0265760_10002419
296 JGI24752J21851_1005072
297 JGI24747J21853_1006917
298 JGI24034J26672_10000666
299 JGI24751J29686_10001679
300 rootH1_10213659
301 Ga0065712_10097901
302 Ga0065707_10308970
303 Ga0070658_10187718
304 Ga0070676_10083261
305 Ga0070683_100005690
306 Ga0070690_100004767
307 Ga0070670_100017432
308 Ga0070677_10015741
309 Ga0068869_100000542
310 Ga0068868_100051123
311 Ga0068868_100342716
312 Ga0070660_100014554
313 Ga0070689_100136297
314 Ga0070661_100005140
315 Ga0070668_100011172
316 Ga0070669_100022993
317 Ga0070669_100286405
318 Ga0070675_100113890
319 Ga0070674_100277762
320 Ga0070673_100091614
321 Ga0070688_100000617
322 Ga0070659_100012421
323 Ga0070667_100250283
324 Ga0070713_100029774
325 Ga0070713_100085373
326 Ga0070708_100015481
327 Ga0070708_100076339
328 Ga0070708_100137789
329 Ga0070708_100327889
330 Ga0070708_100829467
331 Ga0070663_100009895
332 Ga0070678_100066855
333 Ga0070681_10617108
334 Ga0068867_100031069
335 Ga0068867_100471898
336 Ga0070685_10001498
337 Ga0070685_10151739
338 Ga0070706_100019937
339 Ga0070706_100050441
340 Ga0070706_101026528
341 Ga0070707_100011821
342 Ga0070707_100021640
343 Ga0070707_100112772
344 Ga0070707_100927425
345 Ga0070698_100149526
346 Ga0070699_100008909
347 Ga0070699_100361029
348 Ga0070684_100003517
349 Ga0070697_100012550
350 Ga0070697_100024609
351 Ga0070697_100057705
352 Ga0070697_100157232
353 Ga0070697_100202217
354 Ga0070672_100013959
355 Ga0070686_100009065
356 Ga0070665_100251742
357 Ga0070704_100244081
358 Ga0070704_100396748
359 Ga0070664_100015138
360 Ga0068857_100000556
361 Ga0068854_100450748
362 Ga0068856_100014945
363 Ga0070702_100086094
364 Ga0068859_100009906
365 Ga0068859_100165646
366 Ga0068866_10020785
367 Ga0068866_10037950
368 Ga0068866_10244670
369 Ga0068861_100205497
370 Ga0068861_101103703
371 Ga0068851_10007835
372 Ga0068870_10002556
373 Ga0068863_100013974
374 Ga0068863_100071852
375 Ga0068863_100179464
376 Ga0068863_100192841
377 Ga0068858_100004958
378 Ga0068858_100364424
379 Ga0068860_100042278
380 Ga0068860_100203454
381 Ga0081540_1214878
382 Ga0070717_10002152
383 Ga0070717_10040457
384 Ga0070717_10196404
385 Ga0070717_10206987
386 Ga0070716_100110451
387 Ga0070716_100320604
388 Ga0070712_100000309
389 Ga0070712_100023403
390 Ga0070712_100053020
391 Ga0097621_100409236
392 Ga0068871_100299906
393 Ga0075434_100000359
394 Ga0068865_100158656
395 Ga0075436_100240543
396 Ga0075436_100438255
397 Ga0097620_100009906
398 Ga0097620_100165630
399 Ga0075435_100002795
400 Ga0105240_10124351
401 Ga0105245_10187165
402 Ga0105245_10815065
403 Ga0105247_10003131
404 Ga0114129_10004652
405 Ga0114129_10171915
406 Ga0105241_10007141
407 Ga0105242_10046231
408 Ga0105248_10054588
409 Ga0105237_10083723
410 Ga0105238_10325544
411 Ga0105249_10014167
412 Ga0105239_10007481
413 Ga0105239_10063933
414 Ga0105239_11378114
415 Ga0105246_10013190
416 Ga0105246_10207530
417 Ga0157373_10047574
418 Ga0157374_10028468
419 Ga0157374_10073183
420 Ga0157378_10032626
421 Ga0163162_10000822
422 Ga0163162_10056082
423 Ga0157372_10055567
424 Ga0157372_10751083
425 Ga0157375_10025708
426 Ga0157375_10042807
427 Ga0157375_10471553
428 Ga0163163_10049872
429 Ga0163163_10602813
430 Ga0163163_11594621
431 Ga0157380_10056941
432 Ga0157380_10388107
433 Ga0182008_10043372
434 Ga0182008_10200655
435 Ga0157379_10237328
436 Ga0157379_10359984
437 Ga0157379_10636480
438 Ga0157376_10036127
439 Ga0157376_10083493
440 Ga0157376_10409658
441 Ga0182006_1037474
442 Ga0182007_10015624
443 Ga0224570_100665
444 Ga0224572_1007209
445 Ga0224572_1032460
446 Ga0228598_1000447
447 Ga0228598_1000914
448 Ga0207697_10005179
449 Ga0207656_10218663
450 Ga0207692_10011115
451 Ga0207642_10041565
452 Ga0207642_10244623
453 Ga0207710_10170539
454 Ga0207688_10002810
455 Ga0207647_10000813
456 Ga0207699_10011233
457 Ga0207699_10169592
458 Ga0207699_10329638
459 Ga0207699_10478559
460 Ga0207645_10002635
461 Ga0207643_10001249
462 Ga0207705_10705514
463 Ga0207684_10002015
464 Ga0207684_10033148
465 Ga0207684_10091863
466 Ga0207684_10839657
467 Ga0207654_10593672
468 Ga0207695_10474823
469 Ga0207671_10247572
470 Ga0207693_10006665
471 Ga0207693_10176137
472 Ga0207660_10212666
473 Ga0207657_10010924
474 Ga0207649_10001140
475 Ga0207652_11277416
476 Ga0207646_10001576
477 Ga0207646_10054478
478 Ga0207646_10055866
479 Ga0207646_10166264
480 Ga0207694_10776934
481 Ga0207650_10000150
482 Ga0207659_10069555
483 Ga0207687_10317052
484 Ga0207687_10552580
485 Ga0207700_10060232
486 Ga0207700_10096738
487 Ga0207700_10558563
488 Ga0207700_10646911
489 Ga0207664_10605642
490 Ga0207644_10072480
491 Ga0207690_10013253
492 Ga0207706_10004536
493 Ga0207670_10127305
494 Ga0207665_10013840
495 Ga0207665_10168233
496 Ga0207691_10005259
497 Ga0207691_10197568
498 Ga0207711_10236012
499 Ga0207689_10003567
500 Ga0207689_10009453
501 Ga0207661_10001443
502 Ga0207679_10001208
503 Ga0207667_10407409
504 Ga0207668_10092758
505 Ga0207640_10241793
506 Ga0207658_10301355
507 Ga0207658_10392427
508 Ga0207677_10021611
509 Ga0207677_10150798
510 Ga0207677_10700000
511 Ga0207703_10004444
512 Ga0207703_10172537
513 Ga0207703_10966973
514 Ga0207678_10005661
515 Ga0207702_10171169
516 Ga0207641_10000147
517 Ga0207641_10022531
518 Ga0207641_10136805
519 Ga0207648_10006258
520 Ga0207648_10107830
521 Ga0207676_10002739
522 Ga0207674_10000432
523 Ga0207675_100051008
524 Ga0207675_100151788
525 Ga0207683_10005098
526 Ga0207683_10590783
527 Ga0265356_1000415
528 Ga0265355_1005291
529 Ga0268266_10017397
530 Ga0268266_10461686
531 Ga0268264_10166736
532 Ga0268264_10279415
533 Ga0265762_1001172
534 Ga0265762_1006453
535 Ga0265770_1061605
536 Ga0265760_10000214
537 Ga0265330_10040413
538 Ga0265325_10292010
539 Ga0265340_10049206
540 Ga0265314_10006225
541 Ga0373934_0162723
542 Ga0373956_0118741
543 Ga0373943_0326201
544 Ga0373933_0030706
545 Ga0373937_0203689
546 Ga0373937_0251359
547 Ga0373937_0382366
548 Ga0373937_0948502
549 Ga0373925_0057445
550 Ga0373925_0292660
551 Ga0436363_0359536
552 Ga0436363_1504976
553 Ga0451577_0097060
554 Ga0453683_0019988
555 Ga0466963_0460664
556 Ga0453684_0000429
557 Ga0453684_0189811
558 Ga0451576_0011790
559 Ga0451576_0243391
560 Ga0451576_0378118
561 Ga0451576_0661834
562 Ga0466967_0485284
563 Ga0495629_0008206
564 Ga0495580_0011463
565 Ga0495580_0074536
566 Ga0495582_0318429
567 Ga0495642_0109372
568 Ga0495621_0104045
569 Ga0495657_0251973
570 Ga0495657_0269528
571 Ga0495684_0734183
572 Ga0496100_0037155
573 Ga0496102_0202520
574 Ga0496104_0267212
575 Ga0496105_0042673
576 Ga0496106_0204828
577 Ga0496108_0000051
578 Ga0496109_0000105
579 Ga0496110_0005502
580 Ga0496111_0013479
581 Ga0496112_0000050
582 Ga0496112_0069774
583 Ga0496113_0000254
584 Ga0496115_0130883
585 Ga0496126_0003413
586 Ga0501083_0024832
587 nmdc:mga05p37_117344_c1
588 nmdc:mga05p37_36099_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

30

215

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.9245 1 187
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9179 1 188
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.915 1 187
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.9094 1 187
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.9085 1 184
ID Description Score Start End Superfamily
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9304 25 188 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9191 25 188 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9191 44 115 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9125 1 187 3.40.50.150
1ws6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8991 1 184 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6I6D9C2-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase (EC 2.1.1.171) 0.9629 1 190 GO:0003676
GO:0052913
AF-A0A6I6D9C2-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase (EC 2.1.1.171) 0.9579 1 190 GO:0003676
GO:0052913
AF-A0A3D0YYR9-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9573 2 191 GO:0003676
GO:0008168
GO:0031167
AF-X1M4L8-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9572 1 187 GO:0008168
GO:0031167
AF-A0A2J0KU01-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9557 1 190 GO:0008168
GO:0031167

Map