F391997

General Info

Members Datasets Scaffolds Average Seq Length
294 165 588 118

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100224050|Ga0075363_1002240502
Length 124
Sequence VNENIKRVDKPWGHEIWWARTDRYVGKILHIKAGESLSLQYHNVKDETIMVSSGKLLFETGPKDDPTNLTKHDMGPGDVFHITPHTVHRMTGVTDVDLVEVSTPELDDVVRLEDRYGRAGTSKP

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
115 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 0.68
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 24.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100224050 3300006048 Bacteria 1078
2 Ga0065714_10348083 3300005288 Unclassified 638
3 Ga0065704_10190064 3300005289 Bacteria 1191
4 Ga0065704_10479284 3300005289 Unclassified 683
5 Ga0065704_10575144 3300005289 Unclassified 621
6 Ga0065712_10035661 3300005290 Unclassified 1235
7 Ga0065715_10108304 3300005293 Bacteria 2723
8 Ga0065707_10001102 3300005295 Bacteria 8322
9 Ga0065707_10104447 3300005295 Bacteria 2689
10 Ga0065707_10116644 3300005295 Bacteria 2232
11 Ga0065707_10141846 3300005295 Unclassified 1762
12 Ga0065707_10199487 3300005295 Bacteria 1318
13 Ga0065707_10394110 3300005295 Bacteria 861
14 Ga0065707_10756500 3300005295 Bacteria 616
15 Ga0065707_10942999 3300005295 Bacteria 554
16 Ga0070676_10171659 3300005328 Bacteria 1403
17 Ga0070676_10735521 3300005328 Unclassified 723
18 Ga0070690_101441991 3300005330 Unclassified 555
19 Ga0070670_100032389 3300005331 Bacteria 4502
20 Ga0070670_100357987 3300005331 Unclassified 1283
21 Ga0070666_10279763 3300005335 Bacteria 1186
22 Ga0070680_101549305 3300005336 Unclassified 574
23 Ga0070689_100064834 3300005340 Unclassified 2844
24 Ga0070661_101299720 3300005344 Unclassified 610
25 Ga0070669_100380447 3300005353 Bacteria 1151
26 Ga0070669_100693048 3300005353 Bacteria 860
27 Ga0070675_100014231 3300005354 Bacteria 6272
28 Ga0070675_100066785 3300005354 Bacteria 2975
29 Ga0070675_100329014 3300005354 Bacteria 1351
30 Ga0070675_101248935 3300005354 Unclassified 684
31 Ga0070675_101781375 3300005354 Unclassified 568
32 Ga0070674_100084374 3300005356 Bacteria 2278
33 Ga0070674_100473786 3300005356 Bacteria 1038
34 Ga0070674_100992991 3300005356 Unclassified 736
35 Ga0070673_100018768 3300005364 Bacteria 4952
36 Ga0070673_100356412 3300005364 Bacteria 1299
37 Ga0070688_100066401 3300005365 Bacteria 2295
38 Ga0070688_100401012 3300005365 Bacteria 1015
39 Ga0070688_100714859 3300005365 Bacteria 777
40 Ga0070667_101496319 3300005367 Unclassified 634
41 Ga0070701_10096627 3300005438 Unclassified 1629
42 Ga0070705_100215946 3300005440 Bacteria 1325
43 Ga0070705_100631182 3300005440 Unclassified 833
44 Ga0070705_101534876 3300005440 Unclassified 559
45 Ga0070700_101524570 3300005441 Unclassified 569
46 Ga0070694_100292842 3300005444 Bacteria 1245
47 Ga0070694_100373896 3300005444 Bacteria 1110
48 Ga0070708_100013026 3300005445 Bacteria 6797
49 Ga0070708_101652099 3300005445 Unclassified 596
50 Ga0070678_101034645 3300005456 Bacteria 756
51 Ga0070678_101261111 3300005456 Bacteria 687
52 Ga0070662_100547763 3300005457 Unclassified 969
53 Ga0070681_11556735 3300005458 Unclassified 586
54 Ga0070685_10889851 3300005466 Unclassified 662
55 Ga0070698_100138058 3300005471 Bacteria 2391
56 Ga0070699_100044925 3300005518 Bacteria 3824
57 Ga0070697_101304083 3300005536 Unclassified 648
58 Ga0070672_100020939 3300005543 Bacteria 4779
59 Ga0070686_100036887 3300005544 Bacteria 3029
60 Ga0070686_100549624 3300005544 Unclassified 903
61 Ga0070695_100098355 3300005545 Unclassified 1966
62 Ga0070695_100122818 3300005545 Bacteria 1779
63 Ga0070695_100373774 3300005545 Bacteria 1074
64 Ga0070695_100816871 3300005545 Unclassified 748
65 Ga0070696_100540861 3300005546 Bacteria 932
66 Ga0070696_100843416 3300005546 Unclassified 757
67 Ga0070696_101189144 3300005546 Bacteria 644
68 Ga0070704_100037421 3300005549 Bacteria 3315
69 Ga0070704_101108097 3300005549 Bacteria 719
70 Ga0070664_100212990 3300005564 Bacteria 1727
71 Ga0070702_100241662 3300005615 Bacteria 1219
72 Ga0068859_100032964 3300005617 Bacteria 5203
73 Ga0068859_100038368 3300005617 Bacteria 4806
74 Ga0068859_100377567 3300005617 Bacteria 1513
75 Ga0068859_101455476 3300005617 Bacteria 756
76 Ga0068859_101826505 3300005617 Bacteria 671
77 Ga0068861_100052347 3300005719 Unclassified 3102
78 Ga0068861_100065403 3300005719 Bacteria 2801
79 Ga0068861_100526580 3300005719 Bacteria 1073
80 Ga0068870_10919229 3300005840 Bacteria 619
81 Ga0068863_100257651 3300005841 Bacteria 1686
82 Ga0068863_100332091 3300005841 Bacteria 1478
83 Ga0068858_100116829 3300005842 Bacteria 2493
84 Ga0068860_100348763 3300005843 Bacteria 1456
85 Ga0068860_100354145 3300005843 Bacteria 1445
86 Ga0068862_100066863 3300005844 Bacteria 3098
87 Ga0068862_100151985 3300005844 Unclassified 2061
88 Ga0068862_100650029 3300005844 Unclassified 1017
89 Ga0068862_100669094 3300005844 Bacteria 1003
90 Ga0075367_10052093 3300006178 Bacteria 2421
91 Ga0075367_10787980 3300006178 Unclassified 605
92 Ga0075366_10131833 3300006195 Unclassified 1508
93 Ga0097621_101284467 3300006237 Unclassified 691
94 Ga0097621_101481825 3300006237 Bacteria 644
95 Ga0068871_100229158 3300006358 Bacteria 1612
96 Ga0075428_100000011 3300006844 Bacteria 194129
97 Ga0075428_100091990 3300006844 Bacteria 3307
98 Ga0075428_100949672 3300006844 Bacteria 911
99 Ga0075430_100064562 3300006846 Bacteria 3075
100 Ga0075430_101705582 3300006846 Unclassified 517
101 Ga0075431_100066628 3300006847 Bacteria 3718
102 Ga0075431_100666828 3300006847 Bacteria 1020
103 Ga0075431_100963577 3300006847 Bacteria 821
104 Ga0075433_10093325 3300006852 Bacteria 2663
105 Ga0075433_10102892 3300006852 Bacteria 2530
106 Ga0075434_100019758 3300006871 Bacteria 6523
107 Ga0075434_100404227 3300006871 Bacteria 1387
108 Ga0075434_100456417 3300006871 Bacteria 1299
109 Ga0075436_100013077 3300006914 Bacteria 5689
110 Ga0075436_100034001 3300006914 Bacteria 3513
111 Ga0075436_100927483 3300006914 Unclassified 652
112 Ga0097620_100032964 3300006931 Bacteria 5203
113 Ga0097620_100038367 3300006931 Bacteria 4806
114 Ga0097620_100377549 3300006931 Bacteria 1513
115 Ga0097620_101455646 3300006931 Bacteria 756
116 Ga0097620_101827299 3300006931 Bacteria 671
117 Ga0075435_100008965 3300007076 Bacteria 7212
118 Ga0075435_100009617 3300007076 Bacteria 7017
119 Ga0075435_100149216 3300007076 Unclassified 1965
120 Ga0075435_100485672 3300007076 Bacteria 1067
121 Ga0105240_10281936 3300009093 Bacteria 1908
122 Ga0111539_10000011 3300009094 Bacteria 356900
123 Ga0111539_10766864 3300009094 Bacteria 1123
124 Ga0111539_11035039 3300009094 Bacteria 954
125 Ga0111539_11597277 3300009094 Unclassified 756
126 Ga0111539_12124005 3300009094 Bacteria 652
127 Ga0114129_10001107 3300009147 Bacteria 35478
128 Ga0114129_10367995 3300009147 Bacteria 1901
129 Ga0114129_13257475 3300009147 Bacteria 526
130 Ga0105243_10813307 3300009148 Unclassified 922
131 Ga0105243_11986146 3300009148 Bacteria 616
132 Ga0105241_11082488 3300009174 Bacteria 754
133 Ga0105242_10724247 3300009176 Bacteria 976
134 Ga0105248_10615010 3300009177 Bacteria 1226
135 Ga0105248_10741056 3300009177 Bacteria 1109
136 Ga0105248_11420057 3300009177 Unclassified 785
137 Ga0105248_11851551 3300009177 Bacteria 685
138 Ga0105238_11568816 3300009551 Bacteria 688
139 Ga0105249_10052923 3300009553 Bacteria 3709
140 Ga0105249_10341614 3300009553 Unclassified 1514
141 Ga0105249_12088343 3300009553 Bacteria 639
142 Ga0163162_11334362 3300013306 Bacteria 815
143 Ga0163162_11656081 3300013306 Bacteria 730
144 Ga0163163_10000011 3300014325 Bacteria 264399
145 Ga0157380_10003197 3300014326 Bacteria 11181
146 Ga0157380_10007729 3300014326 Bacteria 7653
147 Ga0157380_10147871 3300014326 Bacteria 2027
148 Ga0157380_10153377 3300014326 Bacteria 1994
149 Ga0157377_10073952 3300014745 Bacteria 1976
150 Ga0157377_11120477 3300014745 Bacteria 604
151 Ga0157379_10812717 3300014968 Unclassified 883
152 Ga0157379_11022219 3300014968 Bacteria 789
153 Ga0207653_10212532 3300025885 Bacteria 732
154 Ga0207682_10565829 3300025893 Unclassified 537
155 Ga0207642_10593090 3300025899 Unclassified 689
156 Ga0207688_10293490 3300025901 Bacteria 993
157 Ga0207680_10091298 3300025903 Bacteria 1938
158 Ga0207680_10176977 3300025903 Unclassified 1440
159 Ga0207684_10419762 3300025910 Bacteria 1149
160 Ga0207707_10898354 3300025912 Bacteria 732
161 Ga0207707_11206239 3300025912 Unclassified 612
162 Ga0207695_10208936 3300025913 Bacteria 1864
163 Ga0207662_10264577 3300025918 Bacteria 1133
164 Ga0207681_10136914 3300025923 Bacteria 1819
165 Ga0207681_10309890 3300025923 Bacteria 1252
166 Ga0207681_10784939 3300025923 Bacteria 795
167 Ga0207694_11409527 3300025924 Bacteria 589
168 Ga0207650_10033347 3300025925 Bacteria 3729
169 Ga0207650_10595866 3300025925 Bacteria 929
170 Ga0207659_10049372 3300025926 Bacteria 2984
171 Ga0207659_11065997 3300025926 Unclassified 695
172 Ga0207706_10051377 3300025933 Bacteria 3640
173 Ga0207706_10584065 3300025933 Unclassified 960
174 Ga0207686_10821307 3300025934 Unclassified 746
175 Ga0207709_11434961 3300025935 Bacteria 572
176 Ga0207669_10066123 3300025937 Bacteria 2246
177 Ga0207669_10207663 3300025937 Bacteria 1427
178 Ga0207669_11383482 3300025937 Bacteria 599
179 Ga0207669_11383833 3300025937 Unclassified 599
180 Ga0207704_11838077 3300025938 Unclassified 521
181 Ga0207691_10032346 3300025940 Bacteria 4878
182 Ga0207711_10882462 3300025941 Bacteria 832
183 Ga0207689_10144966 3300025942 Bacteria 1957
184 Ga0207689_10973016 3300025942 Bacteria 716
185 Ga0207661_11976590 3300025944 Unclassified 529
186 Ga0207679_10370931 3300025945 Bacteria 1253
187 Ga0207651_10323806 3300025960 Bacteria 1289
188 Ga0207668_11694554 3300025972 Unclassified 571
189 Ga0207658_10199449 3300025986 Bacteria 1670
190 Ga0207677_10452606 3300026023 Bacteria 1100
191 Ga0207703_10981706 3300026035 Bacteria 810
192 Ga0207678_10505971 3300026067 Unclassified 1053
193 Ga0207678_11315898 3300026067 Bacteria 639
194 Ga0207708_10250914 3300026075 Bacteria 1426
195 Ga0207708_11028251 3300026075 Bacteria 717
196 Ga0207702_10359252 3300026078 Bacteria 1396
197 Ga0207641_10278443 3300026088 Bacteria 1572
198 Ga0207641_10514821 3300026088 Bacteria 1163
199 Ga0207648_10617275 3300026089 Bacteria 1000
200 Ga0207648_11721540 3300026089 Unclassified 588
201 Ga0207675_100066752 3300026118 Unclassified 3363
202 Ga0207675_100243826 3300026118 Bacteria 1737
203 Ga0207675_101247584 3300026118 Unclassified 764
204 Ga0207683_10786154 3300026121 Bacteria 883
205 Ga0207683_11263416 3300026121 Unclassified 684
206 Ga0207683_12118529 3300026121 Unclassified 510
207 Ga0207428_10000212 3300027907 Bacteria 80663
208 Ga0207428_10008447 3300027907 Bacteria 9296
209 Ga0207428_10097219 3300027907 Bacteria 2279
210 Ga0268265_10079213 3300028380 Unclassified 2587
211 Ga0268265_10321289 3300028380 Bacteria 1402
212 Ga0268265_10502973 3300028380 Bacteria 1142
213 Ga0268265_11418511 3300028380 Unclassified 697
214 Ga0268265_12086236 3300028380 Unclassified 574
215 Ga0268264_10477728 3300028381 Bacteria 1212
216 Ga0265338_10044448 3300028800 Bacteria 4101
217 Ga0307413_10699636 3300031824 Bacteria 842
218 Ga0373934_0475690 3300035086 Bacteria 524
219 Ga0373931_0353562 3300035691 Bacteria 920
220 Ga0451835_0886928 3300041492 Bacteria 655
221 Ga0451851_0257438 3300041507 Unclassified 545
222 Ga0439462_0109766 3300042015 Unclassified 764
223 Ga0439435_0066037 3300042436 Unclassified 1063
224 Ga0450916_012003 3300042530 Bacteria 1101
225 Ga0451577_0152108 3300042876 Unclassified 2082
226 Ga0439440_0129538 3300042993 Bacteria 709
227 Ga0451576_0057637 3300045051 Bacteria 4060
228 Ga0451576_0147620 3300045051 Bacteria 2452
229 Ga0495599_0048811 3300046678 Bacteria 2654
230 Ga0495658_0031909 3300046683 Bacteria 2873
231 Ga0495672_0000838 3300047320 Bacteria 32748
232 Ga0495684_0485960 3300047471 Bacteria 852
233 Ga0496104_1236120 3300048907 Bacteria 650
234 Ga0496113_0232352 3300048916 Bacteria 1471
235 Ga0501032_0096250 3300049569 Bacteria 1962
236 Ga0501033_0012596 3300049570 Bacteria 6454
237 Ga0501036_0015412 3300049572 Bacteria 6384
238 Ga0501036_0497487 3300049572 Bacteria 1014
239 Ga0501037_0008036 3300049573 Bacteria 7729
240 Ga0501038_0089865 3300049574 Bacteria 2575
241 Ga0501040_0557779 3300049576 Unclassified 827
242 Ga0501040_0889200 3300049576 Bacteria 645
243 Ga0501043_0138456 3300049579 Bacteria 1906
244 Ga0501046_0050393 3300049580 Bacteria 3289
245 Ga0501046_1126563 3300049580 Bacteria 541
246 Ga0501047_0020342 3300049581 Bacteria 6373
247 Ga0501048_0070490 3300049582 Bacteria 2468
248 Ga0501048_0965788 3300049582 Unclassified 613
249 Ga0501068_0153856 3300049584 Bacteria 1446
250 Ga0501070_0101960 3300049586 Bacteria 2373
251 Ga0501073_0029274 3300049589 Bacteria 3935
252 Ga0501074_0070563 3300049590 Bacteria 2511
253 Ga0501076_0188580 3300049592 Bacteria 1682
254 Ga0501076_0498134 3300049592 Bacteria 1004
255 Ga0501079_0048455 3300049741 Bacteria 3278
256 Ga0501080_0115013 3300049742 Bacteria 2494
257 Ga0501081_1040598 3300049743 Bacteria 619
258 Ga0501083_0009630 3300049744 Bacteria 6825
259 Ga0501083_0916009 3300049744 Unclassified 570
260 Ga0501035_0018303 3300049822 Bacteria 6454
261 Ga0501044_0114636 3300049823 Bacteria 2700
262 Ga0501044_1479845 3300049823 Bacteria 544
263 Ga0501045_1427926 3300049824 Unclassified 502
264 nmdc:mga0k408_582125_c1 3300050493 Unclassified 661
265 nmdc:mga06z11_209093_c1 3300050494 Bacteria 1136
266 nmdc:mga07m45_363554_c1 3300050496 Unclassified 841
267 nmdc:mga05p37_147_c1 3300050507 Bacteria 66379
268 nmdc:mga05p37_383804_c1 3300050507 Bacteria 1645
269 nmdc:mga09592_348155_c1 3300050508 Bacteria 1282
270 nmdc:mga0qj67_231869_c1 3300050509 Bacteria 1498
271 nmdc:mga06r32_26297_c1 3300050510 Bacteria 5424
272 nmdc:mga06r32_960388_c1 3300050510 Bacteria 809
273 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
274 nmdc:mga08y16_1366009_c1 3300050511 Bacteria 673
275 nmdc:mga08y16_1852150_c1 3300050511 Bacteria 555
276 nmdc:mga08y16_24027_c1 3300050511 Bacteria 6437
277 nmdc:mga08y16_37790_c1 3300050511 Bacteria 5069
278 nmdc:mga0n895_177417_c1 3300050512 Bacteria 2161
279 nmdc:mga0n895_2097708_c1 3300050512 Unclassified 522
280 nmdc:mga0n895_70568_c1 3300050512 Bacteria 3462
281 nmdc:mga0n895_755873_c1 3300050512 Bacteria 965
282 nmdc:mga0rr50_438395_c1 3300050513 Bacteria 1106
283 nmdc:mga0rr50_470801_c1 3300050513 Bacteria 1066
284 nmdc:mga08x19_585317_c1 3300050514 Bacteria 790
285 nmdc:mga0a205_279912_c1 3300050515 Bacteria 1543
286 nmdc:mga0a205_323367_c1 3300050515 Bacteria 1413
287 nmdc:mga0a205_906364_c1 3300050515 Bacteria 728
288 Ga0495595_0164489 3300053084 Bacteria 1096
289 Ga0501084_0096162 3300054114 Bacteria 2487
290 Ga0501084_0324078 3300054114 Bacteria 1301
291 Ga0501084_0536710 3300054114 Bacteria 989
292 Ga0501082_0013354 3300060353 Bacteria 7063
293 Ga0530510_0535259 3300061734 Bacteria 889
294 Ga0530510_1056839 3300061734 Bacteria 622
295 Ga0075363_100224050
296 Ga0065714_10348083
297 Ga0065704_10190064
298 Ga0065704_10479284
299 Ga0065704_10575144
300 Ga0065712_10035661
301 Ga0065715_10108304
302 Ga0065707_10001102
303 Ga0065707_10104447
304 Ga0065707_10116644
305 Ga0065707_10141846
306 Ga0065707_10199487
307 Ga0065707_10394110
308 Ga0065707_10756500
309 Ga0065707_10942999
310 Ga0070676_10171659
311 Ga0070676_10735521
312 Ga0070690_101441991
313 Ga0070670_100032389
314 Ga0070670_100357987
315 Ga0070666_10279763
316 Ga0070680_101549305
317 Ga0070689_100064834
318 Ga0070661_101299720
319 Ga0070669_100380447
320 Ga0070669_100693048
321 Ga0070675_100014231
322 Ga0070675_100066785
323 Ga0070675_100329014
324 Ga0070675_101248935
325 Ga0070675_101781375
326 Ga0070674_100084374
327 Ga0070674_100473786
328 Ga0070674_100992991
329 Ga0070673_100018768
330 Ga0070673_100356412
331 Ga0070688_100066401
332 Ga0070688_100401012
333 Ga0070688_100714859
334 Ga0070667_101496319
335 Ga0070701_10096627
336 Ga0070705_100215946
337 Ga0070705_100631182
338 Ga0070705_101534876
339 Ga0070700_101524570
340 Ga0070694_100292842
341 Ga0070694_100373896
342 Ga0070708_100013026
343 Ga0070708_101652099
344 Ga0070678_101034645
345 Ga0070678_101261111
346 Ga0070662_100547763
347 Ga0070681_11556735
348 Ga0070685_10889851
349 Ga0070698_100138058
350 Ga0070699_100044925
351 Ga0070697_101304083
352 Ga0070672_100020939
353 Ga0070686_100036887
354 Ga0070686_100549624
355 Ga0070695_100098355
356 Ga0070695_100122818
357 Ga0070695_100373774
358 Ga0070695_100816871
359 Ga0070696_100540861
360 Ga0070696_100843416
361 Ga0070696_101189144
362 Ga0070704_100037421
363 Ga0070704_101108097
364 Ga0070664_100212990
365 Ga0070702_100241662
366 Ga0068859_100032964
367 Ga0068859_100038368
368 Ga0068859_100377567
369 Ga0068859_101455476
370 Ga0068859_101826505
371 Ga0068861_100052347
372 Ga0068861_100065403
373 Ga0068861_100526580
374 Ga0068870_10919229
375 Ga0068863_100257651
376 Ga0068863_100332091
377 Ga0068858_100116829
378 Ga0068860_100348763
379 Ga0068860_100354145
380 Ga0068862_100066863
381 Ga0068862_100151985
382 Ga0068862_100650029
383 Ga0068862_100669094
384 Ga0075367_10052093
385 Ga0075367_10787980
386 Ga0075366_10131833
387 Ga0097621_101284467
388 Ga0097621_101481825
389 Ga0068871_100229158
390 Ga0075428_100000011
391 Ga0075428_100091990
392 Ga0075428_100949672
393 Ga0075430_100064562
394 Ga0075430_101705582
395 Ga0075431_100066628
396 Ga0075431_100666828
397 Ga0075431_100963577
398 Ga0075433_10093325
399 Ga0075433_10102892
400 Ga0075434_100019758
401 Ga0075434_100404227
402 Ga0075434_100456417
403 Ga0075436_100013077
404 Ga0075436_100034001
405 Ga0075436_100927483
406 Ga0097620_100032964
407 Ga0097620_100038367
408 Ga0097620_100377549
409 Ga0097620_101455646
410 Ga0097620_101827299
411 Ga0075435_100008965
412 Ga0075435_100009617
413 Ga0075435_100149216
414 Ga0075435_100485672
415 Ga0105240_10281936
416 Ga0111539_10000011
417 Ga0111539_10766864
418 Ga0111539_11035039
419 Ga0111539_11597277
420 Ga0111539_12124005
421 Ga0114129_10001107
422 Ga0114129_10367995
423 Ga0114129_13257475
424 Ga0105243_10813307
425 Ga0105243_11986146
426 Ga0105241_11082488
427 Ga0105242_10724247
428 Ga0105248_10615010
429 Ga0105248_10741056
430 Ga0105248_11420057
431 Ga0105248_11851551
432 Ga0105238_11568816
433 Ga0105249_10052923
434 Ga0105249_10341614
435 Ga0105249_12088343
436 Ga0163162_11334362
437 Ga0163162_11656081
438 Ga0163163_10000011
439 Ga0157380_10003197
440 Ga0157380_10007729
441 Ga0157380_10147871
442 Ga0157380_10153377
443 Ga0157377_10073952
444 Ga0157377_11120477
445 Ga0157379_10812717
446 Ga0157379_11022219
447 Ga0207653_10212532
448 Ga0207682_10565829
449 Ga0207642_10593090
450 Ga0207688_10293490
451 Ga0207680_10091298
452 Ga0207680_10176977
453 Ga0207684_10419762
454 Ga0207707_10898354
455 Ga0207707_11206239
456 Ga0207695_10208936
457 Ga0207662_10264577
458 Ga0207681_10136914
459 Ga0207681_10309890
460 Ga0207681_10784939
461 Ga0207694_11409527
462 Ga0207650_10033347
463 Ga0207650_10595866
464 Ga0207659_10049372
465 Ga0207659_11065997
466 Ga0207706_10051377
467 Ga0207706_10584065
468 Ga0207686_10821307
469 Ga0207709_11434961
470 Ga0207669_10066123
471 Ga0207669_10207663
472 Ga0207669_11383482
473 Ga0207669_11383833
474 Ga0207704_11838077
475 Ga0207691_10032346
476 Ga0207711_10882462
477 Ga0207689_10144966
478 Ga0207689_10973016
479 Ga0207661_11976590
480 Ga0207679_10370931
481 Ga0207651_10323806
482 Ga0207668_11694554
483 Ga0207658_10199449
484 Ga0207677_10452606
485 Ga0207703_10981706
486 Ga0207678_10505971
487 Ga0207678_11315898
488 Ga0207708_10250914
489 Ga0207708_11028251
490 Ga0207702_10359252
491 Ga0207641_10278443
492 Ga0207641_10514821
493 Ga0207648_10617275
494 Ga0207648_11721540
495 Ga0207675_100066752
496 Ga0207675_100243826
497 Ga0207675_101247584
498 Ga0207683_10786154
499 Ga0207683_11263416
500 Ga0207683_12118529
501 Ga0207428_10000212
502 Ga0207428_10008447
503 Ga0207428_10097219
504 Ga0268265_10079213
505 Ga0268265_10321289
506 Ga0268265_10502973
507 Ga0268265_11418511
508 Ga0268265_12086236
509 Ga0268264_10477728
510 Ga0265338_10044448
511 Ga0307413_10699636
512 Ga0373934_0475690
513 Ga0373931_0353562
514 Ga0451835_0886928
515 Ga0451851_0257438
516 Ga0439462_0109766
517 Ga0439435_0066037
518 Ga0450916_012003
519 Ga0451577_0152108
520 Ga0439440_0129538
521 Ga0451576_0057637
522 Ga0451576_0147620
523 Ga0495599_0048811
524 Ga0495658_0031909
525 Ga0495672_0000838
526 Ga0495684_0485960
527 Ga0496104_1236120
528 Ga0496113_0232352
529 Ga0501032_0096250
530 Ga0501033_0012596
531 Ga0501036_0015412
532 Ga0501036_0497487
533 Ga0501037_0008036
534 Ga0501038_0089865
535 Ga0501040_0557779
536 Ga0501040_0889200
537 Ga0501043_0138456
538 Ga0501046_0050393
539 Ga0501046_1126563
540 Ga0501047_0020342
541 Ga0501048_0070490
542 Ga0501048_0965788
543 Ga0501068_0153856
544 Ga0501070_0101960
545 Ga0501073_0029274
546 Ga0501074_0070563
547 Ga0501076_0188580
548 Ga0501076_0498134
549 Ga0501079_0048455
550 Ga0501080_0115013
551 Ga0501081_1040598
552 Ga0501083_0009630
553 Ga0501083_0916009
554 Ga0501035_0018303
555 Ga0501044_0114636
556 Ga0501044_1479845
557 Ga0501045_1427926
558 nmdc:mga0k408_582125_c1
559 nmdc:mga06z11_209093_c1
560 nmdc:mga07m45_363554_c1
561 nmdc:mga05p37_147_c1
562 nmdc:mga05p37_383804_c1
563 nmdc:mga09592_348155_c1
564 nmdc:mga0qj67_231869_c1
565 nmdc:mga06r32_26297_c1
566 nmdc:mga06r32_960388_c1
567 nmdc:mga08y16_12_c1
568 nmdc:mga08y16_1366009_c1
569 nmdc:mga08y16_1852150_c1
570 nmdc:mga08y16_24027_c1
571 nmdc:mga08y16_37790_c1
572 nmdc:mga0n895_177417_c1
573 nmdc:mga0n895_2097708_c1
574 nmdc:mga0n895_70568_c1
575 nmdc:mga0n895_755873_c1
576 nmdc:mga0rr50_438395_c1
577 nmdc:mga0rr50_470801_c1
578 nmdc:mga08x19_585317_c1
579 nmdc:mga0a205_279912_c1
580 nmdc:mga0a205_323367_c1
581 nmdc:mga0a205_906364_c1
582 Ga0495595_0164489
583 Ga0501084_0096162
584 Ga0501084_0324078
585 Ga0501084_0536710
586 Ga0501082_0013354
587 Ga0530510_0535259
588 Ga0530510_1056839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

27

103

0.88

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

2

114

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9229 15 100
1uik-assembly1.cif.gz_C crystal structure of soybean beta-conglycinin alpha prime homotrimer 0.9155 24 99
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.914 19 102
1h1m-assembly1.cif.gz_C crystal structure of quercetin 2,3-dioxygenase anaerobically complexed with the substrate kaempferol 0.9128 7 99
1h1i-assembly2.cif.gz_B crystal structure of quercetin 2,3-dioxygenase anaerobically complexed with the substrate quercetn 0.9124 14 99
ID Description Score Start End Superfamily
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9077 17 100 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9012 17 100 2.60.120.10
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9011 7 99 2.60.120.10
af_Q9UT79_390_673_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.896 25 100 2.60.120.650
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.892 1 101 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1PAS5-F1-model_v4 Cupin domain-containing protein 0.9774 6 116
AF-A0A1F2T8B0-F1-model_v4 Cupin 0.9743 6 115
AF-A0A1G1HUV7-F1-model_v4 Cupin 0.9735 5 97
AF-A0A3N5NW21-F1-model_v4 Cupin 0.972 3 115 GO:0005976
GO:0016779
AF-A0A534YVW0-F1-model_v4 Cupin domain-containing protein 0.9675 6 116

Map