F391409

General Info

Members Datasets Scaffolds Average Seq Length
293 148 586 223

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100045386|Ga0068859_1000453862
Length 259
Sequence VWVLLYHVRRRELMLKMTNLSAWSNHNICGSAPNDSAPASRASLTAERRSEAGYTLVALLALMTVLATFAMAIAPSAQQQALREKEKEAIFRGEEVADAIRMYYRYRSGVLQQRGDAALPSSMDQLLQGIPIPGGSKNLQILRPSAARDPLTIEGEWRFIRPRGEALVDFQQSVMFYANNILPQPRDPQILQLQQFAVPPIVPLTNLGSQAPRPSSNSADEDSSGPFVGVASRSDRASVLTFYGIDHHNQWIFTPLFRN

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100045386 3300005617 Bacteria 4415
2 MBSR1b_contig_5061362 2162886012 Bacteria 1358
3 JGI24751J29686_10000003 3300002459 Bacteria 157815
4 rootL2_10136525 3300003322 Unclassified 4433
5 Ga0065704_10117316 3300005289 Bacteria 1836
6 Ga0065712_10000623 3300005290 Bacteria 10100
7 Ga0065712_10067727 3300005290 Bacteria 189643
8 Ga0065715_10091901 3300005293 Bacteria 5474
9 Ga0065715_10092540 3300005293 Bacteria 5065
10 Ga0065715_10102388 3300005293 Bacteria 3117
11 Ga0065715_10356486 3300005293 Unclassified 942
12 Ga0065707_10105647 3300005295 Bacteria 2635
13 Ga0065707_10130753 3300005295 Unclassified 1924
14 Ga0065707_10149546 3300005295 Bacteria 1674
15 Ga0070690_100002542 3300005330 Bacteria 9819
16 Ga0070690_100104385 3300005330 Bacteria 1883
17 Ga0070670_100000167 3300005331 Bacteria 59452
18 Ga0070670_100022710 3300005331 Bacteria 5398
19 Ga0070670_100049557 3300005331 Bacteria 3611
20 Ga0070670_100062553 3300005331 Bacteria 3195
21 Ga0070677_10051806 3300005333 Bacteria 1663
22 Ga0068869_100065236 3300005334 Bacteria 2680
23 Ga0070680_100042738 3300005336 Bacteria 3679
24 Ga0070682_100000091 3300005337 Bacteria 82460
25 Ga0070682_100005463 3300005337 Bacteria 7076
26 Ga0070682_100034284 3300005337 Unclassified 3090
27 Ga0070660_100011513 3300005339 Bacteria 6292
28 Ga0070689_100001217 3300005340 Bacteria 16325
29 Ga0070689_100280356 3300005340 Unclassified 1382
30 Ga0070687_100010910 3300005343 Bacteria 3953
31 Ga0070687_100015803 3300005343 Unclassified 3422
32 Ga0070687_100313869 3300005343 Unclassified 999
33 Ga0070661_100028431 3300005344 Bacteria 4033
34 Ga0070692_10010811 3300005345 Bacteria 4171
35 Ga0070692_10010891 3300005345 Bacteria 4158
36 Ga0070692_10035158 3300005345 Bacteria 2535
37 Ga0070669_100016861 3300005353 Bacteria 5214
38 Ga0070669_100138686 3300005353 Bacteria 1873
39 Ga0070675_100205879 3300005354 Bacteria 1709
40 Ga0070675_100373334 3300005354 Bacteria 1268
41 Ga0070673_100085438 3300005364 Bacteria 2569
42 Ga0070673_100153367 3300005364 Bacteria 1953
43 Ga0070659_100000353 3300005366 Bacteria 35063
44 Ga0070659_100065409 3300005366 Bacteria 2880
45 Ga0070659_100763174 3300005366 Unclassified 839
46 Ga0070703_10002350 3300005406 Bacteria 5456
47 Ga0070701_10078766 3300005438 Bacteria 1779
48 Ga0070705_100004677 3300005440 Bacteria 6666
49 Ga0070705_100013837 3300005440 Bacteria 4135
50 Ga0070705_100277298 3300005440 Bacteria 1190
51 Ga0070700_100000426 3300005441 Bacteria 21450
52 Ga0070700_100001438 3300005441 Bacteria 11845
53 Ga0070700_100014770 3300005441 Unclassified 4413
54 Ga0070694_100001257 3300005444 Bacteria 14712
55 Ga0070708_100280160 3300005445 Unclassified 1569
56 Ga0070681_10002024 3300005458 Bacteria 18349
57 Ga0070681_10101861 3300005458 Bacteria 2817
58 Ga0068867_100042776 3300005459 Bacteria 3316
59 Ga0068867_100112933 3300005459 Bacteria 2090
60 Ga0068867_100338034 3300005459 Bacteria 1253
61 Ga0070706_100000053 3300005467 Bacteria 139565
62 Ga0070698_100011764 3300005471 Bacteria 9282
63 Ga0070699_100476201 3300005518 Bacteria 1133
64 Ga0070679_100012328 3300005530 Bacteria 8165
65 Ga0070697_100055231 3300005536 Unclassified 3229
66 Ga0068853_100037262 3300005539 Bacteria 4138
67 Ga0068853_100233324 3300005539 Bacteria 1684
68 Ga0070672_100085084 3300005543 Bacteria 2541
69 Ga0070686_100010930 3300005544 Bacteria 5139
70 Ga0070695_100006567 3300005545 Bacteria 6872
71 Ga0070695_100181761 3300005545 Bacteria 1491
72 Ga0070696_100022672 3300005546 Unclassified 4267
73 Ga0070693_100002023 3300005547 Bacteria 9271
74 Ga0070693_100005220 3300005547 Bacteria 6215
75 Ga0070693_100016114 3300005547 Bacteria 3862
76 Ga0070704_100081647 3300005549 Bacteria 2382
77 Ga0070704_100139214 3300005549 Bacteria 1892
78 Ga0070704_100472396 3300005549 Unclassified 1084
79 Ga0068855_100167705 3300005563 Bacteria 2488
80 Ga0070664_100000399 3300005564 Bacteria 32416
81 Ga0070664_100278667 3300005564 Bacteria 1507
82 Ga0068857_100000175 3300005577 Bacteria 40688
83 Ga0068854_100252517 3300005578 Bacteria 1409
84 Ga0068854_100397266 3300005578 Bacteria 1140
85 Ga0068854_100539325 3300005578 Unclassified 988
86 Ga0068854_100651511 3300005578 Unclassified 904
87 Ga0070702_100011146 3300005615 Bacteria 4462
88 Ga0068859_100019628 3300005617 Bacteria 6790
89 Ga0068859_100042881 3300005617 Bacteria 4545
90 Ga0068859_100098019 3300005617 Bacteria 2985
91 Ga0068859_100134066 3300005617 Bacteria 2548
92 Ga0068859_100399439 3300005617 Bacteria 1470
93 Ga0068859_100589144 3300005617 Bacteria 1205
94 Ga0068859_100619732 3300005617 Bacteria 1175
95 Ga0068864_100002219 3300005618 Bacteria 16048
96 Ga0068864_100033293 3300005618 Bacteria 4381
97 Ga0068864_100284445 3300005618 Bacteria 1544
98 Ga0068864_100419685 3300005618 Bacteria 1275
99 Ga0068861_100005082 3300005719 Bacteria 8875
100 Ga0068861_100031747 3300005719 Bacteria 3883
101 Ga0068861_100575264 3300005719 Bacteria 1030
102 Ga0068851_10004961 3300005834 Bacteria 6027
103 Ga0068870_10004439 3300005840 Bacteria 6043
104 Ga0068870_10040524 3300005840 Unclassified 2415
105 Ga0068863_100428398 3300005841 Bacteria 1297
106 Ga0068863_100450036 3300005841 Bacteria 1264
107 Ga0068858_100230859 3300005842 Bacteria 1754
108 Ga0068860_100022239 3300005843 Bacteria 6138
109 Ga0068860_100074481 3300005843 Bacteria 3229
110 Ga0068860_100081947 3300005843 Bacteria 3069
111 Ga0068860_100232888 3300005843 Bacteria 1790
112 Ga0068860_100332087 3300005843 Bacteria 1493
113 Ga0068860_100452017 3300005843 Unclassified 1277
114 Ga0068860_100452672 3300005843 Bacteria 1276
115 Ga0068862_100031654 3300005844 Bacteria 4468
116 Ga0068862_100356738 3300005844 Bacteria 1358
117 Ga0081539_10004345 3300005985 Bacteria 15801
118 Ga0097621_100013987 3300006237 Bacteria 5994
119 Ga0097621_100034771 3300006237 Bacteria 4022
120 Ga0068871_100016243 3300006358 Bacteria 5600
121 Ga0075430_100056179 3300006846 Unclassified 3309
122 Ga0075431_100013308 3300006847 Bacteria 8314
123 Ga0075433_10034751 3300006852 Bacteria 4331
124 Ga0075433_10426217 3300006852 Bacteria 1170
125 Ga0075434_100036967 3300006871 Bacteria 4831
126 Ga0075434_100128936 3300006871 Bacteria 2547
127 Ga0075429_100088152 3300006880 Bacteria 2705
128 Ga0075429_100283508 3300006880 Bacteria 1451
129 Ga0097620_100019627 3300006931 Bacteria 6790
130 Ga0097620_100042881 3300006931 Bacteria 4545
131 Ga0097620_100045387 3300006931 Bacteria 4415
132 Ga0097620_100098015 3300006931 Bacteria 2985
133 Ga0097620_100134066 3300006931 Bacteria 2548
134 Ga0097620_100142264 3300006931 Bacteria 2472
135 Ga0097620_100170733 3300006931 Bacteria 2255
136 Ga0097620_100399431 3300006931 Bacteria 1470
137 Ga0097620_100589109 3300006931 Bacteria 1205
138 Ga0097620_100619704 3300006931 Bacteria 1175
139 Ga0075435_100083542 3300007076 Bacteria 2626
140 Ga0111539_10007213 3300009094 Bacteria 14247
141 Ga0111539_10048092 3300009094 Bacteria 5094
142 Ga0111539_10074537 3300009094 Bacteria 3998
143 Ga0111539_10136360 3300009094 Bacteria 2874
144 Ga0111539_10254759 3300009094 Bacteria 2044
145 Ga0111539_10302900 3300009094 Bacteria 1860
146 Ga0105247_10011339 3300009101 Bacteria 5377
147 Ga0105247_10020413 3300009101 Bacteria 3983
148 Ga0114129_10050668 3300009147 Bacteria 5832
149 Ga0105241_10162551 3300009174 Bacteria 1837
150 Ga0105242_10052343 3300009176 Bacteria 3331
151 Ga0105242_11011154 3300009176 Unclassified 840
152 Ga0105248_10034850 3300009177 Bacteria 5632
153 Ga0105248_10046226 3300009177 Bacteria 4879
154 Ga0105248_10123159 3300009177 Bacteria 2925
155 Ga0105248_10159667 3300009177 Bacteria 2543
156 Ga0105248_10235811 3300009177 Bacteria 2060
157 Ga0105237_10158255 3300009545 Bacteria 2263
158 Ga0105249_10031483 3300009553 Bacteria 4798
159 Ga0105249_10084165 3300009553 Bacteria 2962
160 Ga0105239_10300988 3300010375 Bacteria 1806
161 Ga0157373_10003994 3300013100 Bacteria 11124
162 Ga0157374_10142578 3300013296 Bacteria 2326
163 Ga0157378_10064546 3300013297 Bacteria 3276
164 Ga0157378_10073974 3300013297 Bacteria 3065
165 Ga0157378_10311879 3300013297 Bacteria 1526
166 Ga0157378_10374506 3300013297 Unclassified 1397
167 Ga0163162_10001664 3300013306 Bacteria 20846
168 Ga0163162_10170537 3300013306 Bacteria 2301
169 Ga0163162_10498112 3300013306 Bacteria 1349
170 Ga0157372_10179667 3300013307 Bacteria 2449
171 Ga0157375_10018495 3300013308 Bacteria 6321
172 Ga0157375_10274192 3300013308 Bacteria 1849
173 Ga0157375_10466936 3300013308 Bacteria 1427
174 Ga0163163_10000298 3300014325 Bacteria 49128
175 Ga0163163_10003237 3300014325 Bacteria 13805
176 Ga0163163_10089046 3300014325 Bacteria 3098
177 Ga0163163_10163321 3300014325 Bacteria 2273
178 Ga0157380_10395502 3300014326 Unclassified 1309
179 Ga0157377_10162120 3300014745 Unclassified 1392
180 Ga0157379_10163467 3300014968 Bacteria 2009
181 Ga0157379_10367911 3300014968 Bacteria 1318
182 Ga0163161_10045474 3300017792 Bacteria 3166
183 Ga0207656_10015904 3300025321 Bacteria 2920
184 Ga0207653_10000868 3300025885 Bacteria 10039
185 Ga0207682_10034786 3300025893 Bacteria 2033
186 Ga0207710_10015536 3300025900 Bacteria 3219
187 Ga0207710_10179580 3300025900 Bacteria 1038
188 Ga0207647_10001353 3300025904 Bacteria 18823
189 Ga0207647_10043960 3300025904 Bacteria 2793
190 Ga0207643_10000812 3300025908 Bacteria 18974
191 Ga0207684_10000053 3300025910 Bacteria 225260
192 Ga0207654_10096018 3300025911 Bacteria 1817
193 Ga0207654_10379563 3300025911 Unclassified 979
194 Ga0207707_10009569 3300025912 Bacteria 8408
195 Ga0207707_10736808 3300025912 Bacteria 825
196 Ga0207671_10002611 3300025914 Bacteria 19019
197 Ga0207671_10286814 3300025914 Bacteria 1299
198 Ga0207660_10090209 3300025917 Bacteria 2270
199 Ga0207662_10003610 3300025918 Bacteria 7996
200 Ga0207657_10047897 3300025919 Bacteria 3733
201 Ga0207649_10096868 3300025920 Bacteria 1944
202 Ga0207652_10186482 3300025921 Bacteria 1865
203 Ga0207681_10024238 3300025923 Bacteria 3893
204 Ga0207694_10016418 3300025924 Bacteria 5590
205 Ga0207650_10000007 3300025925 Bacteria 530810
206 Ga0207650_10060686 3300025925 Bacteria 2822
207 Ga0207650_10122328 3300025925 Bacteria 2028
208 Ga0207650_10156893 3300025925 Unclassified 1800
209 Ga0207690_10001726 3300025932 Bacteria 13434
210 Ga0207690_10036686 3300025932 Bacteria 3176
211 Ga0207690_10689940 3300025932 Unclassified 839
212 Ga0207706_10097389 3300025933 Unclassified 2587
213 Ga0207706_10200050 3300025933 Bacteria 1752
214 Ga0207686_10066986 3300025934 Bacteria 2295
215 Ga0207709_10115286 3300025935 Bacteria 1804
216 Ga0207670_10002253 3300025936 Bacteria 10092
217 Ga0207670_10156842 3300025936 Bacteria 1695
218 Ga0207691_10157099 3300025940 Unclassified 1997
219 Ga0207691_10240414 3300025940 Unclassified 1566
220 Ga0207711_10004633 3300025941 Bacteria 11686
221 Ga0207711_10216090 3300025941 Unclassified 1752
222 Ga0207711_10767642 3300025941 Bacteria 898
223 Ga0207689_10073335 3300025942 Bacteria 2812
224 Ga0207689_10076276 3300025942 Bacteria 2756
225 Ga0207689_10384270 3300025942 Unclassified 1169
226 Ga0207679_10007342 3300025945 Bacteria 6987
227 Ga0207679_10275627 3300025945 Bacteria 1440
228 Ga0207667_10416210 3300025949 Unclassified 1368
229 Ga0207651_10055296 3300025960 Bacteria 2725
230 Ga0207651_10353429 3300025960 Bacteria 1238
231 Ga0207712_10049564 3300025961 Unclassified 2927
232 Ga0207712_10088209 3300025961 Bacteria 2277
233 Ga0207640_10290034 3300025981 Bacteria 1290
234 Ga0207640_10354730 3300025981 Bacteria 1179
235 Ga0207703_10096462 3300026035 Unclassified 2497
236 Ga0207703_10159171 3300026035 Bacteria 1976
237 Ga0207703_10590073 3300026035 Bacteria 1050
238 Ga0207639_10050980 3300026041 Bacteria 3145
239 Ga0207708_10001571 3300026075 Bacteria 17065
240 Ga0207708_10020853 3300026075 Bacteria 4944
241 Ga0207708_10046804 3300026075 Bacteria 3294
242 Ga0207708_10066172 3300026075 Bacteria 2763
243 Ga0207708_10209899 3300026075 Unclassified 1556
244 Ga0207641_10027913 3300026088 Bacteria 4662
245 Ga0207641_10205657 3300026088 Bacteria 1818
246 Ga0207641_10444393 3300026088 Bacteria 1252
247 Ga0207641_10671237 3300026088 Bacteria 1019
248 Ga0207648_10016231 3300026089 Bacteria 6814
249 Ga0207648_10182884 3300026089 Bacteria 1855
250 Ga0207648_10202578 3300026089 Bacteria 1760
251 Ga0207648_10353012 3300026089 Unclassified 1326
252 Ga0207676_10002562 3300026095 Bacteria 12971
253 Ga0207676_10022722 3300026095 Bacteria 4615
254 Ga0207676_10313868 3300026095 Unclassified 1436
255 Ga0207676_10479091 3300026095 Bacteria 1178
256 Ga0207674_10000058 3300026116 Bacteria 113012
257 Ga0207674_10022245 3300026116 Bacteria 6812
258 Ga0207674_10177405 3300026116 Bacteria 2083
259 Ga0207674_10594693 3300026116 Bacteria 1069
260 Ga0207675_100088838 3300026118 Bacteria 2903
261 Ga0207675_100094400 3300026118 Unclassified 2814
262 Ga0207675_100212605 3300026118 Bacteria 1861
263 Ga0268265_10167256 3300028380 Unclassified 1875
264 Ga0268265_10928838 3300028380 Bacteria 856
265 Ga0268264_10017237 3300028381 Bacteria 5916
266 Ga0268264_10246357 3300028381 Bacteria 1658
267 Ga0268264_10368741 3300028381 Bacteria 1372
268 Ga0268264_10384178 3300028381 Unclassified 1345
269 Ga0268264_11024255 3300028381 Unclassified 833
270 Ga0307408_100436829 3300031548 Unclassified 1132
271 Ga0307405_10329777 3300031731 Unclassified 1169
272 Ga0307406_10006109 3300031901 Bacteria 6617
273 Ga0307412_10616310 3300031911 Bacteria 921
274 Ga0307409_100085611 3300031995 Bacteria 2563
275 Ga0307416_100012231 3300032002 Bacteria 5769
276 Ga0307416_100171652 3300032002 Unclassified 2020
277 Ga0307411_10132167 3300032005 Unclassified 1826
278 Ga0373932_0020210 3300035112 Bacteria 1744
279 Ga0395901_0201004 3300038443 Bacteria 2089
280 Ga0439448_0032370 3300042005 Bacteria 1664
281 Ga0495610_0030343 3300046512 Bacteria 2835
282 Ga0495663_0000086 3300046525 Bacteria 42201
283 Ga0495598_0003969 3300046537 Bacteria 3175
284 Ga0495621_0001179 3300046539 Bacteria 6751
285 Ga0496106_0128600 3300048909 Bacteria 1985
286 Ga0496108_0366155 3300048911 Bacteria 1258
287 nmdc:mga05p37_301508_c1 3300050507 Bacteria 1903
288 nmdc:mga08y16_112697_c1 3300050511 Bacteria 2831
289 nmdc:mga08y16_2496_c1 3300050511 Bacteria 18913
290 nmdc:mga08y16_716933_c1 3300050511 Bacteria 999
291 nmdc:mga0rr50_12760_c1 3300050513 Bacteria 5445
292 nmdc:mga0a205_141433_c1 3300050515 Bacteria 2306
293 Ga0530510_0182418 3300061734 Unclassified 1557
294 Ga0068859_100045386
295 MBSR1b_contig_5061362
296 JGI24751J29686_10000003
297 rootL2_10136525
298 Ga0065704_10117316
299 Ga0065712_10000623
300 Ga0065712_10067727
301 Ga0065715_10091901
302 Ga0065715_10092540
303 Ga0065715_10102388
304 Ga0065715_10356486
305 Ga0065707_10105647
306 Ga0065707_10130753
307 Ga0065707_10149546
308 Ga0070690_100002542
309 Ga0070690_100104385
310 Ga0070670_100000167
311 Ga0070670_100022710
312 Ga0070670_100049557
313 Ga0070670_100062553
314 Ga0070677_10051806
315 Ga0068869_100065236
316 Ga0070680_100042738
317 Ga0070682_100000091
318 Ga0070682_100005463
319 Ga0070682_100034284
320 Ga0070660_100011513
321 Ga0070689_100001217
322 Ga0070689_100280356
323 Ga0070687_100010910
324 Ga0070687_100015803
325 Ga0070687_100313869
326 Ga0070661_100028431
327 Ga0070692_10010811
328 Ga0070692_10010891
329 Ga0070692_10035158
330 Ga0070669_100016861
331 Ga0070669_100138686
332 Ga0070675_100205879
333 Ga0070675_100373334
334 Ga0070673_100085438
335 Ga0070673_100153367
336 Ga0070659_100000353
337 Ga0070659_100065409
338 Ga0070659_100763174
339 Ga0070703_10002350
340 Ga0070701_10078766
341 Ga0070705_100004677
342 Ga0070705_100013837
343 Ga0070705_100277298
344 Ga0070700_100000426
345 Ga0070700_100001438
346 Ga0070700_100014770
347 Ga0070694_100001257
348 Ga0070708_100280160
349 Ga0070681_10002024
350 Ga0070681_10101861
351 Ga0068867_100042776
352 Ga0068867_100112933
353 Ga0068867_100338034
354 Ga0070706_100000053
355 Ga0070698_100011764
356 Ga0070699_100476201
357 Ga0070679_100012328
358 Ga0070697_100055231
359 Ga0068853_100037262
360 Ga0068853_100233324
361 Ga0070672_100085084
362 Ga0070686_100010930
363 Ga0070695_100006567
364 Ga0070695_100181761
365 Ga0070696_100022672
366 Ga0070693_100002023
367 Ga0070693_100005220
368 Ga0070693_100016114
369 Ga0070704_100081647
370 Ga0070704_100139214
371 Ga0070704_100472396
372 Ga0068855_100167705
373 Ga0070664_100000399
374 Ga0070664_100278667
375 Ga0068857_100000175
376 Ga0068854_100252517
377 Ga0068854_100397266
378 Ga0068854_100539325
379 Ga0068854_100651511
380 Ga0070702_100011146
381 Ga0068859_100019628
382 Ga0068859_100042881
383 Ga0068859_100098019
384 Ga0068859_100134066
385 Ga0068859_100399439
386 Ga0068859_100589144
387 Ga0068859_100619732
388 Ga0068864_100002219
389 Ga0068864_100033293
390 Ga0068864_100284445
391 Ga0068864_100419685
392 Ga0068861_100005082
393 Ga0068861_100031747
394 Ga0068861_100575264
395 Ga0068851_10004961
396 Ga0068870_10004439
397 Ga0068870_10040524
398 Ga0068863_100428398
399 Ga0068863_100450036
400 Ga0068858_100230859
401 Ga0068860_100022239
402 Ga0068860_100074481
403 Ga0068860_100081947
404 Ga0068860_100232888
405 Ga0068860_100332087
406 Ga0068860_100452017
407 Ga0068860_100452672
408 Ga0068862_100031654
409 Ga0068862_100356738
410 Ga0081539_10004345
411 Ga0097621_100013987
412 Ga0097621_100034771
413 Ga0068871_100016243
414 Ga0075430_100056179
415 Ga0075431_100013308
416 Ga0075433_10034751
417 Ga0075433_10426217
418 Ga0075434_100036967
419 Ga0075434_100128936
420 Ga0075429_100088152
421 Ga0075429_100283508
422 Ga0097620_100019627
423 Ga0097620_100042881
424 Ga0097620_100045387
425 Ga0097620_100098015
426 Ga0097620_100134066
427 Ga0097620_100142264
428 Ga0097620_100170733
429 Ga0097620_100399431
430 Ga0097620_100589109
431 Ga0097620_100619704
432 Ga0075435_100083542
433 Ga0111539_10007213
434 Ga0111539_10048092
435 Ga0111539_10074537
436 Ga0111539_10136360
437 Ga0111539_10254759
438 Ga0111539_10302900
439 Ga0105247_10011339
440 Ga0105247_10020413
441 Ga0114129_10050668
442 Ga0105241_10162551
443 Ga0105242_10052343
444 Ga0105242_11011154
445 Ga0105248_10034850
446 Ga0105248_10046226
447 Ga0105248_10123159
448 Ga0105248_10159667
449 Ga0105248_10235811
450 Ga0105237_10158255
451 Ga0105249_10031483
452 Ga0105249_10084165
453 Ga0105239_10300988
454 Ga0157373_10003994
455 Ga0157374_10142578
456 Ga0157378_10064546
457 Ga0157378_10073974
458 Ga0157378_10311879
459 Ga0157378_10374506
460 Ga0163162_10001664
461 Ga0163162_10170537
462 Ga0163162_10498112
463 Ga0157372_10179667
464 Ga0157375_10018495
465 Ga0157375_10274192
466 Ga0157375_10466936
467 Ga0163163_10000298
468 Ga0163163_10003237
469 Ga0163163_10089046
470 Ga0163163_10163321
471 Ga0157380_10395502
472 Ga0157377_10162120
473 Ga0157379_10163467
474 Ga0157379_10367911
475 Ga0163161_10045474
476 Ga0207656_10015904
477 Ga0207653_10000868
478 Ga0207682_10034786
479 Ga0207710_10015536
480 Ga0207710_10179580
481 Ga0207647_10001353
482 Ga0207647_10043960
483 Ga0207643_10000812
484 Ga0207684_10000053
485 Ga0207654_10096018
486 Ga0207654_10379563
487 Ga0207707_10009569
488 Ga0207707_10736808
489 Ga0207671_10002611
490 Ga0207671_10286814
491 Ga0207660_10090209
492 Ga0207662_10003610
493 Ga0207657_10047897
494 Ga0207649_10096868
495 Ga0207652_10186482
496 Ga0207681_10024238
497 Ga0207694_10016418
498 Ga0207650_10000007
499 Ga0207650_10060686
500 Ga0207650_10122328
501 Ga0207650_10156893
502 Ga0207690_10001726
503 Ga0207690_10036686
504 Ga0207690_10689940
505 Ga0207706_10097389
506 Ga0207706_10200050
507 Ga0207686_10066986
508 Ga0207709_10115286
509 Ga0207670_10002253
510 Ga0207670_10156842
511 Ga0207691_10157099
512 Ga0207691_10240414
513 Ga0207711_10004633
514 Ga0207711_10216090
515 Ga0207711_10767642
516 Ga0207689_10073335
517 Ga0207689_10076276
518 Ga0207689_10384270
519 Ga0207679_10007342
520 Ga0207679_10275627
521 Ga0207667_10416210
522 Ga0207651_10055296
523 Ga0207651_10353429
524 Ga0207712_10049564
525 Ga0207712_10088209
526 Ga0207640_10290034
527 Ga0207640_10354730
528 Ga0207703_10096462
529 Ga0207703_10159171
530 Ga0207703_10590073
531 Ga0207639_10050980
532 Ga0207708_10001571
533 Ga0207708_10020853
534 Ga0207708_10046804
535 Ga0207708_10066172
536 Ga0207708_10209899
537 Ga0207641_10027913
538 Ga0207641_10205657
539 Ga0207641_10444393
540 Ga0207641_10671237
541 Ga0207648_10016231
542 Ga0207648_10182884
543 Ga0207648_10202578
544 Ga0207648_10353012
545 Ga0207676_10002562
546 Ga0207676_10022722
547 Ga0207676_10313868
548 Ga0207676_10479091
549 Ga0207674_10000058
550 Ga0207674_10022245
551 Ga0207674_10177405
552 Ga0207674_10594693
553 Ga0207675_100088838
554 Ga0207675_100094400
555 Ga0207675_100212605
556 Ga0268265_10167256
557 Ga0268265_10928838
558 Ga0268264_10017237
559 Ga0268264_10246357
560 Ga0268264_10368741
561 Ga0268264_10384178
562 Ga0268264_11024255
563 Ga0307408_100436829
564 Ga0307405_10329777
565 Ga0307406_10006109
566 Ga0307412_10616310
567 Ga0307409_100085611
568 Ga0307416_100012231
569 Ga0307416_100171652
570 Ga0307411_10132167
571 Ga0373932_0020210
572 Ga0395901_0201004
573 Ga0439448_0032370
574 Ga0495610_0030343
575 Ga0495663_0000086
576 Ga0495598_0003969
577 Ga0495621_0001179
578 Ga0496106_0128600
579 Ga0496108_0366155
580 nmdc:mga05p37_301508_c1
581 nmdc:mga08y16_112697_c1
582 nmdc:mga08y16_2496_c1
583 nmdc:mga08y16_716933_c1
584 nmdc:mga0rr50_12760_c1
585 nmdc:mga0a205_141433_c1
586 Ga0530510_0182418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xqu-assembly1.cif.gz_F crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 3'-sln 0.6821 15 87
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.5677 141 188
4n6o-assembly1.cif.gz_B crystal structure of reduced legumain in complex with cystatin e/m 0.4181 139 192
6fk0-assembly1.cif.gz_B xray structure of domain-swapped cystatin e dimer 0.3167 139 206
4xqu-assembly1.cif.gz_F crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 3'-sln 0.3156 15 87
ID Description Score Start End Superfamily
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5677 141 188 3.40.630.30
af_Q54FQ9_203_510_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3826 37 116 1.20.1080.10
6fk0B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.3167 139 206 3.10.450.10
af_Q9V3J5_45_549_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2701 10 98 1.20.1250.20
af_A0A1D8PMB6_1235_1454_3.40.50.11210 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Rap/Ran-GAP 0.2651 164 210 3.40.50.11210
ID Description Score Start End GO Terms
AF-A0A317IAN8-F1-model_v4 Type II secretion system protein 0.8162 31 214 GO:0016020
AF-A0A7C3V2W8-F1-model_v4 Pilus assembly protein 0.8122 22 82 GO:0016020
AF-A0A838S237-F1-model_v4 Uncharacterized protein 0.7851 62 213
AF-A0A352F2S1-F1-model_v4 Type II secretion system protein 0.7764 48 213
AF-A0A7W1QX65-F1-model_v4 Type II secretion system protein 0.7503 8 175 GO:0016020

Map