F391314

General Info

Members Datasets Scaffolds Average Seq Length
293 191 293 305

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10061577|Ga0070658_100615773
Length 340
Sequence VILLVNGVGFVQASADALRGTSAAKPGRAPAIALCQNRGMCRALLYLGKPVLLDNLLFQPDSALVRQSYMPKMLHMMNLAGFGMRAWDSASHDPASPFSYASDSLPIFDRNLKNLAGKVSAGCVLAHVRGVAYTTQVEISLQNVHPFQFPGVPLTLAHNGDLARFAEMRPGLARHVCIRGTTDSEWIYALVVSQLDEPHVPPTGAALVGAMKKAMALIREERARLGIDTSSSVNLFVSDGRQVAAARYCFDFGRYGTDDASRLHEANLGFLSLWYTLGRDYGLHEGEWKMTGGAGNADSILIASEPLTRDVAAWVEVPEYSLLHAEVRNGRPAVTLHYLD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.78
Rhizosphere 95.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10061577 3300005327 Bacteria 3058
2 Ga0070676_10127542 3300005328 Bacteria 1605
3 Ga0070690_100049840 3300005330 Bacteria 2671
4 Ga0070690_100085010 3300005330 Unclassified 2075
5 Ga0068869_100038995 3300005334 Bacteria 3389
6 Ga0070680_100087583 3300005336 Bacteria 2575
7 Ga0068868_100047003 3300005338 Bacteria 3380
8 Ga0068868_100538180 3300005338 Bacteria 1028
9 Ga0070689_100000931 3300005340 Bacteria 18184
10 Ga0070689_100072297 3300005340 Bacteria 2696
11 Ga0070692_10003866 3300005345 Bacteria 6170
12 Ga0070692_10014453 3300005345 Bacteria 3709
13 Ga0070668_100218183 3300005347 Bacteria 1572
14 Ga0070675_100028565 3300005354 Bacteria 4489
15 Ga0070675_100046874 3300005354 Bacteria 3541
16 Ga0070674_100053321 3300005356 Bacteria 2792
17 Ga0070673_100034874 3300005364 Unclassified 3812
18 Ga0070673_100152120 3300005364 Unclassified 1960
19 Ga0070688_100090352 3300005365 Bacteria 2000
20 Ga0070700_100108887 3300005441 Bacteria 1838
21 Ga0070694_100002254 3300005444 Bacteria 11399
22 Ga0070694_100082647 3300005444 Bacteria 2237
23 Ga0070678_100261012 3300005456 Bacteria 1457
24 Ga0070681_10014050 3300005458 Bacteria 7968
25 Ga0068867_100000263 3300005459 Bacteria 34585
26 Ga0068867_100083288 3300005459 Bacteria 2415
27 Ga0070698_100020054 3300005471 Bacteria 7009
28 Ga0070698_100494347 3300005471 Bacteria 1161
29 Ga0070699_100022979 3300005518 Bacteria 5371
30 Ga0070672_100092967 3300005543 Bacteria 2436
31 Ga0070695_100033383 3300005545 Bacteria 3220
32 Ga0070695_100159761 3300005545 Bacteria 1581
33 Ga0070696_100164339 3300005546 Bacteria 1637
34 Ga0070693_100007577 3300005547 Bacteria 5311
35 Ga0070693_100026268 3300005547 Bacteria 3143
36 Ga0070693_100026379 3300005547 Bacteria 3137
37 Ga0070704_100001675 3300005549 Bacteria 12033
38 Ga0070704_100114337 3300005549 Bacteria 2060
39 Ga0070704_100152638 3300005549 Unclassified 1818
40 Ga0070704_100184983 3300005549 Bacteria 1670
41 Ga0070704_100222038 3300005549 Bacteria 1537
42 Ga0070704_100374303 3300005549 Bacteria 1208
43 Ga0068857_100137851 3300005577 Bacteria 2204
44 Ga0068856_100050891 3300005614 Bacteria 4085
45 Ga0070702_100108938 3300005615 Bacteria 1714
46 Ga0070702_100144587 3300005615 Bacteria 1519
47 Ga0068852_100364635 3300005616 Unclassified 1414
48 Ga0068859_100058674 3300005617 Bacteria 3877
49 Ga0068859_100090422 3300005617 Bacteria 3112
50 Ga0068864_100231399 3300005618 Bacteria 1709
51 Ga0068861_100011879 3300005719 Bacteria 6063
52 Ga0068863_100226882 3300005841 Archaea 1801
53 Ga0068858_100009189 3300005842 Bacteria 9446
54 Ga0068862_100003037 3300005844 Bacteria 14610
55 Ga0068862_100015193 3300005844 Bacteria 6393
56 Ga0070716_100239722 3300006173 Bacteria 1229
57 Ga0097621_100074205 3300006237 Bacteria 2817
58 Ga0097621_100076783 3300006237 Unclassified 2771
59 Ga0097621_100162199 3300006237 Bacteria 1922
60 Ga0068871_100027662 3300006358 Bacteria 4436
61 Ga0075428_100018392 3300006844 Bacteria 7726
62 Ga0075428_100028571 3300006844 Bacteria 6170
63 Ga0075428_100030556 3300006844 Bacteria 5957
64 Ga0075430_100004026 3300006846 Bacteria 12395
65 Ga0075430_100015215 3300006846 Bacteria 6550
66 Ga0075430_100061187 3300006846 Bacteria 3164
67 Ga0075431_100017580 3300006847 Bacteria 7270
68 Ga0075431_100042990 3300006847 Bacteria 4662
69 Ga0075431_100053592 3300006847 Bacteria 4158
70 Ga0075433_10111135 3300006852 Bacteria 2431
71 Ga0075433_10236757 3300006852 Bacteria 1621
72 Ga0075434_100043162 3300006871 Bacteria 4471
73 Ga0075429_100000783 3300006880 Bacteria 25072
74 Ga0075429_100061524 3300006880 Bacteria 3271
75 Ga0075429_100096953 3300006880 Bacteria 2573
76 Ga0068865_100084798 3300006881 Unclassified 2284
77 Ga0068865_100185721 3300006881 Bacteria 1604
78 Ga0075436_100014986 3300006914 Bacteria 5314
79 Ga0097620_100058676 3300006931 Bacteria 3877
80 Ga0097620_100090424 3300006931 Bacteria 3112
81 Ga0075435_100002981 3300007076 Bacteria 11384
82 Ga0111539_10019575 3300009094 Bacteria 8350
83 Ga0111539_10063358 3300009094 Bacteria 4376
84 Ga0111539_10098624 3300009094 Unclassified 3431
85 Ga0114129_10007452 3300009147 Bacteria 15584
86 Ga0114129_10043645 3300009147 Bacteria 6308
87 Ga0114129_10402114 3300009147 Bacteria 1805
88 Ga0105243_10000346 3300009148 Bacteria 49790
89 Ga0105243_10003866 3300009148 Bacteria 11968
90 Ga0105241_10042213 3300009174 Bacteria 3449
91 Ga0105242_10023845 3300009176 Bacteria 4827
92 Ga0105242_10225581 3300009176 Bacteria 1676
93 Ga0105248_10023394 3300009177 Bacteria 6864
94 Ga0105248_10252392 3300009177 Bacteria 1985
95 Ga0105249_10003981 3300009553 Bacteria 12746
96 Ga0105249_10254076 3300009553 Bacteria 1744
97 Ga0157371_10094160 3300013102 Bacteria 2123
98 Ga0157374_10065934 3300013296 Bacteria 3402
99 Ga0163162_10094731 3300013306 Unclassified 3072
100 Ga0157372_10456249 3300013307 Bacteria 1490
101 Ga0157375_10183185 3300013308 Unclassified 2246
102 Ga0157380_10004658 3300014326 Bacteria 9544
103 Ga0157379_10028618 3300014968 Bacteria 4956
104 Ga0207645_10165070 3300025907 Unclassified 1450
105 Ga0207707_10005306 3300025912 Bacteria 11262
106 Ga0207681_10203995 3300025923 Unclassified 1520
107 Ga0207694_10072288 3300025924 Bacteria 2696
108 Ga0207659_10044183 3300025926 Bacteria 3133
109 Ga0207659_10139387 3300025926 Bacteria 1881
110 Ga0207687_10037017 3300025927 Bacteria 3327
111 Ga0207686_10154627 3300025934 Bacteria 1601
112 Ga0207709_10196896 3300025935 Bacteria 1436
113 Ga0207670_10027781 3300025936 Bacteria 3582
114 Ga0207670_10283789 3300025936 Bacteria 1291
115 Ga0207669_10031745 3300025937 Bacteria 2956
116 Ga0207669_10093224 3300025937 Bacteria 1967
117 Ga0207691_10119066 3300025940 Bacteria 2342
118 Ga0207689_10008042 3300025942 Bacteria 9204
119 Ga0207689_10087419 3300025942 Bacteria 2561
120 Ga0207679_10350877 3300025945 Unclassified 1286
121 Ga0207712_10124361 3300025961 Unclassified 1956
122 Ga0207668_10163472 3300025972 Bacteria 1737
123 Ga0207640_10166924 3300025981 Bacteria 1635
124 Ga0207677_10166850 3300026023 Bacteria 1717
125 Ga0207703_10045445 3300026035 Bacteria 3533
126 Ga0207703_10194125 3300026035 Bacteria 1800
127 Ga0207708_10012442 3300026075 Bacteria 6343
128 Ga0207708_10127837 3300026075 Bacteria 1984
129 Ga0207708_10140936 3300026075 Bacteria 1891
130 Ga0207702_10040833 3300026078 Bacteria 3890
131 Ga0207648_10001038 3300026089 Bacteria 31140
132 Ga0207648_10201840 3300026089 Bacteria 1763
133 Ga0207676_10218212 3300026095 Bacteria 1697
134 Ga0207674_10329358 3300026116 Bacteria 1477
135 Ga0207675_100014505 3300026118 Bacteria 7346
136 Ga0207683_10104426 3300026121 Bacteria 2532
137 Ga0207683_10325980 3300026121 Bacteria 1407
138 Ga0209967_1000636 3300027364 Bacteria 4508
139 Ga0209981_1006540 3300027378 Bacteria 1561
140 Ga0210000_1000769 3300027462 Bacteria 4441
141 Ga0209995_1010327 3300027471 Bacteria 1513
142 Ga0209999_1000890 3300027543 Bacteria 4999
143 Ga0209971_1012398 3300027682 Bacteria 2016
144 Ga0207428_10006754 3300027907 Bacteria 10527
145 Ga0207428_10187665 3300027907 Bacteria 1559
146 Ga0207428_10196903 3300027907 Bacteria 1517
147 Ga0268265_10003338 3300028380 Bacteria 11611
148 Ga0307416_100081075 3300032002 Bacteria 2742
149 Ga0307411_10075907 3300032005 Unclassified 2296
150 Ga0373926_0000280 3300035083 Bacteria 12425
151 Ga0373936_0042309 3300035113 Bacteria 1828
152 Ga0373954_0000081 3300035118 Bacteria 33886
153 Ga0373946_0022379 3300035171 Bacteria 2459
154 Ga0373924_0042034 3300035410 Bacteria 1874
155 Ga0373931_0150292 3300035691 Archaea 1357
156 Ga0373935_0004835 3300035692 Bacteria 7920
157 Ga0373935_0017901 3300035692 Bacteria 4304
158 Ga0373927_0065999 3300035695 Bacteria 2340
159 Ga0373933_0003979 3300035724 Bacteria 8153
160 Ga0373933_0019999 3300035724 Bacteria 3790
161 Ga0373937_0011968 3300036401 Bacteria 7617
162 Ga0373937_0012417 3300036401 Bacteria 7491
163 Ga0373937_0089676 3300036401 Bacteria 2847
164 Ga0373937_0115440 3300036401 Bacteria 2500
165 Ga0373937_0395571 3300036401 Bacteria 1311
166 Ga0373925_0026233 3300037068 Bacteria 4263
167 Ga0439441_001717 3300042001 Bacteria 2944
168 Ga0439441_008760 3300042001 Unclassified 1661
169 Ga0451576_0012362 3300045051 Bacteria 9592
170 Ga0451576_0235224 3300045051 Bacteria 1913
171 Ga0495592_0009454 3300046454 Bacteria 7330
172 Ga0495592_0010674 3300046454 Bacteria 6925
173 Ga0495629_0184815 3300046459 Bacteria 1444
174 Ga0495653_0057998 3300046463 Bacteria 2944
175 Ga0495580_0010903 3300046472 Bacteria 7051
176 Ga0495582_0139925 3300046473 Unclassified 1371
177 Ga0495639_0008751 3300046475 Bacteria 4341
178 Ga0495594_0057640 3300046499 Unclassified 2145
179 Ga0495608_0011819 3300046511 Bacteria 6074
180 Ga0495608_0019528 3300046511 Bacteria 4663
181 Ga0495618_0360396 3300046514 Bacteria 895
182 Ga0495628_0434383 3300046516 Unclassified 955
183 Ga0495630_0171320 3300046517 Bacteria 1654
184 Ga0495652_0045272 3300046529 Bacteria 3785
185 Ga0495652_0210340 3300046529 Unclassified 1469
186 Ga0495586_0004567 3300046535 Bacteria 7401
187 Ga0495586_0023760 3300046535 Unclassified 3273
188 Ga0495587_0031019 3300046536 Bacteria 3239
189 Ga0495587_0137606 3300046536 Bacteria 1395
190 Ga0495621_0021635 3300046539 Bacteria 2122
191 Ga0495645_0001700 3300046543 Bacteria 14952
192 Ga0495634_0013561 3300046642 Bacteria 5887
193 Ga0495635_0068393 3300046663 Bacteria 2436
194 Ga0495635_0076561 3300046663 Bacteria 2293
195 Ga0495659_0031598 3300046664 Bacteria 1849
196 Ga0495657_0052565 3300046675 Bacteria 2730
197 Ga0495599_0012456 3300046678 Bacteria 5242
198 Ga0495658_0007238 3300046683 Bacteria 5483
199 Ga0495658_0028317 3300046683 Bacteria 3023
200 Ga0495600_0012637 3300046809 Bacteria 5285
201 Ga0495581_0154880 3300047315 Unclassified 1339
202 Ga0495604_0310834 3300047317 Unclassified 1056
203 Ga0495636_0006073 3300047318 Bacteria 4742
204 Ga0495680_0005243 3300047322 Bacteria 12239
205 Ga0495684_0056836 3300047471 Bacteria 2982
206 Ga0495684_0395956 3300047471 Bacteria 971
207 Ga0495602_0054778 3300048088 Bacteria 3518
208 Ga0496100_0001582 3300048903 Bacteria 11214
209 Ga0496101_0014485 3300048904 Bacteria 5301
210 Ga0496102_0003453 3300048905 Bacteria 13397
211 Ga0496104_0240780 3300048907 Bacteria 1721
212 Ga0496105_0028691 3300048908 Bacteria 4552
213 Ga0496106_0002071 3300048909 Bacteria 15026
214 Ga0496107_0012525 3300048910 Bacteria 5920
215 Ga0496108_0026050 3300048911 Bacteria 4823
216 Ga0496109_0090942 3300048912 Unclassified 2822
217 Ga0496110_0008655 3300048913 Bacteria 8195
218 Ga0496111_0101166 3300048914 Bacteria 2117
219 Ga0496112_0104486 3300048915 Unclassified 2802
220 Ga0496113_0036008 3300048916 Bacteria 3624
221 Ga0496115_0022025 3300048918 Bacteria 4930
222 Ga0501031_0102141 3300049568 Bacteria 1871
223 Ga0501033_0251715 3300049570 Bacteria 1251
224 Ga0501036_0125395 3300049572 Bacteria 2169
225 Ga0501037_0225507 3300049573 Bacteria 1317
226 Ga0501038_0043392 3300049574 Bacteria 3910
227 Ga0501039_0008606 3300049575 Bacteria 7778
228 Ga0501039_0063437 3300049575 Bacteria 2863
229 Ga0501039_0257737 3300049575 Unclassified 1371
230 Ga0501040_0002356 3300049576 Bacteria 12136
231 Ga0501040_0005053 3300049576 Bacteria 8525
232 Ga0501040_0176790 3300049576 Bacteria 1512
233 Ga0501041_0019121 3300049577 Bacteria 4086
234 Ga0501041_0145367 3300049577 Bacteria 1479
235 Ga0501041_0188846 3300049577 Bacteria 1290
236 Ga0501042_0058302 3300049578 Bacteria 2756
237 Ga0501042_0058724 3300049578 Bacteria 2746
238 Ga0501046_0088524 3300049580 Bacteria 2384
239 Ga0501046_0101036 3300049580 Bacteria 2213
240 Ga0501046_0175828 3300049580 Bacteria 1604
241 Ga0501068_0125103 3300049584 Bacteria 1605
242 Ga0501071_0018346 3300049587 Bacteria 4843
243 Ga0501071_0039664 3300049587 Bacteria 3369
244 Ga0501072_0011291 3300049588 Bacteria 6821
245 Ga0501072_0104598 3300049588 Bacteria 2251
246 Ga0501072_0183950 3300049588 Bacteria 1667
247 Ga0501073_0106191 3300049589 Bacteria 1949
248 Ga0501073_0238515 3300049589 Bacteria 1256
249 Ga0501074_0088855 3300049590 Bacteria 2213
250 Ga0501075_0002291 3300049591 Bacteria 12703
251 Ga0501075_0030646 3300049591 Bacteria 3985
252 Ga0501076_0002636 3300049592 Bacteria 12377
253 Ga0501076_0037581 3300049592 Bacteria 3798
254 Ga0501076_0050576 3300049592 Bacteria 3288
255 Ga0501076_0159248 3300049592 Bacteria 1839
256 Ga0501079_0000354 3300049741 Bacteria 29389
257 Ga0501079_0035840 3300049741 Bacteria 3820
258 Ga0501079_0036267 3300049741 Bacteria 3799
259 Ga0501079_0154251 3300049741 Bacteria 1790
260 Ga0501080_0006897 3300049742 Bacteria 10245
261 Ga0501080_0018329 3300049742 Bacteria 6479
262 Ga0501081_0000544 3300049743 Bacteria 21365
263 Ga0501081_0047442 3300049743 Bacteria 2955
264 Ga0501035_0128853 3300049822 Bacteria 2207
265 Ga0501045_0005047 3300049824 Bacteria 9142
266 Ga0501045_0233595 3300049824 Bacteria 1369
267 nmdc:mga05p37_409314_c1 3300050507 Bacteria 1581
268 nmdc:mga05p37_5315_c1 3300050507 Bacteria 15118
269 nmdc:mga05p37_94192_c1 3300050507 Bacteria 3690
270 nmdc:mga09592_133828_c1 3300050508 Bacteria 2135
271 nmdc:mga09592_301_c1 3300050508 Bacteria 35907
272 nmdc:mga0qj67_18564_c1 3300050509 Bacteria 5300
273 nmdc:mga0qj67_25224_c1 3300050509 Bacteria 4592
274 nmdc:mga0qj67_3751_c1 3300050509 Bacteria 10976
275 nmdc:mga06r32_199509_c1 3300050510 Unclassified 1989
276 nmdc:mga06r32_80351_c1 3300050510 Bacteria 3173
277 nmdc:mga08y16_108576_c1 3300050511 Bacteria 2889
278 nmdc:mga08y16_15527_c1 3300050511 Bacteria 8008
279 nmdc:mga08y16_306837_c1 3300050511 Bacteria 1635
280 nmdc:mga0n895_19764_c1 3300050512 Bacteria 6267
281 nmdc:mga0rr50_3915_c1 3300050513 Bacteria 8663
282 nmdc:mga0rr50_461853_c1 3300050513 Bacteria 1077
283 nmdc:mga08x19_52408_c1 3300050514 Bacteria 2624
284 nmdc:mga0a205_103338_c1 3300050515 Bacteria 2748
285 nmdc:mga0a205_270439_c1 3300050515 Bacteria 1576
286 nmdc:mga0a205_44240_c2 3300050515 Bacteria 3924
287 Ga0495601_0007014 3300053077 Bacteria 6603
288 Ga0495595_0005543 3300053084 Bacteria 5109
289 Ga0495619_0027771 3300053085 Bacteria 3649
290 Ga0501084_0008264 3300054114 Bacteria 8586
291 Ga0590071_017992 3300059421 Bacteria 1661
292 Ga0501082_0021885 3300060353 Bacteria 5511
293 Ga0530510_0000208 3300061734 Bacteria 36276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10254076 Ga0105249_102540762 268
2 3300046516 Ga0495628_0434383 Ga0495628_0434383_22_846 268
3 3300006237 Ga0097621_100162199 Ga0097621_1001621992 271
4 3300046514 Ga0495618_0360396 Ga0495618_0360396_21_854 271
5 3300049592 Ga0501076_0159248 Ga0501076_0159248_969_1802 271
6 3300048903 Ga0496100_0001582 Ga0496100_0001582_10264_11154 289
7 3300048904 Ga0496101_0014485 Ga0496101_0014485_1909_2799 289
8 3300048905 Ga0496102_0003453 Ga0496102_0003453_1251_2141 289
9 3300048907 Ga0496104_0240780 Ga0496104_0240780_47_937 289
10 3300048908 Ga0496105_0028691 Ga0496105_0028691_2853_3743 289
11 3300048909 Ga0496106_0002071 Ga0496106_0002071_12882_13772 289
12 3300048910 Ga0496107_0012525 Ga0496107_0012525_3071_3961 289
13 3300048911 Ga0496108_0026050 Ga0496108_0026050_2683_3573 289
14 3300048912 Ga0496109_0090942 Ga0496109_0090942_1215_2105 289
15 3300048913 Ga0496110_0008655 Ga0496110_0008655_785_1675 289
16 3300048914 Ga0496111_0101166 Ga0496111_0101166_945_1835 289
17 3300048915 Ga0496112_0104486 Ga0496112_0104486_1176_2066 289
18 3300048916 Ga0496113_0036008 Ga0496113_0036008_1866_2756 289
19 3300048918 Ga0496115_0022025 Ga0496115_0022025_2814_3704 289
20 3300005546 Ga0070696_100164339 Ga0070696_1001643392 290
21 3300005547 Ga0070693_100007577 Ga0070693_1000075774 294
22 3300009174 Ga0105241_10042213 Ga0105241_100422132 294
23 3300046535 Ga0495586_0023760 Ga0495586_0023760_2256_3161 294
24 3300006844 Ga0075428_100030556 Ga0075428_1000305562 295
25 3300009094 Ga0111539_10019575 Ga0111539_100195755 295
26 3300013102 Ga0157371_10094160 Ga0157371_100941603 295
27 3300013307 Ga0157372_10456249 Ga0157372_104562492 295
28 3300027907 Ga0207428_10006754 Ga0207428_100067544 295
29 3300046539 Ga0495621_0021635 Ga0495621_0021635_770_1678 295
30 3300050511 nmdc:mga08y16_15527_c1 nmdc:mga08y16_15527_c1_339_1262 295
31 3300005338 Ga0068868_100538180 Ga0068868_1005381801 296
32 3300005459 Ga0068867_100083288 Ga0068867_1000832882 296
33 3300005614 Ga0068856_100050891 Ga0068856_1000508912 296
34 3300005618 Ga0068864_100231399 Ga0068864_1002313992 296
35 3300005842 Ga0068858_100009189 Ga0068858_1000091897 296
36 3300025924 Ga0207694_10072288 Ga0207694_100722882 296
37 3300025935 Ga0207709_10196896 Ga0207709_101968962 296
38 3300026023 Ga0207677_10166850 Ga0207677_101668502 296
39 3300026035 Ga0207703_10045445 Ga0207703_100454453 296
40 3300026078 Ga0207702_10040833 Ga0207702_100408334 296
41 3300026089 Ga0207648_10201840 Ga0207648_102018401 296
42 3300026095 Ga0207676_10218212 Ga0207676_102182122 296
43 3300005338 Ga0068868_100047003 Ga0068868_1000470034 297
44 3300005340 Ga0070689_100000931 Ga0070689_1000009314 297
45 3300005354 Ga0070675_100028565 Ga0070675_1000285652 297
46 3300005365 Ga0070688_100090352 Ga0070688_1000903522 297
47 3300005543 Ga0070672_100092967 Ga0070672_1000929672 297
48 3300005547 Ga0070693_100026268 Ga0070693_1000262682 297
49 3300006237 Ga0097621_100076783 Ga0097621_1000767834 297
50 3300025926 Ga0207659_10139387 Ga0207659_101393872 297
51 3300025940 Ga0207691_10119066 Ga0207691_101190662 297
52 3300025942 Ga0207689_10087419 Ga0207689_100874192 297
53 3300005330 Ga0070690_100085010 Ga0070690_1000850102 299
54 3300005616 Ga0068852_100364635 Ga0068852_1003646352 299
55 3300005841 Ga0068863_100226882 Ga0068863_1002268822 299
56 3300006881 Ga0068865_100084798 Ga0068865_1000847981 299
57 3300009177 Ga0105248_10252392 Ga0105248_102523921 299
58 3300025961 Ga0207712_10124361 Ga0207712_101243612 299
59 3300026035 Ga0207703_10194125 Ga0207703_101941252 299
60 3300035691 Ga0373931_0150292 Ga0373931_0150292_211_1134 299
61 3300005328 Ga0070676_10127542 Ga0070676_101275421 300
62 3300005334 Ga0068869_100038995 Ga0068869_1000389952 300
63 3300005354 Ga0070675_100046874 Ga0070675_1000468743 300
64 3300005364 Ga0070673_100034874 Ga0070673_1000348742 300
65 3300005456 Ga0070678_100261012 Ga0070678_1002610122 300
66 3300005549 Ga0070704_100374303 Ga0070704_1003743031 300
67 3300005615 Ga0070702_100108938 Ga0070702_1001089382 300
68 3300006846 Ga0075430_100004026 Ga0075430_1000040266 300
69 3300025907 Ga0207645_10165070 Ga0207645_101650702 300
70 3300025926 Ga0207659_10044183 Ga0207659_100441832 300
71 3300025942 Ga0207689_10008042 Ga0207689_100080426 300
72 3300026121 Ga0207683_10325980 Ga0207683_103259802 300
73 3300032005 Ga0307411_10075907 Ga0307411_100759072 300
74 3300049568 Ga0501031_0102141 Ga0501031_0102141_467_1387 300
75 3300049575 Ga0501039_0063437 Ga0501039_0063437_378_1298 300
76 3300049575 Ga0501039_0257737 Ga0501039_0257737_252_1175 300
77 3300049576 Ga0501040_0176790 Ga0501040_0176790_233_1153 300
78 3300049577 Ga0501041_0188846 Ga0501041_0188846_346_1266 300
79 3300049580 Ga0501046_0101036 Ga0501046_0101036_67_987 300
80 3300049580 Ga0501046_0175828 Ga0501046_0175828_304_1224 300
81 3300049587 Ga0501071_0018346 Ga0501071_0018346_1490_2413 300
82 3300049588 Ga0501072_0104598 Ga0501072_0104598_473_1393 300
83 3300049591 Ga0501075_0030646 Ga0501075_0030646_832_1752 300
84 3300049592 Ga0501076_0037581 Ga0501076_0037581_2605_3525 300
85 3300049592 Ga0501076_0050576 Ga0501076_0050576_868_1791 300
86 3300049741 Ga0501079_0035840 Ga0501079_0035840_735_1655 300
87 3300049741 Ga0501079_0036267 Ga0501079_0036267_1449_2372 300
88 3300049742 Ga0501080_0018329 Ga0501080_0018329_76_999 300
89 3300049743 Ga0501081_0047442 Ga0501081_0047442_511_1431 300
90 3300059421 Ga0590071_017992 Ga0590071_017992_579_1499 300
91 3300005336 Ga0070680_100087583 Ga0070680_1000875832 301
92 3300005345 Ga0070692_10003866 Ga0070692_100038662 301
93 3300005345 Ga0070692_10014453 Ga0070692_100144532 301
94 3300005347 Ga0070668_100218183 Ga0070668_1002181832 301
95 3300005356 Ga0070674_100053321 Ga0070674_1000533212 301
96 3300005364 Ga0070673_100152120 Ga0070673_1001521202 301
97 3300005441 Ga0070700_100108887 Ga0070700_1001088872 301
98 3300005444 Ga0070694_100002254 Ga0070694_1000022544 301
99 3300005444 Ga0070694_100082647 Ga0070694_1000826472 301
100 3300005458 Ga0070681_10014050 Ga0070681_100140504 301
101 3300005459 Ga0068867_100000263 Ga0068867_10000026329 301
102 3300005471 Ga0070698_100020054 Ga0070698_1000200542 301
103 3300005471 Ga0070698_100494347 Ga0070698_1004943472 301
104 3300005518 Ga0070699_100022979 Ga0070699_1000229792 301
105 3300005545 Ga0070695_100033383 Ga0070695_1000333832 301
106 3300005545 Ga0070695_100159761 Ga0070695_1001597612 301
107 3300005547 Ga0070693_100026379 Ga0070693_1000263792 301
108 3300005549 Ga0070704_100001675 Ga0070704_1000016757 301
109 3300005549 Ga0070704_100114337 Ga0070704_1001143373 301
110 3300005549 Ga0070704_100152638 Ga0070704_1001526382 301
111 3300005549 Ga0070704_100184983 Ga0070704_1001849832 301
112 3300005549 Ga0070704_100222038 Ga0070704_1002220381 301
113 3300005577 Ga0068857_100137851 Ga0068857_1001378512 301
114 3300005615 Ga0070702_100144587 Ga0070702_1001445872 301
115 3300005617 Ga0068859_100090422 Ga0068859_1000904223 301
116 3300005719 Ga0068861_100011879 Ga0068861_1000118793 301
117 3300005844 Ga0068862_100003037 Ga0068862_10000303711 301
118 3300005844 Ga0068862_100015193 Ga0068862_1000151935 301
119 3300006173 Ga0070716_100239722 Ga0070716_1002397222 301
120 3300006237 Ga0097621_100074205 Ga0097621_1000742052 301
121 3300006358 Ga0068871_100027662 Ga0068871_1000276622 301
122 3300006844 Ga0075428_100018392 Ga0075428_1000183924 301
123 3300006844 Ga0075428_100028571 Ga0075428_1000285713 301
124 3300006846 Ga0075430_100015215 Ga0075430_1000152154 301
125 3300006846 Ga0075430_100061187 Ga0075430_1000611873 301
126 3300006847 Ga0075431_100017580 Ga0075431_1000175807 301
127 3300006847 Ga0075431_100042990 Ga0075431_1000429903 301
128 3300006847 Ga0075431_100053592 Ga0075431_1000535922 301
129 3300006852 Ga0075433_10111135 Ga0075433_101111352 301
130 3300006852 Ga0075433_10236757 Ga0075433_102367572 301
131 3300006871 Ga0075434_100043162 Ga0075434_1000431624 301
132 3300006880 Ga0075429_100000783 Ga0075429_1000007839 301
133 3300006880 Ga0075429_100061524 Ga0075429_1000615242 301
134 3300006880 Ga0075429_100096953 Ga0075429_1000969532 301
135 3300006881 Ga0068865_100185721 Ga0068865_1001857212 301
136 3300006914 Ga0075436_100014986 Ga0075436_1000149865 301
137 3300006931 Ga0097620_100090424 Ga0097620_1000904243 301
138 3300007076 Ga0075435_100002981 Ga0075435_1000029815 301
139 3300009094 Ga0111539_10063358 Ga0111539_100633583 301
140 3300009094 Ga0111539_10098624 Ga0111539_100986243 301
141 3300009147 Ga0114129_10007452 Ga0114129_100074528 301
142 3300009147 Ga0114129_10043645 Ga0114129_100436452 301
143 3300009147 Ga0114129_10402114 Ga0114129_104021142 301
144 3300009148 Ga0105243_10000346 Ga0105243_1000034615 301
145 3300009148 Ga0105243_10003866 Ga0105243_100038668 301
146 3300009176 Ga0105242_10023845 Ga0105242_100238455 301
147 3300009176 Ga0105242_10225581 Ga0105242_102255812 301
148 3300009553 Ga0105249_10003981 Ga0105249_100039812 301
149 3300013296 Ga0157374_10065934 Ga0157374_100659345 301
150 3300013306 Ga0163162_10094731 Ga0163162_100947313 301
151 3300013308 Ga0157375_10183185 Ga0157375_101831852 301
152 3300014326 Ga0157380_10004658 Ga0157380_100046586 301
153 3300025912 Ga0207707_10005306 Ga0207707_100053067 301
154 3300025923 Ga0207681_10203995 Ga0207681_102039952 301
155 3300025927 Ga0207687_10037017 Ga0207687_100370172 301
156 3300025934 Ga0207686_10154627 Ga0207686_101546272 301
157 3300025936 Ga0207670_10283789 Ga0207670_102837892 301
158 3300025937 Ga0207669_10031745 Ga0207669_100317454 301
159 3300025937 Ga0207669_10093224 Ga0207669_100932242 301
160 3300025945 Ga0207679_10350877 Ga0207679_103508772 301
161 3300025972 Ga0207668_10163472 Ga0207668_101634722 301
162 3300025981 Ga0207640_10166924 Ga0207640_101669242 301
163 3300026075 Ga0207708_10012442 Ga0207708_100124424 301
164 3300026075 Ga0207708_10127837 Ga0207708_101278372 301
165 3300026075 Ga0207708_10140936 Ga0207708_101409362 301
166 3300026089 Ga0207648_10001038 Ga0207648_1000103819 301
167 3300026116 Ga0207674_10329358 Ga0207674_103293582 301
168 3300026118 Ga0207675_100014505 Ga0207675_1000145053 301
169 3300026121 Ga0207683_10104426 Ga0207683_101044263 301
170 3300027364 Ga0209967_1000636 Ga0209967_10006363 301
171 3300027378 Ga0209981_1006540 Ga0209981_10065403 301
172 3300027462 Ga0210000_1000769 Ga0210000_10007694 301
173 3300027471 Ga0209995_1010327 Ga0209995_10103273 301
174 3300027543 Ga0209999_1000890 Ga0209999_10008903 301
175 3300027682 Ga0209971_1012398 Ga0209971_10123982 301
176 3300027907 Ga0207428_10187665 Ga0207428_101876652 301
177 3300027907 Ga0207428_10196903 Ga0207428_101969031 301
178 3300028380 Ga0268265_10003338 Ga0268265_100033385 301
179 3300032002 Ga0307416_100081075 Ga0307416_1000810752 301
180 3300035083 Ga0373926_0000280 Ga0373926_0000280_8605_9528 301
181 3300035113 Ga0373936_0042309 Ga0373936_0042309_642_1565 301
182 3300035118 Ga0373954_0000081 Ga0373954_0000081_32537_33460 301
183 3300035171 Ga0373946_0022379 Ga0373946_0022379_1029_1952 301
184 3300035410 Ga0373924_0042034 Ga0373924_0042034_904_1827 301
185 3300035692 Ga0373935_0004835 Ga0373935_0004835_2088_3011 301
186 3300035692 Ga0373935_0017901 Ga0373935_0017901_1351_2274 301
187 3300035695 Ga0373927_0065999 Ga0373927_0065999_57_980 301
188 3300035724 Ga0373933_0003979 Ga0373933_0003979_1258_2181 301
189 3300035724 Ga0373933_0019999 Ga0373933_0019999_1267_2190 301
190 3300036401 Ga0373937_0011968 Ga0373937_0011968_3507_4430 301
191 3300036401 Ga0373937_0012417 Ga0373937_0012417_1816_2739 301
192 3300036401 Ga0373937_0089676 Ga0373937_0089676_1902_2825 301
193 3300036401 Ga0373937_0115440 Ga0373937_0115440_1458_2381 301
194 3300036401 Ga0373937_0395571 Ga0373937_0395571_372_1295 301
195 3300037068 Ga0373925_0026233 Ga0373925_0026233_1457_2380 301
196 3300042001 Ga0439441_008760 Ga0439441_008760_526_1449 301
197 3300045051 Ga0451576_0012362 Ga0451576_0012362_7140_8063 301
198 3300045051 Ga0451576_0235224 Ga0451576_0235224_698_1621 301
199 3300046454 Ga0495592_0009454 Ga0495592_0009454_5294_6217 301
200 3300046454 Ga0495592_0010674 Ga0495592_0010674_3589_4512 301
201 3300046459 Ga0495629_0184815 Ga0495629_0184815_24_947 301
202 3300046463 Ga0495653_0057998 Ga0495653_0057998_1865_2788 301
203 3300046472 Ga0495580_0010903 Ga0495580_0010903_5094_6017 301
204 3300046473 Ga0495582_0139925 Ga0495582_0139925_243_1166 301
205 3300046475 Ga0495639_0008751 Ga0495639_0008751_566_1489 301
206 3300046499 Ga0495594_0057640 Ga0495594_0057640_635_1558 301
207 3300046511 Ga0495608_0011819 Ga0495608_0011819_2561_3484 301
208 3300046511 Ga0495608_0019528 Ga0495608_0019528_1205_2128 301
209 3300046517 Ga0495630_0171320 Ga0495630_0171320_285_1208 301
210 3300046529 Ga0495652_0045272 Ga0495652_0045272_2276_3199 301
211 3300046529 Ga0495652_0210340 Ga0495652_0210340_121_1044 301
212 3300046535 Ga0495586_0004567 Ga0495586_0004567_5493_6416 301
213 3300046536 Ga0495587_0031019 Ga0495587_0031019_2168_3091 301
214 3300046536 Ga0495587_0137606 Ga0495587_0137606_395_1318 301
215 3300046543 Ga0495645_0001700 Ga0495645_0001700_11143_12066 301
216 3300046642 Ga0495634_0013561 Ga0495634_0013561_1871_2794 301
217 3300046663 Ga0495635_0068393 Ga0495635_0068393_1292_2215 301
218 3300046663 Ga0495635_0076561 Ga0495635_0076561_1255_2178 301
219 3300046664 Ga0495659_0031598 Ga0495659_0031598_117_1040 301
220 3300046675 Ga0495657_0052565 Ga0495657_0052565_1241_2164 301
221 3300046678 Ga0495599_0012456 Ga0495599_0012456_1564_2487 301
222 3300046683 Ga0495658_0007238 Ga0495658_0007238_3017_3940 301
223 3300046683 Ga0495658_0028317 Ga0495658_0028317_1825_2748 301
224 3300046809 Ga0495600_0012637 Ga0495600_0012637_2296_3219 301
225 3300047315 Ga0495581_0154880 Ga0495581_0154880_333_1256 301
226 3300047317 Ga0495604_0310834 Ga0495604_0310834_58_981 301
227 3300047318 Ga0495636_0006073 Ga0495636_0006073_1180_2103 301
228 3300047322 Ga0495680_0005243 Ga0495680_0005243_6775_7698 301
229 3300047471 Ga0495684_0056836 Ga0495684_0056836_685_1608 301
230 3300047471 Ga0495684_0395956 Ga0495684_0395956_22_945 301
231 3300048088 Ga0495602_0054778 Ga0495602_0054778_655_1578 301
232 3300049570 Ga0501033_0251715 Ga0501033_0251715_287_1210 301
233 3300049572 Ga0501036_0125395 Ga0501036_0125395_336_1259 301
234 3300049573 Ga0501037_0225507 Ga0501037_0225507_95_1018 301
235 3300049574 Ga0501038_0043392 Ga0501038_0043392_1198_2121 301
236 3300049575 Ga0501039_0008606 Ga0501039_0008606_5093_6016 301
237 3300049576 Ga0501040_0002356 Ga0501040_0002356_6247_7170 301
238 3300049576 Ga0501040_0005053 Ga0501040_0005053_4349_5272 301
239 3300049577 Ga0501041_0019121 Ga0501041_0019121_2779_3702 301
240 3300049577 Ga0501041_0145367 Ga0501041_0145367_291_1214 301
241 3300049578 Ga0501042_0058302 Ga0501042_0058302_776_1699 301
242 3300049578 Ga0501042_0058724 Ga0501042_0058724_983_1906 301
243 3300049580 Ga0501046_0088524 Ga0501046_0088524_645_1568 301
244 3300049584 Ga0501068_0125103 Ga0501068_0125103_26_949 301
245 3300049587 Ga0501071_0039664 Ga0501071_0039664_849_1772 301
246 3300049588 Ga0501072_0011291 Ga0501072_0011291_4563_5486 301
247 3300049588 Ga0501072_0183950 Ga0501072_0183950_219_1142 301
248 3300049589 Ga0501073_0106191 Ga0501073_0106191_984_1907 301
249 3300049589 Ga0501073_0238515 Ga0501073_0238515_13_936 301
250 3300049590 Ga0501074_0088855 Ga0501074_0088855_797_1720 301
251 3300049591 Ga0501075_0002291 Ga0501075_0002291_2131_3054 301
252 3300049592 Ga0501076_0002636 Ga0501076_0002636_2879_3802 301
253 3300049741 Ga0501079_0000354 Ga0501079_0000354_22657_23580 301
254 3300049741 Ga0501079_0154251 Ga0501079_0154251_283_1206 301
255 3300049742 Ga0501080_0006897 Ga0501080_0006897_4574_5497 301
256 3300049743 Ga0501081_0000544 Ga0501081_0000544_7419_8342 301
257 3300049822 Ga0501035_0128853 Ga0501035_0128853_394_1317 301
258 3300049824 Ga0501045_0005047 Ga0501045_0005047_7517_8440 301
259 3300049824 Ga0501045_0233595 Ga0501045_0233595_65_988 301
260 3300050507 nmdc:mga05p37_409314_c1 nmdc:mga05p37_409314_c1_614_1537 301
261 3300050507 nmdc:mga05p37_5315_c1 nmdc:mga05p37_5315_c1_13732_14655 301
262 3300050507 nmdc:mga05p37_94192_c1 nmdc:mga05p37_94192_c1_865_1788 301
263 3300050508 nmdc:mga09592_133828_c1 nmdc:mga09592_133828_c1_462_1385 301
264 3300050508 nmdc:mga09592_301_c1 nmdc:mga09592_301_c1_24112_25035 301
265 3300050509 nmdc:mga0qj67_18564_c1 nmdc:mga0qj67_18564_c1_1143_2066 301
266 3300050509 nmdc:mga0qj67_25224_c1 nmdc:mga0qj67_25224_c1_2196_3119 301
267 3300050510 nmdc:mga06r32_199509_c1 nmdc:mga06r32_199509_c1_520_1443 301
268 3300050510 nmdc:mga06r32_80351_c1 nmdc:mga06r32_80351_c1_1587_2510 301
269 3300050511 nmdc:mga08y16_108576_c1 nmdc:mga08y16_108576_c1_350_1273 301
270 3300050511 nmdc:mga08y16_306837_c1 nmdc:mga08y16_306837_c1_244_1167 301
271 3300050512 nmdc:mga0n895_19764_c1 nmdc:mga0n895_19764_c1_2229_3152 301
272 3300050513 nmdc:mga0rr50_3915_c1 nmdc:mga0rr50_3915_c1_3472_4395 301
273 3300050513 nmdc:mga0rr50_461853_c1 nmdc:mga0rr50_461853_c1_48_971 301
274 3300050514 nmdc:mga08x19_52408_c1 nmdc:mga08x19_52408_c1_1638_2561 301
275 3300050515 nmdc:mga0a205_103338_c1 nmdc:mga0a205_103338_c1_1056_1979 301
276 3300050515 nmdc:mga0a205_270439_c1 nmdc:mga0a205_270439_c1_358_1281 301
277 3300050515 nmdc:mga0a205_44240_c2 nmdc:mga0a205_44240_c2_2798_3721 301
278 3300053077 Ga0495601_0007014 Ga0495601_0007014_3801_4724 301
279 3300053084 Ga0495595_0005543 Ga0495595_0005543_3610_4533 301
280 3300053085 Ga0495619_0027771 Ga0495619_0027771_1436_2359 301
281 3300054114 Ga0501084_0008264 Ga0501084_0008264_584_1507 301
282 3300060353 Ga0501082_0021885 Ga0501082_0021885_2988_3911 301
283 3300061734 Ga0530510_0000208 Ga0530510_0000208_9727_10650 301
284 3300005330 Ga0070690_100049840 Ga0070690_1000498402 306
285 3300005340 Ga0070689_100072297 Ga0070689_1000722973 306
286 3300005617 Ga0068859_100058674 Ga0068859_1000586745 306
287 3300006931 Ga0097620_100058676 Ga0097620_1000586765 306
288 3300025936 Ga0207670_10027781 Ga0207670_100277812 306
289 3300050509 nmdc:mga0qj67_3751_c1 nmdc:mga0qj67_3751_c1_3898_4854 307
290 3300009177 Ga0105248_10023394 Ga0105248_100233942 318
291 3300014968 Ga0157379_10028618 Ga0157379_100286184 318
292 3300042001 Ga0439441_001717 Ga0439441_001717_1868_2896 321
293 3300005327 Ga0070658_10061577 Ga0070658_100615773 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13230

GATase_4

Glutamine amidotransferases class-II

93

250

0.82

PF13522

GATase_6

Glutamine amidotransferase domain

110

247

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hr5-assembly1.cif.gz_A bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) 0.8682 318 340
4zfj-assembly1.cif.gz_B ergothioneine-biosynthetic ntn hydrolase egtc, apo form 0.8413 41 340
6iby-assembly1.cif.gz_A human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 0.8387 315 340
4zfk-assembly1.cif.gz_A ergothioneine-biosynthetic ntn hydrolase egtc with glutamine 0.8375 41 340
4zfj-assembly1.cif.gz_B ergothioneine-biosynthetic ntn hydrolase egtc, apo form 0.8345 41 340
ID Description Score Start End Superfamily
af_A4I1W7_429_663_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8746 315 339 3.40.50.1240
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8304 41 340 3.60.20.10
af_P53871_1_308_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.823 40 340 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8202 41 340 3.60.20.10
af_P53871_1_308_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8028 40 340 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A1G3K299-F1-model_v4 deleted 0.933 40 340
AF-A0A2U1RRA3-F1-model_v4 deleted 0.9309 40 340
AF-A0A3A6W461-F1-model_v4 Class II glutamine amidotransferase 0.9201 40 340 GO:0016740
AF-A0A098GJY2-F1-model_v4 Uncharacterized protein 0.9171 40 340
AF-A0A6N7PHG0-F1-model_v4 Class II glutamine amidotransferase 0.915 40 340 GO:0016740

Feature Viewer

pLDDT pTM Quality
79.15 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map