F391647

General Info

Members Datasets Scaffolds Average Seq Length
293 186 586 314

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0058525|Ga0451576_0058525_11_1066
Length 351
Sequence MTDAGDDWRRHRQVFKGVDARMTSAAPIPLVPIERRSSRAPRKTIELTIDGRAVSVPEGTTILGACRELGIDVPTLCFLETLHPVNVCRVCVVEVQGARVLVPSCSRKVEAGMVVQTRSPRVMHSRKIVFEMLASSVDLSTTPEVGDWLQEYGCAPERYGPAAPASDAGHRDAALTGHHDAPDPAFAATVAQPVKVDNDLYIRDYTKCILCYKCVEACGTDHQNTFAIAVAGRGFDARISTEMAVPLPQSACVYCGNCIAVCPTGALMPKREFDLRALGTWNEDTQTQTDTICPYCGVGCTLRLHVQDGEIVKATSPLDNSITLGNLCIKGRFGWRFVQNGVVSSGNNAGA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.02
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 0
Rhizoplane 5.12
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0058525 3300045051 Bacteria 4027
2 Ga0070683_100009774 3300005329 Bacteria 8218
3 Ga0070683_100016602 3300005329 Bacteria 6497
4 Ga0070683_100021967 3300005329 Bacteria 5697
5 Ga0070683_100028756 3300005329 Bacteria 5026
6 Ga0070683_100087477 3300005329 Bacteria 2922
7 Ga0070680_100004796 3300005336 Bacteria 10176
8 Ga0070680_100037218 3300005336 Bacteria 3931
9 Ga0070680_100085210 3300005336 Bacteria 2610
10 Ga0070680_100160290 3300005336 Bacteria 1890
11 Ga0070682_100015952 3300005337 Bacteria 4363
12 Ga0070660_100011642 3300005339 Bacteria 6261
13 Ga0070660_100067453 3300005339 Bacteria 2787
14 Ga0070691_10056190 3300005341 Bacteria 1886
15 Ga0070692_10061994 3300005345 Bacteria 1972
16 Ga0070669_100014986 3300005353 Bacteria 5526
17 Ga0070675_100267731 3300005354 Bacteria 1499
18 Ga0070674_100081343 3300005356 Bacteria 2315
19 Ga0070674_100299461 3300005356 Bacteria 1281
20 Ga0070713_100005671 3300005436 Bacteria 8568
21 Ga0070705_100090294 3300005440 Bacteria 1906
22 Ga0070705_100094146 3300005440 Bacteria 1875
23 Ga0070708_100131449 3300005445 Bacteria 2317
24 Ga0070708_100351201 3300005445 Bacteria 1390
25 Ga0070663_100015093 3300005455 Bacteria 4973
26 Ga0070681_10053506 3300005458 Bacteria 4023
27 Ga0070681_10057198 3300005458 Bacteria 3880
28 Ga0070706_100239573 3300005467 Bacteria 1694
29 Ga0070707_100124656 3300005468 Bacteria 2502
30 Ga0070698_100527023 3300005471 Bacteria 1120
31 Ga0070679_100019123 3300005530 Bacteria 6655
32 Ga0070679_100259410 3300005530 Bacteria 1693
33 Ga0070679_100484405 3300005530 Bacteria 1181
34 Ga0070679_100528822 3300005530 Bacteria 1123
35 Ga0070684_100064718 3300005535 Bacteria 3208
36 Ga0070697_100041461 3300005536 Bacteria 3725
37 Ga0070665_100076291 3300005548 Bacteria 3359
38 Ga0070704_100030760 3300005549 Bacteria 3601
39 Ga0068855_100086225 3300005563 Bacteria 3631
40 Ga0070664_100087568 3300005564 Bacteria 2693
41 Ga0068857_100389354 3300005577 Bacteria 1295
42 Ga0068854_100072384 3300005578 Bacteria 2524
43 Ga0068854_100199679 3300005578 Bacteria 1571
44 Ga0068859_100562893 3300005617 Bacteria 1234
45 Ga0068864_100105717 3300005618 Bacteria 2502
46 Ga0068858_100298330 3300005842 Bacteria 1537
47 Ga0068862_100123704 3300005844 Bacteria 2282
48 Ga0068862_100163580 3300005844 Bacteria 1988
49 Ga0068862_100322214 3300005844 Bacteria 1427
50 Ga0081455_10004628 3300005937 Bacteria 15341
51 Ga0081540_1065392 3300005983 Bacteria 1710
52 Ga0075365_10083636 3300006038 Bacteria 2165
53 Ga0075364_10021261 3300006051 Bacteria 4088
54 Ga0075362_10000935 3300006177 Bacteria 8910
55 Ga0075366_10014617 3300006195 Bacteria 4485
56 Ga0075366_10126832 3300006195 Bacteria 1539
57 Ga0075428_100238479 3300006844 Bacteria 1962
58 Ga0075428_100406337 3300006844 Bacteria 1459
59 Ga0075430_100036770 3300006846 Bacteria 4150
60 Ga0075430_100037207 3300006846 Bacteria 4126
61 Ga0075431_100152661 3300006847 Bacteria 2378
62 Ga0075433_10011176 3300006852 Bacteria 7222
63 Ga0075433_10145471 3300006852 Bacteria 2107
64 Ga0075434_100003215 3300006871 Bacteria 14570
65 Ga0075434_100091789 3300006871 Bacteria 3038
66 Ga0075434_100160551 3300006871 Bacteria 2267
67 Ga0075429_100006451 3300006880 Bacteria 10158
68 Ga0075429_100024305 3300006880 Bacteria 5257
69 Ga0075429_100085324 3300006880 Bacteria 2753
70 Ga0075436_100000273 3300006914 Bacteria 32570
71 Ga0075436_100118184 3300006914 Bacteria 1853
72 Ga0097620_100562867 3300006931 Bacteria 1234
73 Ga0075435_100153893 3300007076 Bacteria 1934
74 Ga0111539_10000391 3300009094 Bacteria 54306
75 Ga0114129_10001461 3300009147 Bacteria 31932
76 Ga0114129_10147368 3300009147 Bacteria 3223
77 Ga0105243_10007637 3300009148 Bacteria 8311
78 Ga0105243_10350502 3300009148 Bacteria 1355
79 Ga0105237_10083088 3300009545 Bacteria 3194
80 Ga0105238_10058263 3300009551 Bacteria 3872
81 Ga0105238_10230614 3300009551 Bacteria 1828
82 Ga0105238_10273329 3300009551 Bacteria 1670
83 Ga0105249_10054420 3300009553 Bacteria 3660
84 Ga0105249_10184022 3300009553 Bacteria 2034
85 Ga0105249_10270907 3300009553 Bacteria 1691
86 Ga0105249_10476209 3300009553 Bacteria 1291
87 Ga0157370_10001193 3300013104 Bacteria 32395
88 Ga0157370_10305952 3300013104 Bacteria 1467
89 Ga0163162_10288939 3300013306 Bacteria 1772
90 Ga0157372_10321969 3300013307 Bacteria 1800
91 Ga0182008_10085449 3300014497 Bacteria 1554
92 Ga0206350_11069090 3300020080 Bacteria 2132
93 Ga0206353_10205501 3300020082 Bacteria 2113
94 Ga0224712_10004757 3300022467 Bacteria 3701
95 Ga0207699_10131714 3300025906 Bacteria 1632
96 Ga0207645_10088284 3300025907 Bacteria 1993
97 Ga0207705_10029601 3300025909 Bacteria 3904
98 Ga0207707_10011637 3300025912 Bacteria 7659
99 Ga0207707_10021602 3300025912 Bacteria 5624
100 Ga0207707_10045678 3300025912 Bacteria 3816
101 Ga0207660_10075180 3300025917 Bacteria 2467
102 Ga0207660_10109553 3300025917 Bacteria 2076
103 Ga0207657_10002448 3300025919 Bacteria 20057
104 Ga0207657_10047236 3300025919 Bacteria 3766
105 Ga0207649_10080898 3300025920 Bacteria 2102
106 Ga0207652_10024591 3300025921 Bacteria 4997
107 Ga0207652_10406856 3300025921 Bacteria 1228
108 Ga0207646_10230498 3300025922 Bacteria 1673
109 Ga0207681_10225785 3300025923 Bacteria 1451
110 Ga0207694_10222569 3300025924 Bacteria 1540
111 Ga0207700_10018108 3300025928 Bacteria 4724
112 Ga0207700_10125481 3300025928 Bacteria 2088
113 Ga0207690_10103748 3300025932 Bacteria 2036
114 Ga0207669_10016256 3300025937 Bacteria 3776
115 Ga0207669_10074660 3300025937 Bacteria 2145
116 Ga0207661_10009369 3300025944 Bacteria 7019
117 Ga0207661_10036714 3300025944 Bacteria 3827
118 Ga0207661_10105376 3300025944 Bacteria 2376
119 Ga0207661_10161679 3300025944 Bacteria 1943
120 Ga0207661_10205816 3300025944 Bacteria 1732
121 Ga0207712_10140257 3300025961 Bacteria 1854
122 Ga0207712_10369423 3300025961 Bacteria 1197
123 Ga0207703_10225106 3300026035 Bacteria 1679
124 Ga0207702_10230788 3300026078 Bacteria 1730
125 Ga0207676_10181933 3300026095 Bacteria 1841
126 Ga0207674_10213869 3300026116 Bacteria 1876
127 Ga0207675_100037199 3300026118 Bacteria 4541
128 Ga0207698_10007155 3300026142 Bacteria 6990
129 Ga0207698_10177630 3300026142 Bacteria 1882
130 Ga0207698_10184013 3300026142 Bacteria 1854
131 Ga0207428_10001255 3300027907 Bacteria 27154
132 Ga0268265_10262967 3300028380 Bacteria 1535
133 Ga0265332_10004319 3300031238 Bacteria 6704
134 Ga0307408_100032887 3300031548 Bacteria 3619
135 Ga0307408_100083784 3300031548 Bacteria 2390
136 Ga0265314_10003305 3300031711 Bacteria 15746
137 Ga0307410_10284306 3300031852 Bacteria 1299
138 Ga0307407_10087216 3300031903 Bacteria 1903
139 Ga0307412_10035131 3300031911 Bacteria 3200
140 Ga0307412_10308402 3300031911 Bacteria 1254
141 Ga0307409_100023564 3300031995 Bacteria 4270
142 Ga0307416_100020161 3300032002 Bacteria 4749
143 Ga0307416_100275308 3300032002 Bacteria 1656
144 Ga0307411_10203471 3300032005 Bacteria 1523
145 Ga0307411_10277092 3300032005 Bacteria 1333
146 Ga0373926_0084637 3300035083 Bacteria 1175
147 Ga0373954_0030449 3300035118 Bacteria 2488
148 Ga0373927_0000372 3300035695 Bacteria 34696
149 Ga0373927_0007426 3300035695 Bacteria 7420
150 Ga0373933_0136050 3300035724 Bacteria 1548
151 Ga0373947_0015524 3300035725 Bacteria 4374
152 Ga0373947_0062102 3300035725 Bacteria 2272
153 Ga0373925_0000333 3300037068 Bacteria 48976
154 Ga0395905_0103099 3300037471 Bacteria 2678
155 Ga0436364_0159843 3300037853 Bacteria 1502
156 Ga0436361_0168565 3300039447 Bacteria 4314
157 Ga0439464_0003851 3300042439 Bacteria 3816
158 Ga0453683_0001790 3300044673 Bacteria 17778
159 Ga0451576_0057092 3300045051 Bacteria 4080
160 Ga0495592_0202619 3300046454 Bacteria 1338
161 Ga0495651_0016906 3300046462 Bacteria 5649
162 Ga0495653_0079297 3300046463 Bacteria 2432
163 Ga0495653_0101291 3300046463 Bacteria 2087
164 Ga0495580_0000110 3300046472 Bacteria 55363
165 Ga0495580_0021167 3300046472 Bacteria 4801
166 Ga0495580_0203267 3300046472 Bacteria 1364
167 Ga0495582_0014762 3300046473 Bacteria 4292
168 Ga0495639_0008176 3300046475 Bacteria 4493
169 Ga0495664_0037027 3300046477 Bacteria 2878
170 Ga0495594_0005571 3300046499 Bacteria 6469
171 Ga0495594_0007451 3300046499 Bacteria 5631
172 Ga0495594_0009965 3300046499 Bacteria 4920
173 Ga0495594_0032544 3300046499 Bacteria 2831
174 Ga0495594_0046417 3300046499 Unclassified 2386
175 Ga0495608_0012764 3300046511 Bacteria 5829
176 Ga0495608_0152165 3300046511 Bacteria 1474
177 Ga0495618_0038543 3300046514 Bacteria 3004
178 Ga0495618_0093735 3300046514 Bacteria 1920
179 Ga0495628_0045763 3300046516 Bacteria 3478
180 Ga0495628_0060951 3300046516 Bacteria 2960
181 Ga0495628_0309304 3300046516 Bacteria 1168
182 Ga0495630_0090585 3300046517 Bacteria 2310
183 Ga0495630_0125374 3300046517 Bacteria 1949
184 Ga0495666_0064821 3300046526 Bacteria 1743
185 Ga0495652_0032973 3300046529 Bacteria 4526
186 Ga0495665_0046937 3300046531 Bacteria 2292
187 Ga0495640_0049933 3300046533 Bacteria 2883
188 Ga0495640_0050312 3300046533 Bacteria 2871
189 Ga0495587_0002700 3300046536 Bacteria 11837
190 Ga0495587_0010926 3300046536 Bacteria 5762
191 Ga0495587_0171748 3300046536 Bacteria 1231
192 Ga0495645_0001394 3300046543 Bacteria 16330
193 Ga0495645_0028574 3300046543 Bacteria 4053
194 Ga0495645_0084411 3300046543 Bacteria 2274
195 Ga0495667_0004846 3300046559 Bacteria 9094
196 Ga0495667_0008095 3300046559 Bacteria 7135
197 Ga0495667_0036688 3300046559 Bacteria 3270
198 Ga0495635_0220155 3300046663 Bacteria 1284
199 Ga0495659_0071253 3300046664 Bacteria 1302
200 Ga0495599_0000209 3300046678 Bacteria 38082
201 Ga0495599_0022796 3300046678 Bacteria 3910
202 Ga0495647_0037609 3300046681 Bacteria 1827
203 Ga0495613_0140156 3300046689 Bacteria 1728
204 Ga0495624_0029123 3300046690 Bacteria 3605
205 Ga0495600_0004595 3300046809 Bacteria 8270
206 Ga0495674_0007167 3300047319 Bacteria 10663
207 Ga0495674_0245854 3300047319 Bacteria 1473
208 Ga0495672_0003591 3300047320 Bacteria 13179
209 Ga0495680_0032166 3300047322 Bacteria 4262
210 Ga0495680_0099430 3300047322 Bacteria 2169
211 Ga0495680_0197373 3300047322 Bacteria 1445
212 Ga0495675_0085709 3300047444 Bacteria 1980
213 Ga0495684_0063137 3300047471 Bacteria 2816
214 Ga0495684_0137720 3300047471 Bacteria 1831
215 Ga0496104_0034795 3300048907 Bacteria 4699
216 Ga0496104_0047691 3300048907 Bacteria 4038
217 Ga0496105_0089040 3300048908 Bacteria 2550
218 Ga0496108_0041616 3300048911 Bacteria 3836
219 Ga0496109_0058190 3300048912 Bacteria 3530
220 Ga0496109_0158845 3300048912 Bacteria 2118
221 Ga0496110_0046744 3300048913 Bacteria 3787
222 Ga0496111_0109550 3300048914 Bacteria 2033
223 Ga0496112_0002403 3300048915 Bacteria 15066
224 Ga0496112_0025297 3300048915 Bacteria 5700
225 Ga0496112_0142572 3300048915 Bacteria 2365
226 Ga0496113_0098388 3300048916 Bacteria 2264
227 Ga0496113_0108757 3300048916 Bacteria 2155
228 Ga0496113_0120461 3300048916 Bacteria 2051
229 Ga0496115_0060034 3300048918 Bacteria 3064
230 Ga0501033_0042192 3300049570 Bacteria 3402
231 Ga0501034_0095705 3300049571 Bacteria 2966
232 Ga0501036_0101889 3300049572 Bacteria 2429
233 Ga0501036_0273308 3300049572 Bacteria 1414
234 Ga0501038_0067218 3300049574 Bacteria 3050
235 Ga0501039_0087732 3300049575 Bacteria 2424
236 Ga0501040_0067177 3300049576 Bacteria 2471
237 Ga0501047_0056096 3300049581 Bacteria 3809
238 Ga0501048_0075022 3300049582 Bacteria 2386
239 Ga0501067_0136601 3300049583 Bacteria 1365
240 Ga0501071_0069641 3300049587 Bacteria 2562
241 Ga0501072_0010842 3300049588 Bacteria 6947
242 Ga0501072_0116046 3300049588 Bacteria 2132
243 Ga0501072_0209281 3300049588 Bacteria 1554
244 Ga0501074_0017747 3300049590 Bacteria 5169
245 Ga0501075_0142779 3300049591 Bacteria 1825
246 Ga0501076_0020539 3300049592 Bacteria 5056
247 Ga0501076_0034410 3300049592 Bacteria 3960
248 Ga0501077_0001035 3300049593 Bacteria 16810
249 Ga0501202_030450 3300049652 Bacteria 1123
250 Ga0501207_017434 3300049654 Bacteria 1121
251 Ga0501217_041938 3300049661 Bacteria 1167
252 Ga0501225_0049590 3300049705 Bacteria 1167
253 Ga0501079_0118718 3300049741 Bacteria 2056
254 Ga0501080_0109918 3300049742 Bacteria 2555
255 Ga0501035_0039926 3300049822 Bacteria 4244
256 Ga0501044_0026061 3300049823 Bacteria 6192
257 Ga0501044_0409204 3300049823 Bacteria 1268
258 Ga0501045_0151733 3300049824 Bacteria 1724
259 Ga0501212_006890 3300049851 Bacteria 1543
260 nmdc:mga03683_1133_c1 3300050489 Bacteria 7833
261 nmdc:mga00v17_835_c1 3300050491 Bacteria 16694
262 nmdc:mga0yw44_27189_c1 3300050492 Bacteria 3274
263 nmdc:mga0k408_188515_c1 3300050493 Bacteria 1230
264 nmdc:mga0k408_7739_c1 3300050493 Bacteria 5744
265 nmdc:mga06z11_183785_c1 3300050494 Bacteria 1207
266 nmdc:mga05p37_1458_c1 3300050507 Bacteria 27488
267 nmdc:mga09592_14954_c1 3300050508 Bacteria 6339
268 nmdc:mga09592_59083_c1 3300050508 Bacteria 3242
269 nmdc:mga0qj67_108279_c1 3300050509 Bacteria 2242
270 nmdc:mga06r32_12899_c1 3300050510 Bacteria 7555
271 nmdc:mga06r32_137497_c1 3300050510 Bacteria 2418
272 nmdc:mga06r32_13984_c1 3300050510 Bacteria 7280
273 nmdc:mga06r32_56819_c1 3300050510 Bacteria 3757
274 nmdc:mga08y16_155970_c1 3300050511 Bacteria 2372
275 nmdc:mga08y16_516_c1 3300050511 Bacteria 35677
276 nmdc:mga0n895_151710_c1 3300050512 Bacteria 2348
277 nmdc:mga0n895_152929_c1 3300050512 Bacteria 2338
278 nmdc:mga0n895_169316_c1 3300050512 Bacteria 2216
279 nmdc:mga0n895_223795_c1 3300050512 Bacteria 1910
280 nmdc:mga0n895_2747_c1 3300050512 Bacteria 13891
281 nmdc:mga0rr50_100288_c1 3300050513 Bacteria 2274
282 nmdc:mga08x19_13589_c1 3300050514 Bacteria 4924
283 nmdc:mga08x19_20645_c1 3300050514 Bacteria 4057
284 nmdc:mga08x19_239_c1 3300050514 Bacteria 41858
285 nmdc:mga0a205_176989_c1 3300050515 Bacteria 2028
286 nmdc:mga0a205_31327_c1 3300050515 Bacteria 5095
287 nmdc:mga0a205_331755_c1 3300050515 Bacteria 1391
288 Ga0495619_0024321 3300053085 Bacteria 3884
289 Ga0495619_0338395 3300053085 Bacteria 1041
290 Ga0501084_0191517 3300054114 Bacteria 1725
291 Ga0530510_0141915 3300061734 Bacteria 1770
292 Ga0530510_0256626 3300061734 Bacteria 1303
293 8056214742 8056207758 Bacteria 8639239
294 Ga0451576_0058525
295 Ga0070683_100009774
296 Ga0070683_100016602
297 Ga0070683_100021967
298 Ga0070683_100028756
299 Ga0070683_100087477
300 Ga0070680_100004796
301 Ga0070680_100037218
302 Ga0070680_100085210
303 Ga0070680_100160290
304 Ga0070682_100015952
305 Ga0070660_100011642
306 Ga0070660_100067453
307 Ga0070691_10056190
308 Ga0070692_10061994
309 Ga0070669_100014986
310 Ga0070675_100267731
311 Ga0070674_100081343
312 Ga0070674_100299461
313 Ga0070713_100005671
314 Ga0070705_100090294
315 Ga0070705_100094146
316 Ga0070708_100131449
317 Ga0070708_100351201
318 Ga0070663_100015093
319 Ga0070681_10053506
320 Ga0070681_10057198
321 Ga0070706_100239573
322 Ga0070707_100124656
323 Ga0070698_100527023
324 Ga0070679_100019123
325 Ga0070679_100259410
326 Ga0070679_100484405
327 Ga0070679_100528822
328 Ga0070684_100064718
329 Ga0070697_100041461
330 Ga0070665_100076291
331 Ga0070704_100030760
332 Ga0068855_100086225
333 Ga0070664_100087568
334 Ga0068857_100389354
335 Ga0068854_100072384
336 Ga0068854_100199679
337 Ga0068859_100562893
338 Ga0068864_100105717
339 Ga0068858_100298330
340 Ga0068862_100123704
341 Ga0068862_100163580
342 Ga0068862_100322214
343 Ga0081455_10004628
344 Ga0081540_1065392
345 Ga0075365_10083636
346 Ga0075364_10021261
347 Ga0075362_10000935
348 Ga0075366_10014617
349 Ga0075366_10126832
350 Ga0075428_100238479
351 Ga0075428_100406337
352 Ga0075430_100036770
353 Ga0075430_100037207
354 Ga0075431_100152661
355 Ga0075433_10011176
356 Ga0075433_10145471
357 Ga0075434_100003215
358 Ga0075434_100091789
359 Ga0075434_100160551
360 Ga0075429_100006451
361 Ga0075429_100024305
362 Ga0075429_100085324
363 Ga0075436_100000273
364 Ga0075436_100118184
365 Ga0097620_100562867
366 Ga0075435_100153893
367 Ga0111539_10000391
368 Ga0114129_10001461
369 Ga0114129_10147368
370 Ga0105243_10007637
371 Ga0105243_10350502
372 Ga0105237_10083088
373 Ga0105238_10058263
374 Ga0105238_10230614
375 Ga0105238_10273329
376 Ga0105249_10054420
377 Ga0105249_10184022
378 Ga0105249_10270907
379 Ga0105249_10476209
380 Ga0157370_10001193
381 Ga0157370_10305952
382 Ga0163162_10288939
383 Ga0157372_10321969
384 Ga0182008_10085449
385 Ga0206350_11069090
386 Ga0206353_10205501
387 Ga0224712_10004757
388 Ga0207699_10131714
389 Ga0207645_10088284
390 Ga0207705_10029601
391 Ga0207707_10011637
392 Ga0207707_10021602
393 Ga0207707_10045678
394 Ga0207660_10075180
395 Ga0207660_10109553
396 Ga0207657_10002448
397 Ga0207657_10047236
398 Ga0207649_10080898
399 Ga0207652_10024591
400 Ga0207652_10406856
401 Ga0207646_10230498
402 Ga0207681_10225785
403 Ga0207694_10222569
404 Ga0207700_10018108
405 Ga0207700_10125481
406 Ga0207690_10103748
407 Ga0207669_10016256
408 Ga0207669_10074660
409 Ga0207661_10009369
410 Ga0207661_10036714
411 Ga0207661_10105376
412 Ga0207661_10161679
413 Ga0207661_10205816
414 Ga0207712_10140257
415 Ga0207712_10369423
416 Ga0207703_10225106
417 Ga0207702_10230788
418 Ga0207676_10181933
419 Ga0207674_10213869
420 Ga0207675_100037199
421 Ga0207698_10007155
422 Ga0207698_10177630
423 Ga0207698_10184013
424 Ga0207428_10001255
425 Ga0268265_10262967
426 Ga0265332_10004319
427 Ga0307408_100032887
428 Ga0307408_100083784
429 Ga0265314_10003305
430 Ga0307410_10284306
431 Ga0307407_10087216
432 Ga0307412_10035131
433 Ga0307412_10308402
434 Ga0307409_100023564
435 Ga0307416_100020161
436 Ga0307416_100275308
437 Ga0307411_10203471
438 Ga0307411_10277092
439 Ga0373926_0084637
440 Ga0373954_0030449
441 Ga0373927_0000372
442 Ga0373927_0007426
443 Ga0373933_0136050
444 Ga0373947_0015524
445 Ga0373947_0062102
446 Ga0373925_0000333
447 Ga0395905_0103099
448 Ga0436364_0159843
449 Ga0436361_0168565
450 Ga0439464_0003851
451 Ga0453683_0001790
452 Ga0451576_0057092
453 Ga0495592_0202619
454 Ga0495651_0016906
455 Ga0495653_0079297
456 Ga0495653_0101291
457 Ga0495580_0000110
458 Ga0495580_0021167
459 Ga0495580_0203267
460 Ga0495582_0014762
461 Ga0495639_0008176
462 Ga0495664_0037027
463 Ga0495594_0005571
464 Ga0495594_0007451
465 Ga0495594_0009965
466 Ga0495594_0032544
467 Ga0495594_0046417
468 Ga0495608_0012764
469 Ga0495608_0152165
470 Ga0495618_0038543
471 Ga0495618_0093735
472 Ga0495628_0045763
473 Ga0495628_0060951
474 Ga0495628_0309304
475 Ga0495630_0090585
476 Ga0495630_0125374
477 Ga0495666_0064821
478 Ga0495652_0032973
479 Ga0495665_0046937
480 Ga0495640_0049933
481 Ga0495640_0050312
482 Ga0495587_0002700
483 Ga0495587_0010926
484 Ga0495587_0171748
485 Ga0495645_0001394
486 Ga0495645_0028574
487 Ga0495645_0084411
488 Ga0495667_0004846
489 Ga0495667_0008095
490 Ga0495667_0036688
491 Ga0495635_0220155
492 Ga0495659_0071253
493 Ga0495599_0000209
494 Ga0495599_0022796
495 Ga0495647_0037609
496 Ga0495613_0140156
497 Ga0495624_0029123
498 Ga0495600_0004595
499 Ga0495674_0007167
500 Ga0495674_0245854
501 Ga0495672_0003591
502 Ga0495680_0032166
503 Ga0495680_0099430
504 Ga0495680_0197373
505 Ga0495675_0085709
506 Ga0495684_0063137
507 Ga0495684_0137720
508 Ga0496104_0034795
509 Ga0496104_0047691
510 Ga0496105_0089040
511 Ga0496108_0041616
512 Ga0496109_0058190
513 Ga0496109_0158845
514 Ga0496110_0046744
515 Ga0496111_0109550
516 Ga0496112_0002403
517 Ga0496112_0025297
518 Ga0496112_0142572
519 Ga0496113_0098388
520 Ga0496113_0108757
521 Ga0496113_0120461
522 Ga0496115_0060034
523 Ga0501033_0042192
524 Ga0501034_0095705
525 Ga0501036_0101889
526 Ga0501036_0273308
527 Ga0501038_0067218
528 Ga0501039_0087732
529 Ga0501040_0067177
530 Ga0501047_0056096
531 Ga0501048_0075022
532 Ga0501067_0136601
533 Ga0501071_0069641
534 Ga0501072_0010842
535 Ga0501072_0116046
536 Ga0501072_0209281
537 Ga0501074_0017747
538 Ga0501075_0142779
539 Ga0501076_0020539
540 Ga0501076_0034410
541 Ga0501077_0001035
542 Ga0501202_030450
543 Ga0501207_017434
544 Ga0501217_041938
545 Ga0501225_0049590
546 Ga0501079_0118718
547 Ga0501080_0109918
548 Ga0501035_0039926
549 Ga0501044_0026061
550 Ga0501044_0409204
551 Ga0501045_0151733
552 Ga0501212_006890
553 nmdc:mga03683_1133_c1
554 nmdc:mga00v17_835_c1
555 nmdc:mga0yw44_27189_c1
556 nmdc:mga0k408_188515_c1
557 nmdc:mga0k408_7739_c1
558 nmdc:mga06z11_183785_c1
559 nmdc:mga05p37_1458_c1
560 nmdc:mga09592_14954_c1
561 nmdc:mga09592_59083_c1
562 nmdc:mga0qj67_108279_c1
563 nmdc:mga06r32_12899_c1
564 nmdc:mga06r32_137497_c1
565 nmdc:mga06r32_13984_c1
566 nmdc:mga06r32_56819_c1
567 nmdc:mga08y16_155970_c1
568 nmdc:mga08y16_516_c1
569 nmdc:mga0n895_151710_c1
570 nmdc:mga0n895_152929_c1
571 nmdc:mga0n895_169316_c1
572 nmdc:mga0n895_223795_c1
573 nmdc:mga0n895_2747_c1
574 nmdc:mga0rr50_100288_c1
575 nmdc:mga08x19_13589_c1
576 nmdc:mga08x19_20645_c1
577 nmdc:mga08x19_239_c1
578 nmdc:mga0a205_176989_c1
579 nmdc:mga0a205_31327_c1
580 nmdc:mga0a205_331755_c1
581 Ga0495619_0024321
582 Ga0495619_0338395
583 Ga0501084_0191517
584 Ga0530510_0141915
585 Ga0530510_0256626
586 8056214742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

286

340

0.96

PF13510

Fer2_4

2Fe-2S iron-sulfur cluster binding domain

42

120

0.96

PF00037

Fer4

4Fe-4S binding domain

246

268

0.92

PF22117

Nqo3_Fer4

NADH-quinone oxidoreductase subunit 3, ferredoxin-like domain

200

268

0.86

PF12838

Fer4_7

4Fe-4S dicluster domain

207

266

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oh5-assembly1.cif.gz_C cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.904 29 124
5luf-assembly1.cif.gz_G cryo-em of bovine respirasome 0.8414 30 137
6h8k-assembly1.cif.gz_A crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8413 30 120
2iv2-assembly1.cif.gz_X reinterpretation of reduced form of formate dehydrogenase h from e. coli 0.8366 271 322
5j8k-assembly1.cif.gz_G architecture of supercomplex i-iii2 0.8305 30 116
ID Description Score Start End Superfamily
af_A4HY18_36_156_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.863 32 137 3.10.20.740
3c8yA01 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8511 30 140 3.10.20.740
af_P9WIV9_16_140_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8429 30 136 3.10.20.740
af_I1LMA5_75_197_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8354 30 138 3.10.20.740
3ml1A01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.8229 270 318 3.30.200.210
ID Description Score Start End GO Terms
AF-A0A3M1RP21-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9654 28 122 GO:0016491
GO:0046872
GO:0051536
AF-A0A7C6QSE5-F1-model_v4 FAD-dependent oxidoreductase 0.9574 28 120 GO:0016491
GO:0051536
AF-A0A2M7AD21-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9549 28 120 GO:0051536
AF-A0A7X5WUA7-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9532 26 124 GO:0051536
AF-A0A1W9SQB3-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9532 28 115 GO:0051536

Map