F392055

General Info

Members Datasets Scaffolds Average Seq Length
294 176 281 588

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10045403|Ga0105242_100454034
Length 640
Sequence LVPSGFPQSTQALSHDFTELNFQFGRASVQNLVDARRTRPLPEPQNALQLRLHPSRTAMPIYRAPIDEYKFVLNELLEIDRHRDLPDFGELTPELLDDILTNAGRFCEEVLQPINQSGDEEGAHFENGVVRTPKGFKEAYKAYCEAGWGALSAPAKFGGAGLPMLVTMAVAEMPWMKEHVLPKMINGEWAGTMCLTEPGCGTDLRLMKTRAVEQADGTYKLTGTKIFISGGDQDLTDNIVHMVIAKIPDADGRIHDDLSTVNFFMVPKFLVSEDGAMGARNGVATGGIEKKMGIKAQATCVLNFDEATAWRLGPKPVAPKPGEKRSASAGMAXXXXMMNNARLGVGVQGISIGEVAYQNGMAYAHERRVGHALTGPKEPDKPADLEFVHPDVRRMLLHCKSFVEGARAVAMWTTLNMAVAETDKPEAANAQLLADLMTPVIKAFFTDMGFEAANLAMQCYGGHGYIRDNGVEQFVRDGRINQTYEGANGVQAMDLVGRKLGRKGGAAPMALFGLLGGWVGENEADAAMAAFVKPVKRGLDTLQQATLWLAQNGLANPDNAGAGAVDYLRLMGIVVTGWMWARMAKVAQARLAAGASNKAFYEQKLVAARYWMERMIPECPMLLERIQAGSGTIMAFEQVG

Samples

Sample ID Description Type Environment
1 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
2 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
3 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
4 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
5 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
6 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
7 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
8 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
9 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
10 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
119 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
120 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
121 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
127 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
170 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
175 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
176 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0
Isolates 4.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 1.02
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25153J46596_10001429 3300003215 Bacteria 14280
3 Ga0070658_10003778 3300005327 Bacteria 12401
4 Ga0070676_10018410 3300005328 Bacteria 3871
5 Ga0070666_10010381 3300005335 Bacteria 5824
6 Ga0070680_100000037 3300005336 Bacteria 66957
7 Ga0070680_100020849 3300005336 Bacteria 5203
8 Ga0070680_100038502 3300005336 Bacteria 3867
9 Ga0070680_100040691 3300005336 Bacteria 3765
10 Ga0068868_100099991 3300005338 Bacteria 2346
11 Ga0070691_10000168 3300005341 Bacteria 21401
12 Ga0070661_100001403 3300005344 Bacteria 16824
13 Ga0070675_100000968 3300005354 Bacteria 20525
14 Ga0070673_100036243 3300005364 Bacteria 3747
15 Ga0070659_100095264 3300005366 Bacteria 2391
16 Ga0070713_100000003 3300005436 Bacteria 245840
17 Ga0070711_100012970 3300005439 Bacteria 5224
18 Ga0070681_10000001 3300005458 Bacteria 946857
19 Ga0068867_100002178 3300005459 Bacteria 13755
20 Ga0070679_100000037 3300005530 Bacteria 100971
21 Ga0068853_100031802 3300005539 Bacteria 4466
22 Ga0070665_100025439 3300005548 Bacteria 5964
23 Ga0070665_100035283 3300005548 Bacteria 5028
24 Ga0070665_100157077 3300005548 Bacteria 2276
25 Ga0068855_100000010 3300005563 Bacteria 246022
26 Ga0068855_100032251 3300005563 Bacteria 6255
27 Ga0068855_100170978 3300005563 Bacteria 2461
28 Ga0068857_100000050 3300005577 Bacteria 65116
29 Ga0068857_100048259 3300005577 Bacteria 3780
30 Ga0068856_100000075 3300005614 Bacteria 94156
31 Ga0068852_100017425 3300005616 Bacteria 5636
32 Ga0068859_100050050 3300005617 Bacteria 4197
33 Ga0068858_100029508 3300005842 Bacteria 5093
34 Ga0070712_100000027 3300006175 Bacteria 77007
35 Ga0070712_100000104 3300006175 Bacteria 43217
36 Ga0070712_100000580 3300006175 Bacteria 21326
37 Ga0097621_100000188 3300006237 Bacteria 39517
38 Ga0097621_100062741 3300006237 Bacteria 3052
39 Ga0068871_100000033 3300006358 Bacteria 72594
40 Ga0075428_100001519 3300006844 Bacteria 24799
41 Ga0068865_100057161 3300006881 Bacteria 2721
42 Ga0075436_100000038 3300006914 Bacteria 82918
43 Ga0097620_100050051 3300006931 Bacteria 4197
44 Ga0105240_10000085 3300009093 Bacteria 189341
45 Ga0105240_10011739 3300009093 Bacteria 12169
46 Ga0105240_10103529 3300009093 Bacteria 3458
47 Ga0105240_10134165 3300009093 Bacteria 2966
48 Ga0105240_10153078 3300009093 Bacteria 2745
49 Ga0111539_10005783 3300009094 Bacteria 15983
50 Ga0111539_10065326 3300009094 Bacteria 4300
51 Ga0105245_10017100 3300009098 Bacteria 6329
52 Ga0105243_10000045 3300009148 Bacteria 156620
53 Ga0105243_10004166 3300009148 Bacteria 11469
54 Ga0105241_10009536 3300009174 Bacteria 7131
55 Ga0105241_10029176 3300009174 Bacteria 4114
56 Ga0105242_10008981 3300009176 Bacteria 7674
57 Ga0105242_10045403 3300009176 Bacteria 3561
58 Ga0105248_10000001 3300009177 Bacteria 1881304
59 Ga0105248_10055683 3300009177 Bacteria 4437
60 Ga0105238_10001813 3300009551 Bacteria 21414
61 Ga0105238_10018858 3300009551 Bacteria 7023
62 Ga0105238_10046082 3300009551 Bacteria 4402
63 Ga0105239_10007077 3300010375 Bacteria 12917
64 Ga0105239_10052316 3300010375 Bacteria 4478
65 Ga0105239_10108224 3300010375 Bacteria 3080
66 Ga0105239_10165030 3300010375 Bacteria 2476
67 Ga0157373_10002326 3300013100 Bacteria 14410
68 Ga0157370_10000085 3300013104 Bacteria 103847
69 Ga0157370_10002310 3300013104 Bacteria 23075
70 Ga0157370_10030809 3300013104 Bacteria 5254
71 Ga0157370_10070848 3300013104 Bacteria 3290
72 Ga0157369_10012946 3300013105 Bacteria 9451
73 Ga0157369_10032682 3300013105 Bacteria 5719
74 Ga0157374_10165667 3300013296 Bacteria 2154
75 Ga0157378_10060071 3300013297 Bacteria 3392
76 Ga0157372_10076603 3300013307 Bacteria 3776
77 Ga0157375_10040154 3300013308 Bacteria 4509
78 Ga0163163_10010081 3300014325 Bacteria 8476
79 Ga0157380_10000345 3300014326 Bacteria 27857
80 Ga0157379_10000359 3300014968 Bacteria 36602
81 Ga0157379_10003422 3300014968 Bacteria 13421
82 Ga0157379_10036349 3300014968 Bacteria 4393
83 Ga0213874_10004558 3300021377 Bacteria 3178
84 Ga0213876_10000431 3300021384 Bacteria 34586
85 Ga0209233_1000013 3300025261 Bacteria 1013785
86 Ga0209758_1000036 3300025297 Bacteria 441671
87 Ga0207682_10031647 3300025893 Bacteria 2124
88 Ga0207699_10000178 3300025906 Bacteria 38460
89 Ga0207645_10009669 3300025907 Bacteria 6661
90 Ga0207705_10000608 3300025909 Bacteria 30010
91 Ga0207707_10000001 3300025912 Bacteria 1212482
92 Ga0207695_10000003 3300025913 Bacteria 1368691
93 Ga0207695_10033061 3300025913 Bacteria 5650
94 Ga0207695_10034333 3300025913 Bacteria 5518
95 Ga0207695_10044258 3300025913 Bacteria 4736
96 Ga0207695_10086680 3300025913 Bacteria 3157
97 Ga0207671_10008489 3300025914 Bacteria 8706
98 Ga0207693_10000299 3300025915 Bacteria 46202
99 Ga0207693_10001409 3300025915 Bacteria 21327
100 Ga0207693_10002579 3300025915 Bacteria 15744
101 Ga0207660_10000029 3300025917 Bacteria 67115
102 Ga0207660_10051997 3300025917 Bacteria 2915
103 Ga0207657_10000932 3300025919 Bacteria 30955
104 Ga0207657_10049793 3300025919 Bacteria 3648
105 Ga0207649_10000073 3300025920 Bacteria 86636
106 Ga0207652_10000201 3300025921 Bacteria 63129
107 Ga0207694_10000011 3300025924 Bacteria 417640
108 Ga0207694_10024870 3300025924 Bacteria 4548
109 Ga0207700_10000010 3300025928 Bacteria 298473
110 Ga0207664_10039061 3300025929 Bacteria 3683
111 Ga0207686_10005032 3300025934 Bacteria 7114
112 Ga0207709_10000011 3300025935 Bacteria 552881
113 Ga0207709_10004197 3300025935 Bacteria 8360
114 Ga0207711_10000002 3300025941 Bacteria 1228676
115 Ga0207689_10002868 3300025942 Bacteria 15899
116 Ga0207667_10000050 3300025949 Bacteria 234390
117 Ga0207667_10028357 3300025949 Bacteria 6081
118 Ga0207667_10066429 3300025949 Bacteria 3759
119 Ga0207651_10003208 3300025960 Bacteria 7995
120 Ga0207703_10064800 3300026035 Bacteria 3001
121 Ga0207639_10008142 3300026041 Bacteria 7167
122 Ga0207639_10010517 3300026041 Bacteria 6409
123 Ga0207702_10000013 3300026078 Bacteria 257468
124 Ga0207702_10000911 3300026078 Bacteria 30601
125 Ga0207702_10080205 3300026078 Bacteria 2831
126 Ga0207648_10004296 3300026089 Bacteria 14686
127 Ga0207648_10067535 3300026089 Bacteria 3117
128 Ga0207674_10000026 3300026116 Bacteria 151359
129 Ga0209971_1007310 3300027682 Bacteria 2620
130 Ga0207428_10090217 3300027907 Bacteria 2381
131 Ga0268266_10006035 3300028379 Bacteria 11168
132 Ga0268266_10012212 3300028379 Bacteria 7430
133 Ga0265318_10000018 3300028577 Bacteria 173038
134 Ga0265338_10000014 3300028800 Bacteria 378751
135 Ga0265338_10005577 3300028800 Bacteria 16371
136 Ga0265338_10006000 3300028800 Bacteria 15611
137 Ga0265338_10018675 3300028800 Bacteria 7409
138 Ga0265338_10027004 3300028800 Bacteria 5773
139 Ga0265338_10050338 3300028800 Bacteria 3767
140 Ga0265338_10051011 3300028800 Bacteria 3732
141 Ga0265330_10006710 3300031235 Bacteria 5677
142 Ga0265330_10012329 3300031235 Bacteria 4000
143 Ga0265320_10001046 3300031240 Bacteria 20535
144 Ga0265325_10000001 3300031241 Bacteria 726814
145 Ga0265325_10001041 3300031241 Bacteria 20001
146 Ga0265325_10003902 3300031241 Bacteria 9559
147 Ga0265340_10000021 3300031247 Bacteria 87640
148 Ga0265340_10004314 3300031247 Bacteria 7967
149 Ga0265340_10014337 3300031247 Bacteria 4144
150 Ga0265339_10000135 3300031249 Bacteria 60639
151 Ga0265339_10007591 3300031249 Bacteria 6989
152 Ga0265331_10000006 3300031250 Bacteria 418907
153 Ga0265331_10000419 3300031250 Bacteria 43019
154 Ga0265331_10016528 3300031250 Bacteria 3871
155 Ga0265331_10019348 3300031250 Bacteria 3516
156 Ga0265327_10000074 3300031251 Bacteria 214435
157 Ga0307408_100000002 3300031548 Bacteria 827227
158 Ga0265313_10001220 3300031595 Bacteria 24535
159 Ga0265313_10001807 3300031595 Bacteria 19567
160 Ga0265313_10004653 3300031595 Bacteria 10379
161 Ga0265313_10008142 3300031595 Bacteria 7011
162 Ga0265314_10000160 3300031711 Bacteria 102289
163 Ga0265314_10007512 3300031711 Bacteria 9446
164 Ga0265314_10010809 3300031711 Bacteria 7590
165 Ga0265314_10013244 3300031711 Bacteria 6675
166 Ga0265314_10026102 3300031711 Bacteria 4396
167 Ga0265342_10008575 3300031712 Bacteria 7309
168 Ga0265342_10033752 3300031712 Bacteria 3143
169 Ga0307516_10012757 3300031730 Bacteria 9032
170 Ga0307405_10001828 3300031731 Bacteria 9125
171 Ga0307410_10032774 3300031852 Bacteria 3348
172 Ga0307416_100004226 3300032002 Bacteria 8620
173 Ga0307416_100063951 3300032002 Bacteria 3016
174 Ga0307414_10036623 3300032004 Bacteria 3278
175 Ga0373943_0008886 3300035170 Bacteria 4501
176 Ga0373943_0052854 3300035170 Bacteria 2004
177 Ga0373947_0119821 3300035725 Bacteria 1670
178 Ga0373937_0001935 3300036401 Bacteria 17332
179 Ga0373925_0047398 3300037068 Bacteria 3199
180 Ga0373925_0188168 3300037068 Bacteria 1637
181 Ga0395905_0000954 3300037471 Bacteria 37082
182 Ga0400484_00479 3300038725 Bacteria 13492
183 Ga0400484_01082 3300038725 Bacteria 5267
184 Ga0400490_45281 3300038726 Bacteria 70798
185 Ga0400490_49064 3300038726 Bacteria 21698
186 Ga0400490_50015 3300038726 Bacteria 29938
187 Ga0400483_035512 3300039062 Bacteria 15856
188 Ga0400483_158655 3300039062 Bacteria 3904
189 Ga0400483_174128 3300039062 Bacteria 30099
190 Ga0400483_256790 3300039062 Bacteria 9181
191 Ga0400487_00423 3300039110 Bacteria 16204
192 Ga0400487_10280 3300039110 Bacteria 138613
193 Ga0400487_12681 3300039110 Bacteria 2543
194 Ga0436365_0131305 3300039437 Bacteria 51128
195 Ga0436363_0549664 3300039450 Bacteria 3348
196 Ga0439437_000486 3300042000 Bacteria 3916
197 Ga0439455_0002085 3300042012 Bacteria 3559
198 Ga0450911_000005 3300042115 Bacteria 233469
199 Ga0450904_000120 3300042139 Bacteria 17308
200 Ga0439446_0000010 3300042156 Bacteria 44145
201 Ga0439446_0001736 3300042156 Bacteria 5066
202 Ga0450918_004941 3300042531 Bacteria 2406
203 Ga0495580_0015730 3300046472 Bacteria 5701
204 Ga0495606_0000501 3300046507 Bacteria 63726
205 Ga0495654_0028072 3300046530 Bacteria 2880
206 Ga0495622_0008195 3300046557 Bacteria 4842
207 Ga0495658_0009668 3300046683 Bacteria 4808
208 Ga0495649_0002831 3300046694 Bacteria 12039
209 Ga0495681_0000009 3300047470 Bacteria 205224
210 Ga0496121_0002235 3300048924 Bacteria 30187
211 Ga0496126_0000859 3300048929 Bacteria 53488
212 Ga0495682_0001843 3300049460 Bacteria 10638
213 Ga0501031_0005344 3300049568 Bacteria 8363
214 Ga0501032_0002310 3300049569 Bacteria 14963
215 Ga0501032_0096798 3300049569 Bacteria 1956
216 Ga0501033_0004673 3300049570 Bacteria 10959
217 Ga0501033_0020891 3300049570 Bacteria 4942
218 Ga0501033_0030250 3300049570 Bacteria 4069
219 Ga0501034_0010630 3300049571 Bacteria 9574
220 Ga0501036_0003802 3300049572 Bacteria 12106
221 Ga0501036_0004939 3300049572 Bacteria 10778
222 Ga0501036_0039644 3300049572 Bacteria 3986
223 Ga0501036_0054354 3300049572 Bacteria 3392
224 Ga0501036_0091560 3300049572 Bacteria 2569
225 Ga0501037_0004362 3300049573 Bacteria 10269
226 Ga0501038_0002236 3300049574 Bacteria 17988
227 Ga0501038_0010172 3300049574 Bacteria 8611
228 Ga0501038_0027253 3300049574 Bacteria 5086
229 Ga0501039_0002160 3300049575 Bacteria 14533
230 Ga0501041_0001670 3300049577 Bacteria 12422
231 Ga0501042_0004376 3300049578 Bacteria 9006
232 Ga0501042_0019064 3300049578 Bacteria 4761
233 Ga0501043_0034117 3300049579 Bacteria 4003
234 Ga0501046_0002239 3300049580 Bacteria 18250
235 Ga0501046_0008626 3300049580 Bacteria 8866
236 Ga0501046_0108209 3300049580 Bacteria 2126
237 Ga0501047_0012776 3300049581 Bacteria 7956
238 Ga0501047_0016602 3300049581 Bacteria 7028
239 Ga0501047_0036370 3300049581 Bacteria 4758
240 Ga0501047_0052828 3300049581 Bacteria 3928
241 Ga0501048_0003443 3300049582 Bacteria 12024
242 Ga0501048_0007588 3300049582 Bacteria 8224
243 Ga0501067_0001129 3300049583 Bacteria 14457
244 Ga0501067_0006319 3300049583 Bacteria 6570
245 Ga0501067_0006932 3300049583 Bacteria 6287
246 Ga0501069_0000595 3300049585 Bacteria 16710
247 Ga0501070_0000157 3300049586 Bacteria 62720
248 Ga0501070_0011667 3300049586 Bacteria 7419
249 Ga0501071_0000363 3300049587 Bacteria 22256
250 Ga0501072_0005828 3300049588 Bacteria 9386
251 Ga0501073_0007084 3300049589 Bacteria 8351
252 Ga0501073_0016547 3300049589 Bacteria 5345
253 Ga0501073_0087738 3300049589 Bacteria 2163
254 Ga0501074_0000515 3300049590 Bacteria 23745
255 Ga0501080_0000976 3300049742 Bacteria 23417
256 Ga0501080_0002643 3300049742 Bacteria 15670
257 Ga0501080_0006942 3300049742 Bacteria 10211
258 Ga0501080_0025977 3300049742 Bacteria 5441
259 Ga0501081_0006046 3300049743 Bacteria 7839
260 Ga0501081_0010798 3300049743 Bacteria 5965
261 Ga0501035_0004855 3300049822 Bacteria 12748
262 Ga0501035_0011902 3300049822 Bacteria 8051
263 Ga0501035_0011916 3300049822 Bacteria 8047
264 Ga0501035_0021827 3300049822 Bacteria 5883
265 Ga0501035_0027041 3300049822 Bacteria 5246
266 Ga0501044_0001417 3300049823 Bacteria 28145
267 Ga0501044_0002973 3300049823 Bacteria 19239
268 Ga0501044_0004900 3300049823 Bacteria 14962
269 Ga0501044_0023295 3300049823 Bacteria 6587
270 Ga0501226_000010 3300049853 Bacteria 180094
271 nmdc:mga08y16_36816_c1 3300050511 Bacteria 5139
272 nmdc:mga0rr50_10726_c1 3300050513 Bacteria 5835
273 nmdc:mga08x19_95_c1 3300050514 Bacteria 78182
274 Ga0500643_000014 3300053087 Bacteria 318249
275 Ga0500655_002534 3300053133 Bacteria 3319
276 Ga0500573_0000003 3300053140 Bacteria 355643
277 Ga0501084_0000405 3300054114 Bacteria 33289
278 Ga0501084_0000852 3300054114 Bacteria 23563
279 Ga0501084_0034657 3300054114 Bacteria 4220
280 Ga0501082_0007060 3300060353 Bacteria 9695
281 Ga0501082_0077955 3300060353 Bacteria 2858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0119821 Ga0373947_0119821_26_1504 465
2 3300035170 Ga0373943_0008886 Ga0373943_0008886_14_1498 466
3 3300049569 Ga0501032_0096798 Ga0501032_0096798_419_1930 468
4 3300037068 Ga0373925_0188168 Ga0373925_0188168_67_1611 488
5 3300049572 Ga0501036_0091560 Ga0501036_0091560_682_2265 513
6 3300005539 Ga0068853_100031802 Ga0068853_1000318024 544
7 3300005616 Ga0068852_100017425 Ga0068852_1000174255 544
8 3300009177 Ga0105248_10000001 Ga0105248_10000001379 544
9 3300025941 Ga0207711_10000002 Ga0207711_100000021080 544
10 3300026041 Ga0207639_10008142 Ga0207639_100081424 544
11 3300026041 Ga0207639_10010517 Ga0207639_100105174 544
12 3300028800 Ga0265338_10000014 Ga0265338_10000014258 544
13 3300031241 Ga0265325_10000001 Ga0265325_1000000129 544
14 3300031249 Ga0265339_10000135 Ga0265339_1000013516 544
15 3300031250 Ga0265331_10019348 Ga0265331_100193483 544
16 3300031595 Ga0265313_10001807 Ga0265313_100018076 544
17 3300031711 Ga0265314_10026102 Ga0265314_100261023 544
18 3300031712 Ga0265342_10033752 Ga0265342_100337522 544
19 3300049742 Ga0501080_0000976 Ga0501080_0000976_1435_3270 544
20 3300005563 Ga0068855_100000010 Ga0068855_100000010181 545
21 3300009093 Ga0105240_10000085 Ga0105240_1000008512 545
22 3300013105 Ga0157369_10032682 Ga0157369_100326822 545
23 3300025913 Ga0207695_10000003 Ga0207695_10000003559 545
24 3300025949 Ga0207667_10000050 Ga0207667_1000005026 545
25 3300031730 Ga0307516_10012757 Ga0307516_100127574 545
26 3300049460 Ga0495682_0001843 Ga0495682_0001843_5770_7599 545
27 3300053133 Ga0500655_002534 Ga0500655_002534_52_1881 545
28 3300054114 Ga0501084_0034657 Ga0501084_0034657_1219_3048 545
29 3300049581 Ga0501047_0016602 Ga0501047_0016602_177_2006 546
30 3300049583 Ga0501067_0001129 Ga0501067_0001129_11740_13569 546
31 3300049588 Ga0501072_0005828 Ga0501072_0005828_6010_7839 546
32 3300049589 Ga0501073_0087738 Ga0501073_0087738_309_2138 546
33 3300005336 Ga0070680_100000037 Ga0070680_10000003745 550
34 3300005458 Ga0070681_10000001 Ga0070681_10000001746 550
35 3300005530 Ga0070679_100000037 Ga0070679_10000003715 550
36 3300010375 Ga0105239_10007077 Ga0105239_1000707711 550
37 3300025912 Ga0207707_10000001 Ga0207707_10000001428 550
38 3300025917 Ga0207660_10000029 Ga0207660_1000002953 550
39 3300025921 Ga0207652_10000201 Ga0207652_1000020156 550
40 3300009176 Ga0105242_10045403 Ga0105242_100454034 553
41 3300021384 Ga0213876_10000431 Ga0213876_1000043130 554
42 3300039437 Ga0436365_0131305 Ga0436365_0131305_24581_26410 554
43 3300025929 Ga0207664_10039061 Ga0207664_100390613 555
44 3300014326 Ga0157380_10000345 Ga0157380_1000034520 556
45 3300049572 Ga0501036_0003802 Ga0501036_0003802_3082_4866 556
46 3300049577 Ga0501041_0001670 Ga0501041_0001670_6554_8338 556
47 3300049578 Ga0501042_0019064 Ga0501042_0019064_1050_2834 556
48 3300049582 Ga0501048_0003443 Ga0501048_0003443_467_2251 556
49 3300049587 Ga0501071_0000363 Ga0501071_0000363_7696_9480 556
50 3300032002 Ga0307416_100063951 Ga0307416_1000639512 558
51 3300021377 Ga0213874_10004558 Ga0213874_100045582 559
52 3300027682 Ga0209971_1007310 Ga0209971_10073102 559
53 3300031731 Ga0307405_10001828 Ga0307405_100018285 559
54 3300031852 Ga0307410_10032774 Ga0307410_100327742 559
55 3300032002 Ga0307416_100004226 Ga0307416_1000042262 559
56 3300039450 Ga0436363_0549664 Ga0436363_0549664_659_2491 559
57 3300042156 Ga0439446_0001736 Ga0439446_0001736_1364_3154 559
58 3300054114 Ga0501084_0000405 Ga0501084_0000405_25196_27022 559
59 3300060353 Ga0501082_0077955 Ga0501082_0077955_200_2026 559
60 3300042531 Ga0450918_004941 Ga0450918_004941_105_1895 560
61 3300049743 Ga0501081_0006046 Ga0501081_0006046_438_2222 560
62 3300049743 Ga0501081_0010798 Ga0501081_0010798_388_2178 560
63 3300009148 Ga0105243_10000045 Ga0105243_1000004528 561
64 3300025935 Ga0207709_10000011 Ga0207709_10000011361 561
65 3300047470 Ga0495681_0000009 Ga0495681_0000009_99589_101361 561
66 3300028577 Ga0265318_10000018 Ga0265318_10000018156 563
67 3300009551 Ga0105238_10046082 Ga0105238_100460822 565
68 3300025924 Ga0207694_10000011 Ga0207694_10000011208 565
69 3300026089 Ga0207648_10067535 Ga0207648_100675352 565
70 3300037471 Ga0395905_0000954 Ga0395905_0000954_23520_25295 566
71 iso_pu_bacteria 2600254954 2600444051 567
72 iso_pu_bacteria 2600255389 2602008464 567
73 iso_pu_bacteria 2728369097 2729148507 567
74 iso_pu_bacteria 2808606373 2808906964 567
75 iso_pu_bacteria 2811994881 2812370019 567
76 iso_pu_bacteria 2823421272 2823425680 567
77 iso_pu_bacteria 2919501602 2919502423 567
78 iso_pu_bacteria 2923519811 2923524105 567
79 iso_pu_bacteria 2926063275 2926064096 567
80 iso_pu_bacteria 640427133 640486267 567
81 iso_pu_bacteria 651053060 651174233 567
82 iso_pu_bacteria 8034962539 8034963620 567
83 iso_pu_bacteria 2828305725 2828307489 569
84 3300005354 Ga0070675_100000968 Ga0070675_10000096810 570
85 3300005617 Ga0068859_100050050 Ga0068859_1000500503 570
86 3300006844 Ga0075428_100001519 Ga0075428_10000151915 570
87 3300006931 Ga0097620_100050051 Ga0097620_1000500513 570
88 3300009094 Ga0111539_10005783 Ga0111539_1000578314 570
89 3300009094 Ga0111539_10065326 Ga0111539_100653264 570
90 3300027907 Ga0207428_10090217 Ga0207428_100902172 570
91 3300049583 Ga0501067_0006319 Ga0501067_0006319_1351_3141 570
92 3300049589 Ga0501073_0016547 Ga0501073_0016547_2810_4600 570
93 3300049742 Ga0501080_0002643 Ga0501080_0002643_11052_12842 570
94 3300050511 nmdc:mga08y16_36816_c1 nmdc:mga08y16_36816_c1_3188_4978 570
95 3300013104 Ga0157370_10000085 Ga0157370_1000008533 571
96 3300031548 Ga0307408_100000002 Ga0307408_100000002365 571
97 3300032004 Ga0307414_10036623 Ga0307414_100366232 571
98 3300042000 Ga0439437_000486 Ga0439437_000486_1602_3392 571
99 3300042012 Ga0439455_0002085 Ga0439455_0002085_163_1953 571
100 3300042115 Ga0450911_000005 Ga0450911_000005_198047_199837 571
101 3300042139 Ga0450904_000120 Ga0450904_000120_2160_3950 571
102 3300042156 Ga0439446_0000010 Ga0439446_0000010_26813_28603 571
103 3300046507 Ga0495606_0000501 Ga0495606_0000501_57194_58984 571
104 3300046694 Ga0495649_0002831 Ga0495649_0002831_4737_6527 571
105 3300049853 Ga0501226_000010 Ga0501226_000010_146589_148379 571
106 3300009093 Ga0105240_10153078 Ga0105240_101530783 573
107 3300025913 Ga0207695_10034333 Ga0207695_100343333 573
108 3300028800 Ga0265338_10027004 Ga0265338_100270045 573
109 3300038725 Ga0400484_00479 Ga0400484_00479_10098_11882 573
110 3300038725 Ga0400484_01082 Ga0400484_01082_71_1855 573
111 3300038726 Ga0400490_45281 Ga0400490_45281_4862_6646 573
112 3300038726 Ga0400490_49064 Ga0400490_49064_11701_13485 573
113 3300038726 Ga0400490_50015 Ga0400490_50015_24_1808 573
114 3300039062 Ga0400483_035512 Ga0400483_035512_7817_9601 573
115 3300039062 Ga0400483_158655 Ga0400483_158655_1621_3405 573
116 3300039062 Ga0400483_174128 Ga0400483_174128_5342_7126 573
117 3300039062 Ga0400483_256790 Ga0400483_256790_19_1803 573
118 3300039110 Ga0400487_00423 Ga0400487_00423_10527_12311 573
119 3300039110 Ga0400487_10280 Ga0400487_10280_10288_12072 573
120 3300039110 Ga0400487_12681 Ga0400487_12681_573_2357 573
121 3300006175 Ga0070712_100000580 Ga0070712_10000058010 576
122 3300025915 Ga0207693_10001409 Ga0207693_1000140914 576
123 3300031235 Ga0265330_10012329 Ga0265330_100123291 576
124 3300031247 Ga0265340_10000021 Ga0265340_1000002168 576
125 3300031712 Ga0265342_10008575 Ga0265342_100085754 576
126 3300005344 Ga0070661_100001403 Ga0070661_10000140312 577
127 3300025920 Ga0207649_10000073 Ga0207649_1000007372 577
128 3300031250 Ga0265331_10000006 Ga0265331_10000006150 577
129 3300031250 Ga0265331_10000419 Ga0265331_1000041911 577
130 3300031251 Ga0265327_10000074 Ga0265327_1000007482 577
131 3300031711 Ga0265314_10007512 Ga0265314_100075125 577
132 3300049572 Ga0501036_0039644 Ga0501036_0039644_945_2783 577
133 3300049574 Ga0501038_0010172 Ga0501038_0010172_6226_8064 577
134 3300049579 Ga0501043_0034117 Ga0501043_0034117_1682_3520 577
135 3300049580 Ga0501046_0108209 Ga0501046_0108209_125_1966 577
136 3300049581 Ga0501047_0052828 Ga0501047_0052828_1594_3432 577
137 3300049742 Ga0501080_0025977 Ga0501080_0025977_2846_4684 577
138 3300049822 Ga0501035_0021827 Ga0501035_0021827_3640_5478 577
139 3300049823 Ga0501044_0004900 Ga0501044_0004900_2497_4335 577
140 3300005328 Ga0070676_10018410 Ga0070676_100184104 579
141 3300005364 Ga0070673_100036243 Ga0070673_1000362431 579
142 3300005459 Ga0068867_100002178 Ga0068867_1000021786 579
143 3300005563 Ga0068855_100170978 Ga0068855_1001709782 579
144 3300006237 Ga0097621_100062741 Ga0097621_1000627412 579
145 3300009098 Ga0105245_10017100 Ga0105245_100171001 579
146 3300009148 Ga0105243_10004166 Ga0105243_100041668 579
147 3300009176 Ga0105242_10008981 Ga0105242_100089814 579
148 3300010375 Ga0105239_10165030 Ga0105239_101650302 579
149 3300013297 Ga0157378_10060071 Ga0157378_100600714 579
150 3300025907 Ga0207645_10009669 Ga0207645_100096692 579
151 3300025909 Ga0207705_10000608 Ga0207705_100006082 579
152 3300025919 Ga0207657_10000932 Ga0207657_1000093216 579
153 3300025934 Ga0207686_10005032 Ga0207686_100050324 579
154 3300025935 Ga0207709_10004197 Ga0207709_100041976 579
155 3300025942 Ga0207689_10002868 Ga0207689_100028683 579
156 3300025960 Ga0207651_10003208 Ga0207651_100032085 579
157 3300026089 Ga0207648_10004296 Ga0207648_100042964 579
158 3300031241 Ga0265325_10003902 Ga0265325_100039023 579
159 3300031711 Ga0265314_10000160 Ga0265314_1000016046 579
160 3300053140 Ga0500573_0000003 Ga0500573_0000003_300037_301839 579
161 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013113 580
162 3300003215 JGI25153J46596_10001429 JGI25153J46596_1000142917 580
163 3300005327 Ga0070658_10003778 Ga0070658_100037781 580
164 3300005335 Ga0070666_10010381 Ga0070666_100103811 580
165 3300005336 Ga0070680_100020849 Ga0070680_1000208496 580
166 3300005336 Ga0070680_100038502 Ga0070680_1000385024 580
167 3300005336 Ga0070680_100040691 Ga0070680_1000406913 580
168 3300005338 Ga0068868_100099991 Ga0068868_1000999912 580
169 3300005341 Ga0070691_10000168 Ga0070691_1000016814 580
170 3300005366 Ga0070659_100095264 Ga0070659_1000952642 580
171 3300005436 Ga0070713_100000003 Ga0070713_10000000394 580
172 3300005439 Ga0070711_100012970 Ga0070711_1000129702 580
173 3300005548 Ga0070665_100025439 Ga0070665_1000254393 580
174 3300005548 Ga0070665_100035283 Ga0070665_1000352835 580
175 3300005548 Ga0070665_100157077 Ga0070665_1001570772 580
176 3300005563 Ga0068855_100032251 Ga0068855_1000322514 580
177 3300005577 Ga0068857_100000050 Ga0068857_10000005014 580
178 3300005577 Ga0068857_100048259 Ga0068857_1000482592 580
179 3300005614 Ga0068856_100000075 Ga0068856_10000007550 580
180 3300005842 Ga0068858_100029508 Ga0068858_1000295083 580
181 3300006175 Ga0070712_100000027 Ga0070712_10000002726 580
182 3300006175 Ga0070712_100000104 Ga0070712_10000010444 580
183 3300006237 Ga0097621_100000188 Ga0097621_10000018827 580
184 3300006358 Ga0068871_100000033 Ga0068871_10000003340 580
185 3300006881 Ga0068865_100057161 Ga0068865_1000571611 580
186 3300006914 Ga0075436_100000038 Ga0075436_10000003821 580
187 3300009093 Ga0105240_10011739 Ga0105240_100117395 580
188 3300009093 Ga0105240_10103529 Ga0105240_101035292 580
189 3300009093 Ga0105240_10134165 Ga0105240_101341652 580
190 3300009174 Ga0105241_10009536 Ga0105241_100095364 580
191 3300009174 Ga0105241_10029176 Ga0105241_100291762 580
192 3300009177 Ga0105248_10055683 Ga0105248_100556832 580
193 3300009551 Ga0105238_10001813 Ga0105238_100018135 580
194 3300009551 Ga0105238_10018858 Ga0105238_100188583 580
195 3300010375 Ga0105239_10052316 Ga0105239_100523164 580
196 3300010375 Ga0105239_10108224 Ga0105239_101082243 580
197 3300013100 Ga0157373_10002326 Ga0157373_100023265 580
198 3300013104 Ga0157370_10002310 Ga0157370_1000231015 580
199 3300013104 Ga0157370_10030809 Ga0157370_100308094 580
200 3300013104 Ga0157370_10070848 Ga0157370_100708483 580
201 3300013105 Ga0157369_10012946 Ga0157369_100129467 580
202 3300013296 Ga0157374_10165667 Ga0157374_101656671 580
203 3300013307 Ga0157372_10076603 Ga0157372_100766033 580
204 3300013308 Ga0157375_10040154 Ga0157375_100401542 580
205 3300014325 Ga0163163_10010081 Ga0163163_100100812 580
206 3300014968 Ga0157379_10000359 Ga0157379_1000035918 580
207 3300014968 Ga0157379_10003422 Ga0157379_100034227 580
208 3300014968 Ga0157379_10036349 Ga0157379_100363495 580
209 3300025261 Ga0209233_1000013 Ga0209233_1000013368 580
210 3300025297 Ga0209758_1000036 Ga0209758_1000036322 580
211 3300025893 Ga0207682_10031647 Ga0207682_100316471 580
212 3300025906 Ga0207699_10000178 Ga0207699_1000017836 580
213 3300025913 Ga0207695_10033061 Ga0207695_100330614 580
214 3300025913 Ga0207695_10044258 Ga0207695_100442581 580
215 3300025913 Ga0207695_10086680 Ga0207695_100866804 580
216 3300025914 Ga0207671_10008489 Ga0207671_100084895 580
217 3300025915 Ga0207693_10000299 Ga0207693_1000029910 580
218 3300025915 Ga0207693_10002579 Ga0207693_100025793 580
219 3300025917 Ga0207660_10051997 Ga0207660_100519971 580
220 3300025919 Ga0207657_10049793 Ga0207657_100497931 580
221 3300025924 Ga0207694_10024870 Ga0207694_100248702 580
222 3300025928 Ga0207700_10000010 Ga0207700_10000010244 580
223 3300025949 Ga0207667_10028357 Ga0207667_100283574 580
224 3300025949 Ga0207667_10066429 Ga0207667_100664293 580
225 3300026035 Ga0207703_10064800 Ga0207703_100648002 580
226 3300026078 Ga0207702_10000013 Ga0207702_1000001343 580
227 3300026078 Ga0207702_10000911 Ga0207702_100009119 580
228 3300026078 Ga0207702_10080205 Ga0207702_100802053 580
229 3300026116 Ga0207674_10000026 Ga0207674_1000002613 580
230 3300028379 Ga0268266_10006035 Ga0268266_100060355 580
231 3300028379 Ga0268266_10012212 Ga0268266_100122126 580
232 3300028800 Ga0265338_10005577 Ga0265338_1000557710 580
233 3300028800 Ga0265338_10006000 Ga0265338_1000600012 580
234 3300028800 Ga0265338_10018675 Ga0265338_100186757 580
235 3300028800 Ga0265338_10050338 Ga0265338_100503383 580
236 3300028800 Ga0265338_10051011 Ga0265338_100510112 580
237 3300031235 Ga0265330_10006710 Ga0265330_100067105 580
238 3300031240 Ga0265320_10001046 Ga0265320_100010469 580
239 3300031241 Ga0265325_10001041 Ga0265325_100010414 580
240 3300031247 Ga0265340_10004314 Ga0265340_100043146 580
241 3300031247 Ga0265340_10014337 Ga0265340_100143372 580
242 3300031249 Ga0265339_10007591 Ga0265339_100075917 580
243 3300031250 Ga0265331_10016528 Ga0265331_100165281 580
244 3300031595 Ga0265313_10001220 Ga0265313_1000122013 580
245 3300031595 Ga0265313_10004653 Ga0265313_100046534 580
246 3300031595 Ga0265313_10008142 Ga0265313_100081424 580
247 3300031711 Ga0265314_10010809 Ga0265314_100108094 580
248 3300031711 Ga0265314_10013244 Ga0265314_100132442 580
249 3300035170 Ga0373943_0052854 Ga0373943_0052854_104_1927 580
250 3300036401 Ga0373937_0001935 Ga0373937_0001935_6127_7947 580
251 3300037068 Ga0373925_0047398 Ga0373925_0047398_953_2776 580
252 3300046472 Ga0495580_0015730 Ga0495580_0015730_1058_2881 580
253 3300046530 Ga0495654_0028072 Ga0495654_0028072_954_2756 580
254 3300046557 Ga0495622_0008195 Ga0495622_0008195_1974_3776 580
255 3300046683 Ga0495658_0009668 Ga0495658_0009668_2925_4748 580
256 3300048924 Ga0496121_0002235 Ga0496121_0002235_5900_7702 580
257 3300048929 Ga0496126_0000859 Ga0496126_0000859_43452_45272 580
258 3300049568 Ga0501031_0005344 Ga0501031_0005344_3688_5490 580
259 3300049569 Ga0501032_0002310 Ga0501032_0002310_7303_9105 580
260 3300049570 Ga0501033_0004673 Ga0501033_0004673_7490_9292 580
261 3300049570 Ga0501033_0020891 Ga0501033_0020891_2468_4270 580
262 3300049570 Ga0501033_0030250 Ga0501033_0030250_1561_3363 580
263 3300049571 Ga0501034_0010630 Ga0501034_0010630_3381_5183 580
264 3300049572 Ga0501036_0004939 Ga0501036_0004939_5124_6926 580
265 3300049572 Ga0501036_0054354 Ga0501036_0054354_157_1959 580
266 3300049573 Ga0501037_0004362 Ga0501037_0004362_3253_5055 580
267 3300049574 Ga0501038_0002236 Ga0501038_0002236_5871_7673 580
268 3300049574 Ga0501038_0027253 Ga0501038_0027253_74_1906 580
269 3300049575 Ga0501039_0002160 Ga0501039_0002160_6398_8200 580
270 3300049578 Ga0501042_0004376 Ga0501042_0004376_2814_4616 580
271 3300049580 Ga0501046_0002239 Ga0501046_0002239_5872_7674 580
272 3300049580 Ga0501046_0008626 Ga0501046_0008626_5519_7321 580
273 3300049581 Ga0501047_0012776 Ga0501047_0012776_4275_6077 580
274 3300049581 Ga0501047_0036370 Ga0501047_0036370_2468_4270 580
275 3300049582 Ga0501048_0007588 Ga0501048_0007588_4781_6583 580
276 3300049583 Ga0501067_0006932 Ga0501067_0006932_800_2602 580
277 3300049585 Ga0501069_0000595 Ga0501069_0000595_102_1904 580
278 3300049586 Ga0501070_0000157 Ga0501070_0000157_54782_56614 580
279 3300049586 Ga0501070_0011667 Ga0501070_0011667_2276_4078 580
280 3300049589 Ga0501073_0007084 Ga0501073_0007084_3676_5478 580
281 3300049590 Ga0501074_0000515 Ga0501074_0000515_6655_8457 580
282 3300049742 Ga0501080_0006942 Ga0501080_0006942_1821_3653 580
283 3300049822 Ga0501035_0004855 Ga0501035_0004855_4821_6653 580
284 3300049822 Ga0501035_0011902 Ga0501035_0011902_2397_4199 580
285 3300049822 Ga0501035_0011916 Ga0501035_0011916_5537_7339 580
286 3300049822 Ga0501035_0027041 Ga0501035_0027041_867_2669 580
287 3300049823 Ga0501044_0001417 Ga0501044_0001417_6090_7922 580
288 3300049823 Ga0501044_0002973 Ga0501044_0002973_6504_8306 580
289 3300049823 Ga0501044_0023295 Ga0501044_0023295_1317_3149 580
290 3300050513 nmdc:mga0rr50_10726_c1 nmdc:mga0rr50_10726_c1_367_2280 580
291 3300050514 nmdc:mga08x19_95_c1 nmdc:mga08x19_95_c1_61400_63313 580
292 3300053087 Ga0500643_000014 Ga0500643_000014_287740_289542 580
293 3300054114 Ga0501084_0000852 Ga0501084_0000852_7004_8806 580
294 3300060353 Ga0501082_0007060 Ga0501082_0007060_6884_8686 580

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12418

AcylCoA_DH_N

Acyl-CoA dehydrogenase N terminal

62

92

0.97

PF12806

Acyl-CoA_dh_C

Acetyl-CoA dehydrogenase C-terminal like

514

637

0.96

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

328

500

0.81

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

192

307

0.78

PF22924

ACOX_C_alpha1

Acyl-CoA oxidase, C-alpha1 domain

340

499

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ijc-assembly1.cif.gz_A structure of mmpa-coa dehydrogenase from roseovarius nubinhibens ism 0.9275 3 573
6ijc-assembly1.cif.gz_A structure of mmpa-coa dehydrogenase from roseovarius nubinhibens ism 0.9211 3 573
6kpt-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase fade5 from mycobacteria smegmatis 0.9131 1 580
6kpt-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase fade5 from mycobacteria smegmatis 0.9116 1 580
6ksb-assembly1.cif.gz_B crystal structure of e447a m130g acyl-coa dehydrogenase fade5 mutant from mycobacteria smegmatis in complex with c16coa 0.9067 1 580
ID Description Score Start End Superfamily
af_Q4DK44_41_183_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.949 18 158 1.10.540.10
af_Q4DK44_41_183_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.93 18 158 1.10.540.10
af_Q4DK44_312_486_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9202 290 449 1.20.140.10
af_Q4DK44_487_616_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9161 458 577 1.20.140.10
5lnxD01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9 40 156 1.10.540.10
ID Description Score Start End GO Terms
AF-A0A5C7KKJ5-F1-model_v4 deleted 0.97 1 162
AF-A0A383ERR9-F1-model_v4 Acyl-CoA dehydrogenase/oxidase N-terminal domain-containing protein 0.9661 1 176 GO:0016627
GO:0050660
AF-A0A519M8V9-F1-model_v4 Acyl-CoA dehydrogenase 0.9648 1 165 GO:0016627
GO:0050660
AF-A0A2A2K5R7-F1-model_v4 HTH merR-type domain-containing protein 0.9632 4 186 GO:0003677
GO:0006355
GO:0016627
GO:0050660
AF-A0A536XCF4-F1-model_v4 Acyl-CoA dehydrogenase 0.9627 1 143 GO:0016627
GO:0050660

Feature Viewer

pLDDT pTM Quality
91.76 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map