F391478

General Info

Members Datasets Scaffolds Average Seq Length
293 181 586 341

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10011487|Ga0105237_100114874
Length 367
Sequence LYFVLCALIFVFSEWLAFERRSTKDKEQRTKKKALSEWRNNMFRSSIGRWLLGLILLIAVLAFIRFKPWRLRGNSQQQAQARAELKVGFLPVTCHLTRFESQRFTDFPTVVESIKSGRLDATFMIAPLAMKLREQGVPVKICYLGHRDGSTVIVRKDLPAQSLRDLKGKTFAIPSKYSNQYLVITKLMADQGVDPTDVNFVELPPPDMPGALAAKAIDAYFIGEPHAAKAELDGSGRVLYHAKDIWPHFISCVLVVTDKLIKERPEVVRDLVRGIAESGEWAETHRIEAAKVVAPYFRQDEKLVRYVLTQPPDRVSYRMLTPTDEELQRIHDMALKAGILQKPINMKDLVDREFIPTDIKPANIVSP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 3.75
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10011487 3300009545 Bacteria 9369
2 MBSR1b_contig_11670305 2162886012 Unclassified 1413
3 JGI24738J21930_10002077 3300002075 Bacteria 5365
4 Ga0065704_10084325 3300005289 Unclassified 3348
5 Ga0065712_10000531 3300005290 Bacteria 10443
6 Ga0065712_10131134 3300005290 Bacteria 1548
7 Ga0065712_10133135 3300005290 Bacteria 1523
8 Ga0065715_10008249 3300005293 Bacteria 2942
9 Ga0065715_10091472 3300005293 Bacteria 5764
10 Ga0065715_10103311 3300005293 Unclassified 3043
11 Ga0065715_10179350 3300005293 Bacteria 1488
12 Ga0065707_10019625 3300005295 Bacteria 2095
13 Ga0070683_100413053 3300005329 Bacteria 1287
14 Ga0070690_100000469 3300005330 Bacteria 20227
15 Ga0070690_100002076 3300005330 Bacteria 10699
16 Ga0070690_100123044 3300005330 Unclassified 1743
17 Ga0070670_100015602 3300005331 Bacteria 6524
18 Ga0070670_100093497 3300005331 Bacteria 2586
19 Ga0068869_100002444 3300005334 Bacteria 11205
20 Ga0068869_100027490 3300005334 Bacteria 3966
21 Ga0068869_100097379 3300005334 Bacteria 2221
22 Ga0070666_10042255 3300005335 Bacteria 3049
23 Ga0070666_10072477 3300005335 Unclassified 2345
24 Ga0070680_100001249 3300005336 Bacteria 18349
25 Ga0070680_100011568 3300005336 Bacteria 6832
26 Ga0070682_100000098 3300005337 Bacteria 78492
27 Ga0068868_100011274 3300005338 Bacteria 6508
28 Ga0070660_100051152 3300005339 Bacteria 3181
29 Ga0070687_100077090 3300005343 Unclassified 1808
30 Ga0070669_100006904 3300005353 Bacteria 8161
31 Ga0070669_100084098 3300005353 Bacteria 2374
32 Ga0070675_100275084 3300005354 Bacteria 1478
33 Ga0070673_100220683 3300005364 Bacteria 1640
34 Ga0070673_100233015 3300005364 Bacteria 1598
35 Ga0070659_100013675 3300005366 Bacteria 6048
36 Ga0070667_100099453 3300005367 Bacteria 2511
37 Ga0070667_100399250 3300005367 Unclassified 1251
38 Ga0070701_10041504 3300005438 Bacteria 2345
39 Ga0070701_10208518 3300005438 Unclassified 1159
40 Ga0070700_100104783 3300005441 Bacteria 1869
41 Ga0070700_100208629 3300005441 Bacteria 1377
42 Ga0070694_100006330 3300005444 Bacteria 7186
43 Ga0070694_100207278 3300005444 Bacteria 1464
44 Ga0070708_100002474 3300005445 Bacteria 14267
45 Ga0070678_100011986 3300005456 Bacteria 5369
46 Ga0070662_100072673 3300005457 Bacteria 2540
47 Ga0070681_10000312 3300005458 Bacteria 39403
48 Ga0070681_10001236 3300005458 Bacteria 22239
49 Ga0070685_10053919 3300005466 Bacteria 2331
50 Ga0070706_100030220 3300005467 Bacteria 4991
51 Ga0070707_100138808 3300005468 Bacteria 2365
52 Ga0070707_100323428 3300005468 Bacteria 1499
53 Ga0070698_100002654 3300005471 Bacteria 19722
54 Ga0070698_100005533 3300005471 Bacteria 13803
55 Ga0070698_100069573 3300005471 Bacteria 3533
56 Ga0070699_100051399 3300005518 Bacteria 3567
57 Ga0070679_100000278 3300005530 Bacteria 43146
58 Ga0070679_100026701 3300005530 Bacteria 5677
59 Ga0070697_100001300 3300005536 Bacteria 18815
60 Ga0070697_100011493 3300005536 Bacteria 6921
61 Ga0068853_100012169 3300005539 Bacteria 6998
62 Ga0068853_100111188 3300005539 Bacteria 2434
63 Ga0070672_100078823 3300005543 Bacteria 2636
64 Ga0070686_100026337 3300005544 Unclassified 3510
65 Ga0070686_100208195 3300005544 Bacteria 1406
66 Ga0070695_100048455 3300005545 Bacteria 2717
67 Ga0070695_100069725 3300005545 Bacteria 2298
68 Ga0070695_100147369 3300005545 Bacteria 1639
69 Ga0070696_100100136 3300005546 Bacteria 2075
70 Ga0070704_100018467 3300005549 Bacteria 4461
71 Ga0070704_100118636 3300005549 Unclassified 2027
72 Ga0070704_100278657 3300005549 Bacteria 1384
73 Ga0070704_100327514 3300005549 Bacteria 1286
74 Ga0068855_100251392 3300005563 Bacteria 1972
75 Ga0070664_100000569 3300005564 Bacteria 28150
76 Ga0070664_100103065 3300005564 Bacteria 2484
77 Ga0070664_100113557 3300005564 Bacteria 2366
78 Ga0068857_100002916 3300005577 Bacteria 14097
79 Ga0068857_100544182 3300005577 Bacteria 1093
80 Ga0068856_100326323 3300005614 Bacteria 1552
81 Ga0070702_100016497 3300005615 Bacteria 3791
82 Ga0068852_100002276 3300005616 Bacteria 13190
83 Ga0068859_100180563 3300005617 Bacteria 2193
84 Ga0068864_100088192 3300005618 Bacteria 2732
85 Ga0068864_100096497 3300005618 Bacteria 2616
86 Ga0068864_100115792 3300005618 Bacteria 2391
87 Ga0068864_100206370 3300005618 Bacteria 1807
88 Ga0068861_100083340 3300005719 Bacteria 2508
89 Ga0068870_10155284 3300005840 Unclassified 1352
90 Ga0068870_10170565 3300005840 Unclassified 1298
91 Ga0068863_100008554 3300005841 Bacteria 10002
92 Ga0068863_100014194 3300005841 Bacteria 7673
93 Ga0068858_100136337 3300005842 Unclassified 2303
94 Ga0068858_100143117 3300005842 Bacteria 2245
95 Ga0068858_100178885 3300005842 Bacteria 2002
96 Ga0068860_100021158 3300005843 Bacteria 6300
97 Ga0068860_100079457 3300005843 Bacteria 3119
98 Ga0068860_100374337 3300005843 Unclassified 1405
99 Ga0068862_100041350 3300005844 Bacteria 3921
100 Ga0075365_10133843 3300006038 Bacteria 1717
101 Ga0075364_10073383 3300006051 Bacteria 2255
102 Ga0075367_10042100 3300006178 Bacteria 2672
103 Ga0068871_100071041 3300006358 Bacteria 2862
104 Ga0075428_100173599 3300006844 Bacteria 2335
105 Ga0075430_100019870 3300006846 Bacteria 5715
106 Ga0075431_100166927 3300006847 Bacteria 2263
107 Ga0075431_100178268 3300006847 Bacteria 2181
108 Ga0075433_10009372 3300006852 Bacteria 7823
109 Ga0097620_100180559 3300006931 Bacteria 2193
110 Ga0075435_100004808 3300007076 Bacteria 9342
111 Ga0111539_10029151 3300009094 Bacteria 6728
112 Ga0111539_10054470 3300009094 Bacteria 4760
113 Ga0105245_10030452 3300009098 Bacteria 4771
114 Ga0114129_10014168 3300009147 Bacteria 11360
115 Ga0114129_10189922 3300009147 Bacteria 2790
116 Ga0114129_10193619 3300009147 Bacteria 2759
117 Ga0105243_10120272 3300009148 Bacteria 2213
118 Ga0105241_10236029 3300009174 Bacteria 1544
119 Ga0105242_10014690 3300009176 Bacteria 6063
120 Ga0105248_10025725 3300009177 Bacteria 6546
121 Ga0105248_10037659 3300009177 Bacteria 5412
122 Ga0105248_10108691 3300009177 Bacteria 3127
123 Ga0105248_10244206 3300009177 Bacteria 2021
124 Ga0105248_10453896 3300009177 Bacteria 1444
125 Ga0105249_10006924 3300009553 Bacteria 9887
126 Ga0105249_10053215 3300009553 Bacteria 3700
127 Ga0105249_10105793 3300009553 Bacteria 2653
128 Ga0157373_10079183 3300013100 Bacteria 2317
129 Ga0157371_10178031 3300013102 Bacteria 1520
130 Ga0157374_10025536 3300013296 Bacteria 5307
131 Ga0157374_10042243 3300013296 Bacteria 4205
132 Ga0157378_10007192 3300013297 Bacteria 9723
133 Ga0157378_10045103 3300013297 Bacteria 3917
134 Ga0157378_10153476 3300013297 Bacteria 2147
135 Ga0157378_10158339 3300013297 Unclassified 2116
136 Ga0163162_10008328 3300013306 Bacteria 10113
137 Ga0163162_10029402 3300013306 Bacteria 5438
138 Ga0163162_10034973 3300013306 Bacteria 5003
139 Ga0163162_10701678 3300013306 Bacteria 1133
140 Ga0157372_10075081 3300013307 Bacteria 3813
141 Ga0157375_10129721 3300013308 Bacteria 2639
142 Ga0157375_10144111 3300013308 Bacteria 2512
143 Ga0157375_10627939 3300013308 Bacteria 1232
144 Ga0163163_10007367 3300014325 Bacteria 9709
145 Ga0163163_10014227 3300014325 Bacteria 7310
146 Ga0163163_10023353 3300014325 Bacteria 5867
147 Ga0163163_10059390 3300014325 Bacteria 3783
148 Ga0163163_10060349 3300014325 Bacteria 3755
149 Ga0163163_10191461 3300014325 Bacteria 2094
150 Ga0157380_10008249 3300014326 Bacteria 7422
151 Ga0157380_10016213 3300014326 Bacteria 5491
152 Ga0157380_10102816 3300014326 Unclassified 2383
153 Ga0157377_10010643 3300014745 Bacteria 4558
154 Ga0157376_10037684 3300014969 Unclassified 3928
155 Ga0157376_10051223 3300014969 Unclassified 3429
156 Ga0157376_10103590 3300014969 Bacteria 2492
157 Ga0157376_10144794 3300014969 Unclassified 2136
158 Ga0163161_10122479 3300017792 Bacteria 1955
159 Ga0213873_10004337 3300021358 Bacteria 2638
160 Ga0213874_10058012 3300021377 Unclassified 1206
161 Ga0213876_10105457 3300021384 Unclassified 1495
162 Ga0213875_10000187 3300021388 Bacteria 63247
163 Ga0207697_10075227 3300025315 Bacteria 1419
164 Ga0207642_10103660 3300025899 Bacteria 1434
165 Ga0207684_10029268 3300025910 Bacteria 4692
166 Ga0207684_10033451 3300025910 Bacteria 4371
167 Ga0207707_10000024 3300025912 Bacteria 183501
168 Ga0207707_10037350 3300025912 Bacteria 4245
169 Ga0207660_10044207 3300025917 Bacteria 3133
170 Ga0207662_10004873 3300025918 Bacteria 7098
171 Ga0207662_10007236 3300025918 Bacteria 6036
172 Ga0207652_10000189 3300025921 Bacteria 64976
173 Ga0207652_10047681 3300025921 Bacteria 3660
174 Ga0207646_10159044 3300025922 Bacteria 2038
175 Ga0207646_10439218 3300025922 Bacteria 1178
176 Ga0207650_10358391 3300025925 Bacteria 1201
177 Ga0207644_10004719 3300025931 Bacteria 8852
178 Ga0207644_10051491 3300025931 Bacteria 2956
179 Ga0207644_10101635 3300025931 Bacteria 2161
180 Ga0207644_10254971 3300025931 Bacteria 1401
181 Ga0207690_10027374 3300025932 Bacteria 3602
182 Ga0207690_10316246 3300025932 Bacteria 1226
183 Ga0207706_10098923 3300025933 Bacteria 2566
184 Ga0207706_10335992 3300025933 Bacteria 1314
185 Ga0207669_10034234 3300025937 Bacteria 2876
186 Ga0207691_10014189 3300025940 Bacteria 7602
187 Ga0207691_10068734 3300025940 Bacteria 3200
188 Ga0207711_10098471 3300025941 Bacteria 2584
189 Ga0207689_10003521 3300025942 Bacteria 14303
190 Ga0207689_10006777 3300025942 Bacteria 10081
191 Ga0207689_10025821 3300025942 Unclassified 4921
192 Ga0207689_10082519 3300025942 Bacteria 2643
193 Ga0207689_10128160 3300025942 Bacteria 2087
194 Ga0207661_10272131 3300025944 Bacteria 1512
195 Ga0207661_10358854 3300025944 Bacteria 1316
196 Ga0207679_10253481 3300025945 Bacteria 1497
197 Ga0207651_10120442 3300025960 Bacteria 1989
198 Ga0207658_10090345 3300025986 Bacteria 2373
199 Ga0207703_10134920 3300026035 Bacteria 2136
200 Ga0207703_10185673 3300026035 Bacteria 1838
201 Ga0207639_10317068 3300026041 Bacteria 1383
202 Ga0207678_10115933 3300026067 Bacteria 2286
203 Ga0207708_10009234 3300026075 Bacteria 7299
204 Ga0207708_10035530 3300026075 Bacteria 3792
205 Ga0207708_10144346 3300026075 Bacteria 1870
206 Ga0207708_10171587 3300026075 Bacteria 1718
207 Ga0207702_10068286 3300026078 Bacteria 3053
208 Ga0207648_10183034 3300026089 Bacteria 1855
209 Ga0207676_10088417 3300026095 Bacteria 2536
210 Ga0207676_10294407 3300026095 Bacteria 1479
211 Ga0207676_10300740 3300026095 Bacteria 1465
212 Ga0207676_10348180 3300026095 Bacteria 1369
213 Ga0207674_10001516 3300026116 Bacteria 29946
214 Ga0207675_100037214 3300026118 Bacteria 4540
215 Ga0207675_100045738 3300026118 Bacteria 4089
216 Ga0207683_10021879 3300026121 Bacteria 5484
217 Ga0207698_10005166 3300026142 Bacteria 8025
218 Ga0209998_10015616 3300027717 Bacteria 1592
219 Ga0268266_10062750 3300028379 Bacteria 3208
220 Ga0268266_10204370 3300028379 Bacteria 1809
221 Ga0268266_10451938 3300028379 Unclassified 1221
222 Ga0268265_10028180 3300028380 Bacteria 4019
223 Ga0268265_10195641 3300028380 Bacteria 1750
224 Ga0268264_10124668 3300028381 Unclassified 2275
225 Ga0268264_10194833 3300028381 Bacteria 1850
226 Ga0268264_10251581 3300028381 Bacteria 1642
227 Ga0265320_10003652 3300031240 Bacteria 10271
228 Ga0265325_10012269 3300031241 Bacteria 4903
229 Ga0265340_10003681 3300031247 Bacteria 8628
230 Ga0265316_10008798 3300031344 Bacteria 9329
231 Ga0265316_10104867 3300031344 Bacteria 2145
232 Ga0265314_10158167 3300031711 Unclassified 1382
233 Ga0265342_10057229 3300031712 Bacteria 2308
234 Ga0307413_10169322 3300031824 Bacteria 1544
235 Ga0307406_10079651 3300031901 Bacteria 2173
236 Ga0307411_10119624 3300032005 Bacteria 1903
237 Ga0373935_0218074 3300035692 Bacteria 1324
238 Ga0373937_0081844 3300036401 Bacteria 2987
239 Ga0373925_0162147 3300037068 Bacteria 1762
240 Ga0395899_0085418 3300037312 Bacteria 2293
241 Ga0395900_0018134 3300037418 Bacteria 7183
242 Ga0395898_0254184 3300037466 Bacteria 1676
243 Ga0395905_0000578 3300037471 Bacteria 49378
244 Ga0436364_0190332 3300037853 Bacteria 74125
245 Ga0436364_0695971 3300037853 Bacteria 2977
246 Ga0436365_1479385 3300039437 Bacteria 2514
247 Ga0436360_1001386 3300039438 Bacteria 7806
248 Ga0436361_0008093 3300039447 Bacteria 2887
249 Ga0436363_0795140 3300039450 Bacteria 4986
250 Ga0436362_0218689 3300039453 Unclassified 1958
251 Ga0436362_1301880 3300039453 Bacteria 11836
252 Ga0450923_004156 3300042125 Bacteria 2254
253 Ga0450896_000041 3300042133 Bacteria 7706
254 Ga0439435_0004899 3300042436 Bacteria 2911
255 Ga0450918_010947 3300042531 Bacteria 1582
256 Ga0495638_0003545 3300046460 Bacteria 12228
257 Ga0495663_0000121 3300046525 Bacteria 32576
258 Ga0495598_0000110 3300046537 Bacteria 13597
259 Ga0495621_0015271 3300046539 Bacteria 2446
260 Ga0495636_0050062 3300047318 Bacteria 1748
261 Ga0495672_0007969 3300047320 Bacteria 7896
262 Ga0496101_0043251 3300048904 Bacteria 3219
263 Ga0496102_0079339 3300048905 Unclassified 3023
264 Ga0496104_0039566 3300048907 Bacteria 4415
265 Ga0496104_0400986 3300048907 Bacteria 1284
266 Ga0496105_0201633 3300048908 Bacteria 1624
267 Ga0496105_0251036 3300048908 Bacteria 1433
268 Ga0496106_0058277 3300048909 Bacteria 2924
269 Ga0496108_0179609 3300048911 Bacteria 1832
270 Ga0496110_0087976 3300048913 Bacteria 2774
271 Ga0496111_0043185 3300048914 Bacteria 3240
272 Ga0496112_0013500 3300048915 Bacteria 7544
273 Ga0501036_0052756 3300049572 Bacteria 3444
274 Ga0501038_0126146 3300049574 Unclassified 2106
275 Ga0501048_0259392 3300049582 Bacteria 1235
276 Ga0501072_0013439 3300049588 Bacteria 6267
277 Ga0501076_0034756 3300049592 Bacteria 3942
278 Ga0501076_0061251 3300049592 Bacteria 2995
279 Ga0501079_0071654 3300049741 Bacteria 2678
280 nmdc:mga00v17_124502_c1 3300050491 Bacteria 1644
281 nmdc:mga0yw44_10307_c1 3300050492 Bacteria 4767
282 nmdc:mga06z11_66261_c1 3300050494 Bacteria 1898
283 nmdc:mga05p37_326750_c1 3300050507 Bacteria 1813
284 nmdc:mga05p37_44134_c1 3300050507 Bacteria 5485
285 nmdc:mga0qj67_15815_c1 3300050509 Bacteria 5714
286 nmdc:mga06r32_148852_c1 3300050510 Bacteria 2319
287 nmdc:mga06r32_27025_c1 3300050510 Bacteria 5357
288 nmdc:mga06r32_33687_c1 3300050510 Bacteria 4825
289 nmdc:mga08y16_281541_c1 3300050511 Bacteria 1715
290 nmdc:mga0rr50_184413_c1 3300050513 Bacteria 1707
291 Ga0500568_0005453 3300053139 Bacteria 6569
292 Ga0500568_0017505 3300053139 Bacteria 3163
293 Ga0500568_0027366 3300053139 Bacteria 2385
294 Ga0105237_10011487
295 MBSR1b_contig_11670305
296 JGI24738J21930_10002077
297 Ga0065704_10084325
298 Ga0065712_10000531
299 Ga0065712_10131134
300 Ga0065712_10133135
301 Ga0065715_10008249
302 Ga0065715_10091472
303 Ga0065715_10103311
304 Ga0065715_10179350
305 Ga0065707_10019625
306 Ga0070683_100413053
307 Ga0070690_100000469
308 Ga0070690_100002076
309 Ga0070690_100123044
310 Ga0070670_100015602
311 Ga0070670_100093497
312 Ga0068869_100002444
313 Ga0068869_100027490
314 Ga0068869_100097379
315 Ga0070666_10042255
316 Ga0070666_10072477
317 Ga0070680_100001249
318 Ga0070680_100011568
319 Ga0070682_100000098
320 Ga0068868_100011274
321 Ga0070660_100051152
322 Ga0070687_100077090
323 Ga0070669_100006904
324 Ga0070669_100084098
325 Ga0070675_100275084
326 Ga0070673_100220683
327 Ga0070673_100233015
328 Ga0070659_100013675
329 Ga0070667_100099453
330 Ga0070667_100399250
331 Ga0070701_10041504
332 Ga0070701_10208518
333 Ga0070700_100104783
334 Ga0070700_100208629
335 Ga0070694_100006330
336 Ga0070694_100207278
337 Ga0070708_100002474
338 Ga0070678_100011986
339 Ga0070662_100072673
340 Ga0070681_10000312
341 Ga0070681_10001236
342 Ga0070685_10053919
343 Ga0070706_100030220
344 Ga0070707_100138808
345 Ga0070707_100323428
346 Ga0070698_100002654
347 Ga0070698_100005533
348 Ga0070698_100069573
349 Ga0070699_100051399
350 Ga0070679_100000278
351 Ga0070679_100026701
352 Ga0070697_100001300
353 Ga0070697_100011493
354 Ga0068853_100012169
355 Ga0068853_100111188
356 Ga0070672_100078823
357 Ga0070686_100026337
358 Ga0070686_100208195
359 Ga0070695_100048455
360 Ga0070695_100069725
361 Ga0070695_100147369
362 Ga0070696_100100136
363 Ga0070704_100018467
364 Ga0070704_100118636
365 Ga0070704_100278657
366 Ga0070704_100327514
367 Ga0068855_100251392
368 Ga0070664_100000569
369 Ga0070664_100103065
370 Ga0070664_100113557
371 Ga0068857_100002916
372 Ga0068857_100544182
373 Ga0068856_100326323
374 Ga0070702_100016497
375 Ga0068852_100002276
376 Ga0068859_100180563
377 Ga0068864_100088192
378 Ga0068864_100096497
379 Ga0068864_100115792
380 Ga0068864_100206370
381 Ga0068861_100083340
382 Ga0068870_10155284
383 Ga0068870_10170565
384 Ga0068863_100008554
385 Ga0068863_100014194
386 Ga0068858_100136337
387 Ga0068858_100143117
388 Ga0068858_100178885
389 Ga0068860_100021158
390 Ga0068860_100079457
391 Ga0068860_100374337
392 Ga0068862_100041350
393 Ga0075365_10133843
394 Ga0075364_10073383
395 Ga0075367_10042100
396 Ga0068871_100071041
397 Ga0075428_100173599
398 Ga0075430_100019870
399 Ga0075431_100166927
400 Ga0075431_100178268
401 Ga0075433_10009372
402 Ga0097620_100180559
403 Ga0075435_100004808
404 Ga0111539_10029151
405 Ga0111539_10054470
406 Ga0105245_10030452
407 Ga0114129_10014168
408 Ga0114129_10189922
409 Ga0114129_10193619
410 Ga0105243_10120272
411 Ga0105241_10236029
412 Ga0105242_10014690
413 Ga0105248_10025725
414 Ga0105248_10037659
415 Ga0105248_10108691
416 Ga0105248_10244206
417 Ga0105248_10453896
418 Ga0105249_10006924
419 Ga0105249_10053215
420 Ga0105249_10105793
421 Ga0157373_10079183
422 Ga0157371_10178031
423 Ga0157374_10025536
424 Ga0157374_10042243
425 Ga0157378_10007192
426 Ga0157378_10045103
427 Ga0157378_10153476
428 Ga0157378_10158339
429 Ga0163162_10008328
430 Ga0163162_10029402
431 Ga0163162_10034973
432 Ga0163162_10701678
433 Ga0157372_10075081
434 Ga0157375_10129721
435 Ga0157375_10144111
436 Ga0157375_10627939
437 Ga0163163_10007367
438 Ga0163163_10014227
439 Ga0163163_10023353
440 Ga0163163_10059390
441 Ga0163163_10060349
442 Ga0163163_10191461
443 Ga0157380_10008249
444 Ga0157380_10016213
445 Ga0157380_10102816
446 Ga0157377_10010643
447 Ga0157376_10037684
448 Ga0157376_10051223
449 Ga0157376_10103590
450 Ga0157376_10144794
451 Ga0163161_10122479
452 Ga0213873_10004337
453 Ga0213874_10058012
454 Ga0213876_10105457
455 Ga0213875_10000187
456 Ga0207697_10075227
457 Ga0207642_10103660
458 Ga0207684_10029268
459 Ga0207684_10033451
460 Ga0207707_10000024
461 Ga0207707_10037350
462 Ga0207660_10044207
463 Ga0207662_10004873
464 Ga0207662_10007236
465 Ga0207652_10000189
466 Ga0207652_10047681
467 Ga0207646_10159044
468 Ga0207646_10439218
469 Ga0207650_10358391
470 Ga0207644_10004719
471 Ga0207644_10051491
472 Ga0207644_10101635
473 Ga0207644_10254971
474 Ga0207690_10027374
475 Ga0207690_10316246
476 Ga0207706_10098923
477 Ga0207706_10335992
478 Ga0207669_10034234
479 Ga0207691_10014189
480 Ga0207691_10068734
481 Ga0207711_10098471
482 Ga0207689_10003521
483 Ga0207689_10006777
484 Ga0207689_10025821
485 Ga0207689_10082519
486 Ga0207689_10128160
487 Ga0207661_10272131
488 Ga0207661_10358854
489 Ga0207679_10253481
490 Ga0207651_10120442
491 Ga0207658_10090345
492 Ga0207703_10134920
493 Ga0207703_10185673
494 Ga0207639_10317068
495 Ga0207678_10115933
496 Ga0207708_10009234
497 Ga0207708_10035530
498 Ga0207708_10144346
499 Ga0207708_10171587
500 Ga0207702_10068286
501 Ga0207648_10183034
502 Ga0207676_10088417
503 Ga0207676_10294407
504 Ga0207676_10300740
505 Ga0207676_10348180
506 Ga0207674_10001516
507 Ga0207675_100037214
508 Ga0207675_100045738
509 Ga0207683_10021879
510 Ga0207698_10005166
511 Ga0209998_10015616
512 Ga0268266_10062750
513 Ga0268266_10204370
514 Ga0268266_10451938
515 Ga0268265_10028180
516 Ga0268265_10195641
517 Ga0268264_10124668
518 Ga0268264_10194833
519 Ga0268264_10251581
520 Ga0265320_10003652
521 Ga0265325_10012269
522 Ga0265340_10003681
523 Ga0265316_10008798
524 Ga0265316_10104867
525 Ga0265314_10158167
526 Ga0265342_10057229
527 Ga0307413_10169322
528 Ga0307406_10079651
529 Ga0307411_10119624
530 Ga0373935_0218074
531 Ga0373937_0081844
532 Ga0373925_0162147
533 Ga0395899_0085418
534 Ga0395900_0018134
535 Ga0395898_0254184
536 Ga0395905_0000578
537 Ga0436364_0190332
538 Ga0436364_0695971
539 Ga0436365_1479385
540 Ga0436360_1001386
541 Ga0436361_0008093
542 Ga0436363_0795140
543 Ga0436362_0218689
544 Ga0436362_1301880
545 Ga0450923_004156
546 Ga0450896_000041
547 Ga0439435_0004899
548 Ga0450918_010947
549 Ga0495638_0003545
550 Ga0495663_0000121
551 Ga0495598_0000110
552 Ga0495621_0015271
553 Ga0495636_0050062
554 Ga0495672_0007969
555 Ga0496101_0043251
556 Ga0496102_0079339
557 Ga0496104_0039566
558 Ga0496104_0400986
559 Ga0496105_0201633
560 Ga0496105_0251036
561 Ga0496106_0058277
562 Ga0496108_0179609
563 Ga0496110_0087976
564 Ga0496111_0043185
565 Ga0496112_0013500
566 Ga0501036_0052756
567 Ga0501038_0126146
568 Ga0501048_0259392
569 Ga0501072_0013439
570 Ga0501076_0034756
571 Ga0501076_0061251
572 Ga0501079_0071654
573 nmdc:mga00v17_124502_c1
574 nmdc:mga0yw44_10307_c1
575 nmdc:mga06z11_66261_c1
576 nmdc:mga05p37_326750_c1
577 nmdc:mga05p37_44134_c1
578 nmdc:mga0qj67_15815_c1
579 nmdc:mga06r32_148852_c1
580 nmdc:mga06r32_27025_c1
581 nmdc:mga06r32_33687_c1
582 nmdc:mga08y16_281541_c1
583 nmdc:mga0rr50_184413_c1
584 Ga0500568_0005453
585 Ga0500568_0017505
586 Ga0500568_0027366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

96

296

0.9

PF09084

NMT1

NMT1/THI5 like

104

289

0.89

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

79

285

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.913 45 331
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.9061 45 331
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8825 45 331
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8421 47 285
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8301 47 329
ID Description Score Start End Superfamily
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9082 127 221 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8879 124 218 3.40.190.10
3un6A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8779 45 331 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8564 126 216 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8551 127 226 3.40.190.10
ID Description Score Start End GO Terms
AF-Q1NWP1-F1-model_v4 deleted 0.9512 45 331
AF-A0A329ZQ37-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9501 47 332 GO:0005886
GO:0012505
AF-A0A2H0ULZ4-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9429 47 331 GO:0005886
GO:0012505
AF-B8DNS0-F1-model_v4 RNA polymerase, sigma-24 subunit, ECF subfamily 0.9398 48 335 GO:0003677
GO:0006352
GO:0016987
AF-A0A533ZAA0-F1-model_v4 ABC transporter substrate-binding protein 0.9395 47 272 GO:0005886
GO:0012505

Map