F391283

General Info

Members Datasets Scaffolds Average Seq Length
293 148 288 327

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10169734|rootH1_101697341
Length 377
Sequence MFKKKWQRYTLLVLLVLTAVYFLGPHPKAPEYSDVMPTVPTDINALPQYIQQQESQHKVKPNNEARIVWYNPAPDSAAAKVIDSMKKTGKQGEFVSNAYKVDSMPHAITEYSIVYLHGFSASQEEGAPIHTNIAKEFGCNLYLSRLAEHGIDTAEPMINLTPEKYWESAKQALAIGKQIGKKVILMGTSTGGTNALQLAAAYPNDIAAVVLLSPNIAIHDPNARVLNNPWGLQIARMVKGSHYVTASDDRPIYKQYWYHQYPLEAAVQLQELLETTMTKETFEKIKQPTLLLYYYMDEQHQDSVVSVPAMLKMFNELGTPANLKEKDAIPAAGDHVLGSYIKSKDLLSVQTAIENFMVNKLQMPKKQNGSIINVSKP

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
3 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
4 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
5 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0
Rhizoplane 1.37
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001949 3300000545 Bacteria 1412
2 JGI24751J29686_10000577 3300002459 Bacteria 9916
3 rootH1_10169734 3300003316 Unclassified 1467
4 rootH2_10119508 3300003320 Bacteria 2003
5 rootH2_10176807 3300003320 Bacteria 4635
6 rootL2_10000759 3300003322 Bacteria 3697
7 rootL2_10063526 3300003322 Bacteria 2819
8 rootL2_10133552 3300003322 Bacteria 5722
9 rootL2_10180293 3300003322 Bacteria 1555
10 rootH1_10126215 3300003323 Bacteria 5528
11 JGI25160J50197_1000452 3300003354 Bacteria 25597
12 JGI25160J50197_1014829 3300003354 Bacteria 2587
13 Ga0055531_10000029 3300003794 Bacteria 159248
14 Ga0065714_10083716 3300005288 Bacteria 2235
15 Ga0065712_10001405 3300005290 Bacteria 5967
16 Ga0065712_10008933 3300005290 Bacteria 2416
17 Ga0065712_10008969 3300005290 Bacteria 3450
18 Ga0065712_10088782 3300005290 Bacteria 2490
19 Ga0065715_10125918 3300005293 Bacteria 2106
20 Ga0065707_10105295 3300005295 Bacteria 2651
21 Ga0070676_10026387 3300005328 Bacteria 3289
22 Ga0070683_100052822 3300005329 Bacteria 3766
23 Ga0070670_100006171 3300005331 Bacteria 10130
24 Ga0070670_100036313 3300005331 Bacteria 4240
25 Ga0070670_100043518 3300005331 Bacteria 3859
26 Ga0070670_100109883 3300005331 Bacteria 2376
27 Ga0070670_100133481 3300005331 Bacteria 2145
28 Ga0068869_100051771 3300005334 Bacteria 2979
29 Ga0068869_100085715 3300005334 Bacteria 2360
30 Ga0068869_100091380 3300005334 Bacteria 2290
31 Ga0068869_100189750 3300005334 Bacteria 1616
32 Ga0070666_10010452 3300005335 Bacteria 5808
33 Ga0070689_100005141 3300005340 Bacteria 8898
34 Ga0070687_100095982 3300005343 Bacteria 1649
35 Ga0070668_100025949 3300005347 Bacteria 4443
36 Ga0070668_100049385 3300005347 Bacteria 3237
37 Ga0070668_100154627 3300005347 Bacteria 1857
38 Ga0070669_100022097 3300005353 Bacteria 4550
39 Ga0070675_100281886 3300005354 Bacteria 1460
40 Ga0070674_100093212 3300005356 Unclassified 2179
41 Ga0070674_100147997 3300005356 Bacteria 1769
42 Ga0070674_100212081 3300005356 Unclassified 1501
43 Ga0070673_100006773 3300005364 Bacteria 7479
44 Ga0070673_100006951 3300005364 Bacteria 7408
45 Ga0070673_100068833 3300005364 Bacteria 2835
46 Ga0070673_100161024 3300005364 Bacteria 1909
47 Ga0070688_100009832 3300005365 Bacteria 5255
48 Ga0070688_100029662 3300005365 Bacteria 3277
49 Ga0070688_100070563 3300005365 Bacteria 2234
50 Ga0070688_100250678 3300005365 Bacteria 1260
51 Ga0070701_10106675 3300005438 Bacteria 1559
52 Ga0070678_100390788 3300005456 Bacteria 1206
53 Ga0070662_100062289 3300005457 Bacteria 2725
54 Ga0068867_100007904 3300005459 Bacteria 7515
55 Ga0068867_100064547 3300005459 Bacteria 2723
56 Ga0070685_10002124 3300005466 Bacteria 10236
57 Ga0070685_10049298 3300005466 Bacteria 2428
58 Ga0070685_10104318 3300005466 Bacteria 1736
59 Ga0070698_100000061 3300005471 Bacteria 78637
60 Ga0070698_100003252 3300005471 Bacteria 17859
61 Ga0070698_100028616 3300005471 Bacteria 5786
62 Ga0070684_100062004 3300005535 Bacteria 3274
63 Ga0068853_100002818 3300005539 Bacteria 13167
64 Ga0068853_100143116 3300005539 Bacteria 2147
65 Ga0070672_100005625 3300005543 Bacteria 8338
66 Ga0070672_100034165 3300005543 Bacteria 3858
67 Ga0070672_100040699 3300005543 Bacteria 3567
68 Ga0070686_100106677 3300005544 Bacteria 1901
69 Ga0070704_100466850 3300005549 Bacteria 1090
70 Ga0070664_100051594 3300005564 Bacteria 3482
71 Ga0068857_100031284 3300005577 Bacteria 4702
72 Ga0068857_100053930 3300005577 Bacteria 3567
73 Ga0068854_100122270 3300005578 Bacteria 1978
74 Ga0068854_100234475 3300005578 Bacteria 1458
75 Ga0068859_100033782 3300005617 Bacteria 5135
76 Ga0068859_100102432 3300005617 Bacteria 2921
77 Ga0068859_100127477 3300005617 Bacteria 2615
78 Ga0068859_100245390 3300005617 Bacteria 1880
79 Ga0068859_100252309 3300005617 Bacteria 1855
80 Ga0068859_100327687 3300005617 Bacteria 1625
81 Ga0068864_100070677 3300005618 Bacteria 3037
82 Ga0068864_100119265 3300005618 Bacteria 2357
83 Ga0068861_100017331 3300005719 Bacteria 5111
84 Ga0068861_100043378 3300005719 Bacteria 3376
85 Ga0068861_100231947 3300005719 Bacteria 1566
86 Ga0068861_100271366 3300005719 Bacteria 1457
87 Ga0068870_10021666 3300005840 Bacteria 3148
88 Ga0068870_10046336 3300005840 Bacteria 2279
89 Ga0068863_100017886 3300005841 Bacteria 6783
90 Ga0068863_100082301 3300005841 Bacteria 3050
91 Ga0068863_100094166 3300005841 Bacteria 2843
92 Ga0068863_100309416 3300005841 Bacteria 1533
93 Ga0068863_100517184 3300005841 Bacteria 1177
94 Ga0068860_100058786 3300005843 Bacteria 3656
95 Ga0068860_100075022 3300005843 Bacteria 3217
96 Ga0068860_100102254 3300005843 Bacteria 2734
97 Ga0068860_100258988 3300005843 Bacteria 1695
98 Ga0068862_100015024 3300005844 Bacteria 6430
99 Ga0068862_100260908 3300005844 Bacteria 1582
100 Ga0068871_100008975 3300006358 Bacteria 7217
101 Ga0075428_100000528 3300006844 Bacteria 38898
102 Ga0075428_100023311 3300006844 Bacteria 6849
103 Ga0075428_100154187 3300006844 Bacteria 2495
104 Ga0075428_100166763 3300006844 Bacteria 2389
105 Ga0075430_100015053 3300006846 Bacteria 6583
106 Ga0068865_100004371 3300006881 Bacteria 8517
107 Ga0068865_100029721 3300006881 Bacteria 3629
108 Ga0068865_100209911 3300006881 Bacteria 1517
109 Ga0097620_100033784 3300006931 Bacteria 5135
110 Ga0097620_100102430 3300006931 Bacteria 2921
111 Ga0097620_100127478 3300006931 Bacteria 2615
112 Ga0097620_100245386 3300006931 Bacteria 1880
113 Ga0097620_100252341 3300006931 Bacteria 1855
114 Ga0097620_100327681 3300006931 Bacteria 1625
115 Ga0111539_10027777 3300009094 Bacteria 6911
116 Ga0111539_10316717 3300009094 Bacteria 1815
117 Ga0114129_10022948 3300009147 Bacteria 8851
118 Ga0114129_10114892 3300009147 Bacteria 3711
119 Ga0114129_10608100 3300009147 Unclassified 1415
120 Ga0105241_10311117 3300009174 Bacteria 1355
121 Ga0105242_10002760 3300009176 Bacteria 13747
122 Ga0105242_10003357 3300009176 Bacteria 12455
123 Ga0105242_10051350 3300009176 Bacteria 3360
124 Ga0105242_10067753 3300009176 Bacteria 2951
125 Ga0105242_10364375 3300009176 Bacteria 1338
126 Ga0105248_10110555 3300009177 Bacteria 3098
127 Ga0105248_10358087 3300009177 Bacteria 1643
128 Ga0105237_10004321 3300009545 Bacteria 16478
129 Ga0105249_10000561 3300009553 Bacteria 34246
130 Ga0105249_10001422 3300009553 Bacteria 20964
131 Ga0105249_10002023 3300009553 Bacteria 17609
132 Ga0105249_10032709 3300009553 Bacteria 4706
133 Ga0105249_10051202 3300009553 Bacteria 3766
134 Ga0105249_10319217 3300009553 Bacteria 1564
135 Ga0105246_10049413 3300011119 Bacteria 2880
136 Ga0105246_10115728 3300011119 Bacteria 1978
137 Ga0157370_10104885 3300013104 Bacteria 2646
138 Ga0157369_10283479 3300013105 Bacteria 1725
139 Ga0163162_10021490 3300013306 Bacteria 6357
140 Ga0163162_10116525 3300013306 Bacteria 2772
141 Ga0163162_10144966 3300013306 Bacteria 2490
142 Ga0157372_10042252 3300013307 Bacteria 5042
143 Ga0157375_10182040 3300013308 Bacteria 2253
144 Ga0157375_10184803 3300013308 Bacteria 2237
145 Ga0157375_10230537 3300013308 Unclassified 2011
146 Ga0157375_10279293 3300013308 Bacteria 1833
147 Ga0163163_10197688 3300014325 Unclassified 2059
148 Ga0163163_10253159 3300014325 Bacteria 1812
149 Ga0157380_10015227 3300014326 Bacteria 5646
150 Ga0157380_10209342 3300014326 Bacteria 1736
151 Ga0157380_10242387 3300014326 Bacteria 1626
152 Ga0157380_10301431 3300014326 Bacteria 1476
153 Ga0157380_10307338 3300014326 Unclassified 1464
154 Ga0157377_10003418 3300014745 Bacteria 7184
155 Ga0157377_10017694 3300014745 Bacteria 3691
156 Ga0157376_10245387 3300014969 Bacteria 1670
157 Ga0163161_10003969 3300017792 Bacteria 10370
158 Ga0213876_10006872 3300021384 Bacteria 6202
159 Ga0209436_103441 3300025208 Bacteria 4213
160 Ga0209130_1003981 3300025284 Bacteria 5897
161 Ga0207426_1000026 3300025302 Bacteria 515228
162 Ga0207426_1000139 3300025302 Bacteria 195835
163 Ga0209257_1000013 3300025304 Bacteria 1047305
164 Ga0207682_10049567 3300025893 Bacteria 1734
165 Ga0207688_10029493 3300025901 Bacteria 3020
166 Ga0207645_10000356 3300025907 Bacteria 37874
167 Ga0207645_10078828 3300025907 Bacteria 2111
168 Ga0207645_10121885 3300025907 Bacteria 1693
169 Ga0207643_10000864 3300025908 Bacteria 18281
170 Ga0207643_10016491 3300025908 Bacteria 4030
171 Ga0207660_10265967 3300025917 Bacteria 1357
172 Ga0207662_10012284 3300025918 Bacteria 4767
173 Ga0207662_10089036 3300025918 Bacteria 1896
174 Ga0207681_10037568 3300025923 Bacteria 3201
175 Ga0207650_10061423 3300025925 Bacteria 2806
176 Ga0207650_10065355 3300025925 Bacteria 2726
177 Ga0207650_10115010 3300025925 Bacteria 2087
178 Ga0207650_10116745 3300025925 Bacteria 2073
179 Ga0207650_10290118 3300025925 Bacteria 1334
180 Ga0207659_10015698 3300025926 Bacteria 4915
181 Ga0207659_10019046 3300025926 Bacteria 4509
182 Ga0207706_10008793 3300025933 Bacteria 9296
183 Ga0207686_10002184 3300025934 Bacteria 10766
184 Ga0207686_10002528 3300025934 Bacteria 9930
185 Ga0207686_10043956 3300025934 Bacteria 2740
186 Ga0207669_10076395 3300025937 Unclassified 2126
187 Ga0207704_10143062 3300025938 Bacteria 1676
188 Ga0207704_10215949 3300025938 Bacteria 1415
189 Ga0207691_10002055 3300025940 Bacteria 19671
190 Ga0207691_10010848 3300025940 Bacteria 8744
191 Ga0207691_10054484 3300025940 Bacteria 3648
192 Ga0207711_10102306 3300025941 Bacteria 2536
193 Ga0207689_10001418 3300025942 Bacteria 22893
194 Ga0207689_10003300 3300025942 Bacteria 14776
195 Ga0207689_10011075 3300025942 Bacteria 7750
196 Ga0207689_10011163 3300025942 Bacteria 7708
197 Ga0207689_10041536 3300025942 Unclassified 3806
198 Ga0207661_10022082 3300025944 Bacteria 4784
199 Ga0207651_10044241 3300025960 Bacteria 2978
200 Ga0207651_10105324 3300025960 Bacteria 2103
201 Ga0207712_10000442 3300025961 Bacteria 35214
202 Ga0207712_10001446 3300025961 Bacteria 16193
203 Ga0207712_10002318 3300025961 Bacteria 12370
204 Ga0207712_10011585 3300025961 Bacteria 5622
205 Ga0207712_10039401 3300025961 Bacteria 3237
206 Ga0207640_10031214 3300025981 Bacteria 3290
207 Ga0207658_10056647 3300025986 Bacteria 2910
208 Ga0207703_10043082 3300026035 Bacteria 3621
209 Ga0207639_10002203 3300026041 Bacteria 13125
210 Ga0207708_10165646 3300026075 Bacteria 1747
211 Ga0207641_10000318 3300026088 Bacteria 59432
212 Ga0207641_10077868 3300026088 Bacteria 2870
213 Ga0207641_10078174 3300026088 Bacteria 2865
214 Ga0207641_10108100 3300026088 Bacteria 2461
215 Ga0207648_10000372 3300026089 Bacteria 49262
216 Ga0207648_10005883 3300026089 Bacteria 12273
217 Ga0207648_10063064 3300026089 Bacteria 3231
218 Ga0207648_10069573 3300026089 Bacteria 3067
219 Ga0207648_10086979 3300026089 Bacteria 2727
220 Ga0207676_10063458 3300026095 Bacteria 2934
221 Ga0207676_10077238 3300026095 Bacteria 2693
222 Ga0207676_10178706 3300026095 Bacteria 1856
223 Ga0207674_10006535 3300026116 Bacteria 13706
224 Ga0207674_10088793 3300026116 Bacteria 3084
225 Ga0207674_10138216 3300026116 Bacteria 2397
226 Ga0207675_100001072 3300026118 Bacteria 27156
227 Ga0207675_100004724 3300026118 Bacteria 13114
228 Ga0207675_100034818 3300026118 Bacteria 4696
229 Ga0207675_100037486 3300026118 Bacteria 4522
230 Ga0207675_100046466 3300026118 Bacteria 4056
231 Ga0207675_100113699 3300026118 Bacteria 2556
232 Ga0207675_100307120 3300026118 Bacteria 1546
233 Ga0207675_100453552 3300026118 Bacteria 1271
234 Ga0207683_10001338 3300026121 Bacteria 22249
235 Ga0207428_10026023 3300027907 Bacteria 4888
236 Ga0207428_10233722 3300027907 Bacteria 1375
237 Ga0268266_10079735 3300028379 Bacteria 2851
238 Ga0268265_10016433 3300028380 Bacteria 5084
239 Ga0268265_10055896 3300028380 Bacteria 3000
240 Ga0268264_10182064 3300028381 Bacteria 1909
241 Ga0307515_10001389 3300028794 Bacteria 54743
242 Ga0265327_10000048 3300031251 Bacteria 269173
243 Ga0307513_10331782 3300031456 Bacteria 1275
244 Ga0307416_100340749 3300032002 Unclassified 1512
245 Ga0373936_0039144 3300035113 Bacteria 1897
246 Ga0436365_0509737 3300039437 Bacteria 16513
247 Ga0436365_1656319 3300039437 Bacteria 11225
248 Ga0451793_0933822 3300041452 Unclassified 1670
249 Ga0451804_1008878 3300041463 Bacteria 1464
250 Ga0451807_0040917 3300041486 Bacteria 1692
251 Ga0439445_0006620 3300042004 Bacteria 2667
252 Ga0439457_019446 3300042014 Bacteria 1509
253 Ga0450894_003898 3300042131 Bacteria 1951
254 Ga0439434_0058638 3300042435 Bacteria 1201
255 Ga0451577_0186986 3300042876 Bacteria 1868
256 Ga0466969_0106955 3300044656 Bacteria 1312
257 Ga0495650_0025083 3300046471 Bacteria 2802
258 Ga0495621_0036047 3300046539 Bacteria 1715
259 Ga0495672_0014316 3300047320 Bacteria 5437
260 Ga0496114_0331117 3300048917 Bacteria 1346
261 Ga0501033_0216087 3300049570 Bacteria 1366
262 Ga0501033_0310794 3300049570 Bacteria 1108
263 Ga0501034_0023917 3300049571 Bacteria 6217
264 Ga0501034_0171657 3300049571 Bacteria 2135
265 Ga0501034_0195748 3300049571 Bacteria 1981
266 Ga0501034_0379215 3300049571 Bacteria 1339
267 Ga0501036_0185318 3300049572 Bacteria 1751
268 Ga0501037_0003825 3300049573 Bacteria 10920
269 Ga0501037_0173421 3300049573 Bacteria 1532
270 Ga0501038_0018429 3300049574 Bacteria 6302
271 Ga0501043_0012691 3300049579 Bacteria 6589
272 Ga0501047_0159731 3300049581 Bacteria 2126
273 Ga0501047_0290443 3300049581 Bacteria 1479
274 Ga0501080_0150305 3300049742 Bacteria 2153
275 Ga0501080_0474951 3300049742 Bacteria 1119
276 Ga0501083_0027706 3300049744 Bacteria 3908
277 Ga0501044_0041341 3300049823 Bacteria 4798
278 Ga0501044_0066902 3300049823 Bacteria 3662
279 Ga0501044_0083232 3300049823 Bacteria 3236
280 Ga0501044_0094297 3300049823 Bacteria 3018
281 nmdc:mga0k408_178979_c1 3300050493 Bacteria 1264
282 nmdc:mga0qj67_96385_c1 3300050509 Bacteria 2382
283 nmdc:mga08y16_23624_c1 3300050511 Bacteria 6493
284 nmdc:mga08y16_308467_c1 3300050511 Bacteria 1630
285 nmdc:mga08y16_44626_c1 3300050511 Bacteria 4644
286 Ga0500568_0000080 3300053139 Bacteria 92694
287 Ga0500616_0005743 3300053153 Bacteria 8343
288 Ga0500645_004089 3300053730 Bacteria 5711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028380 Ga0268265_10055896 Ga0268265_100558962 273
2 3300049742 Ga0501080_0474951 Ga0501080_0474951_12_866 276
3 3300009177 Ga0105248_10110555 Ga0105248_101105552 283
4 3300014326 Ga0157380_10301431 Ga0157380_103014312 283
5 3300005356 Ga0070674_100212081 Ga0070674_1002120811 285
6 3300046539 Ga0495621_0036047 Ga0495621_0036047_546_1427 286
7 3300032002 Ga0307416_100340749 Ga0307416_1003407491 290
8 3300049570 Ga0501033_0310794 Ga0501033_0310794_155_1051 290
9 3300009545 Ga0105237_10004321 Ga0105237_1000432112 292
10 3300013307 Ga0157372_10042252 Ga0157372_100422524 292
11 3300003322 rootL2_10180293 rootL2_101802932 294
12 3300005471 Ga0070698_100003252 Ga0070698_1000032527 296
13 3300009174 Ga0105241_10311117 Ga0105241_103111172 298
14 3300009147 Ga0114129_10608100 Ga0114129_106081001 299
15 3300005471 Ga0070698_100000061 Ga0070698_10000006113 305
16 3300050493 nmdc:mga0k408_178979_c1 nmdc:mga0k408_178979_c1_292_1251 306
17 3300009553 Ga0105249_10001422 Ga0105249_100014228 307
18 3300026116 Ga0207674_10138216 Ga0207674_101382162 307
19 3300048917 Ga0496114_0331117 Ga0496114_0331117_313_1290 307
20 3300053730 Ga0500645_004089 Ga0500645_004089_1804_2805 307
21 3300006844 Ga0075428_100000528 Ga0075428_10000052824 308
22 3300006844 Ga0075428_100154187 Ga0075428_1001541872 308
23 3300009147 Ga0114129_10022948 Ga0114129_100229485 308
24 3300005466 Ga0070685_10104318 Ga0070685_101043182 309
25 3300005719 Ga0068861_100271366 Ga0068861_1002713662 309
26 3300025907 Ga0207645_10121885 Ga0207645_101218852 309
27 3300026118 Ga0207675_100453552 Ga0207675_1004535521 309
28 3300005328 Ga0070676_10026387 Ga0070676_100263873 310
29 3300005331 Ga0070670_100043518 Ga0070670_1000435182 310
30 3300005335 Ga0070666_10010452 Ga0070666_100104524 310
31 3300005347 Ga0070668_100049385 Ga0070668_1000493853 310
32 3300005354 Ga0070675_100281886 Ga0070675_1002818862 310
33 3300005356 Ga0070674_100093212 Ga0070674_1000932122 310
34 3300005364 Ga0070673_100006773 Ga0070673_1000067732 310
35 3300005365 Ga0070688_100070563 Ga0070688_1000705632 310
36 3300005459 Ga0068867_100007904 Ga0068867_1000079043 310
37 3300005539 Ga0068853_100002818 Ga0068853_1000028186 310
38 3300005543 Ga0070672_100034165 Ga0070672_1000341652 310
39 3300005617 Ga0068859_100252309 Ga0068859_1002523093 310
40 3300005843 Ga0068860_100058786 Ga0068860_1000587864 310
41 3300006358 Ga0068871_100008975 Ga0068871_1000089755 310
42 3300006881 Ga0068865_100004371 Ga0068865_1000043712 310
43 3300006931 Ga0097620_100252341 Ga0097620_1002523413 310
44 3300009177 Ga0105248_10358087 Ga0105248_103580872 310
45 3300011119 Ga0105246_10049413 Ga0105246_100494132 310
46 3300013308 Ga0157375_10184803 Ga0157375_101848032 310
47 3300014325 Ga0163163_10253159 Ga0163163_102531592 310
48 3300025901 Ga0207688_10029493 Ga0207688_100294931 310
49 3300025907 Ga0207645_10000356 Ga0207645_100003569 310
50 3300025925 Ga0207650_10115010 Ga0207650_101150101 310
51 3300025937 Ga0207669_10076395 Ga0207669_100763952 310
52 3300025938 Ga0207704_10143062 Ga0207704_101430622 310
53 3300025940 Ga0207691_10002055 Ga0207691_100020554 310
54 3300025942 Ga0207689_10011163 Ga0207689_100111634 310
55 3300025986 Ga0207658_10056647 Ga0207658_100566472 310
56 3300026041 Ga0207639_10002203 Ga0207639_100022036 310
57 3300026089 Ga0207648_10000372 Ga0207648_1000037239 310
58 3300026089 Ga0207648_10005883 Ga0207648_100058836 310
59 3300026118 Ga0207675_100037486 Ga0207675_1000374861 310
60 3300026118 Ga0207675_100046466 Ga0207675_1000464663 310
61 3300026121 Ga0207683_10001338 Ga0207683_100013388 310
62 3300028379 Ga0268266_10079735 Ga0268266_100797354 310
63 3300044656 Ga0466969_0106955 Ga0466969_0106955_114_1115 310
64 iso_pu_bacteria 2818991460 2819679007 310
65 iso_pu_bacteria 2929177148 2929181897 310
66 iso_pu_bacteria 2945977869 2945984293 310
67 iso_pu_bacteria 2946013367 2946016314 310
68 3300003322 rootL2_10000759 rootL2_100007592 311
69 3300042435 Ga0439434_0058638 Ga0439434_0058638_12_980 311
70 3300035113 Ga0373936_0039144 Ga0373936_0039144_179_1183 312
71 3300039437 Ga0436365_0509737 Ga0436365_0509737_11713_12720 312
72 3300042876 Ga0451577_0186986 Ga0451577_0186986_157_1149 312
73 3300049571 Ga0501034_0195748 Ga0501034_0195748_653_1654 312
74 3300049742 Ga0501080_0150305 Ga0501080_0150305_15_1016 312
75 3300049823 Ga0501044_0066902 Ga0501044_0066902_2208_3209 312
76 3300053139 Ga0500568_0000080 Ga0500568_0000080_35645_36634 312
77 3300005841 Ga0068863_100094166 Ga0068863_1000941662 313
78 3300013104 Ga0157370_10104885 Ga0157370_101048852 313
79 3300026088 Ga0207641_10078174 Ga0207641_100781742 313
80 iso_pu_bacteria 2902048731 2902050326 313
81 3300003320 rootH2_10176807 rootH2_101768074 314
82 3300003354 JGI25160J50197_1014829 JGI25160J50197_10148292 314
83 3300005329 Ga0070683_100052822 Ga0070683_1000528221 314
84 3300005535 Ga0070684_100062004 Ga0070684_1000620042 314
85 3300005564 Ga0070664_100051594 Ga0070664_1000515942 314
86 3300005578 Ga0068854_100234475 Ga0068854_1002344751 314
87 3300025208 Ga0209436_103441 Ga0209436_1034412 314
88 3300025284 Ga0209130_1003981 Ga0209130_10039813 314
89 3300025302 Ga0207426_1000139 Ga0207426_100013958 314
90 3300025944 Ga0207661_10022082 Ga0207661_100220821 314
91 3300049570 Ga0501033_0216087 Ga0501033_0216087_271_1272 314
92 3300003322 rootL2_10133552 rootL2_101335521 315
93 3300003323 rootH1_10126215 rootH1_101262152 315
94 3300003794 Ga0055531_10000029 Ga0055531_100000294 315
95 3300005578 Ga0068854_100122270 Ga0068854_1001222702 315
96 3300009176 Ga0105242_10002760 Ga0105242_100027608 315
97 3300021384 Ga0213876_10006872 Ga0213876_100068724 315
98 3300025304 Ga0209257_1000013 Ga0209257_1000013639 315
99 3300025934 Ga0207686_10002184 Ga0207686_100021846 315
100 3300026118 Ga0207675_100004724 Ga0207675_1000047242 315
101 3300039437 Ga0436365_1656319 Ga0436365_1656319_3419_4435 315
102 3300041452 Ga0451793_0933822 Ga0451793_0933822_78_1061 315
103 3300053153 Ga0500616_0005743 Ga0500616_0005743_2338_3348 315
104 3300005617 Ga0068859_100127477 Ga0068859_1001274772 316
105 3300006931 Ga0097620_100127478 Ga0097620_1001274782 316
106 3300025907 Ga0207645_10078828 Ga0207645_100788282 316
107 3300025917 Ga0207660_10265967 Ga0207660_102659672 316
108 3300002459 JGI24751J29686_10000577 JGI24751J29686_100005774 317
109 3300005331 Ga0070670_100006171 Ga0070670_1000061718 317
110 3300005577 Ga0068857_100031284 Ga0068857_1000312844 317
111 3300005577 Ga0068857_100053930 Ga0068857_1000539302 317
112 3300005843 Ga0068860_100258988 Ga0068860_1002589883 317
113 3300009553 Ga0105249_10000561 Ga0105249_100005618 317
114 3300013306 Ga0163162_10116525 Ga0163162_101165254 317
115 3300013308 Ga0157375_10230537 Ga0157375_102305372 317
116 3300014325 Ga0163163_10197688 Ga0163163_101976882 317
117 3300025925 Ga0207650_10065355 Ga0207650_100653552 317
118 3300025925 Ga0207650_10290118 Ga0207650_102901182 317
119 3300025961 Ga0207712_10002318 Ga0207712_100023184 317
120 3300025961 Ga0207712_10011585 Ga0207712_100115853 317
121 3300026116 Ga0207674_10088793 Ga0207674_100887931 317
122 3300028380 Ga0268265_10016433 Ga0268265_100164333 317
123 3300028381 Ga0268264_10182064 Ga0268264_101820642 317
124 3300028794 Ga0307515_10001389 Ga0307515_1000138952 317
125 3300046471 Ga0495650_0025083 Ga0495650_0025083_1065_2060 317
126 3300005288 Ga0065714_10083716 Ga0065714_100837162 318
127 3300005290 Ga0065712_10001405 Ga0065712_100014054 318
128 3300005290 Ga0065712_10008933 Ga0065712_100089332 318
129 3300005290 Ga0065712_10008969 Ga0065712_100089693 318
130 3300005290 Ga0065712_10088782 Ga0065712_100887821 318
131 3300005293 Ga0065715_10125918 Ga0065715_101259181 318
132 3300005295 Ga0065707_10105295 Ga0065707_101052952 318
133 3300005331 Ga0070670_100036313 Ga0070670_1000363132 318
134 3300005331 Ga0070670_100109883 Ga0070670_1001098832 318
135 3300005331 Ga0070670_100133481 Ga0070670_1001334812 318
136 3300005334 Ga0068869_100051771 Ga0068869_1000517712 318
137 3300005334 Ga0068869_100085715 Ga0068869_1000857152 318
138 3300005334 Ga0068869_100091380 Ga0068869_1000913802 318
139 3300005334 Ga0068869_100189750 Ga0068869_1001897502 318
140 3300005340 Ga0070689_100005141 Ga0070689_1000051411 318
141 3300005343 Ga0070687_100095982 Ga0070687_1000959822 318
142 3300005347 Ga0070668_100025949 Ga0070668_1000259495 318
143 3300005347 Ga0070668_100154627 Ga0070668_1001546272 318
144 3300005353 Ga0070669_100022097 Ga0070669_1000220974 318
145 3300005356 Ga0070674_100147997 Ga0070674_1001479972 318
146 3300005364 Ga0070673_100006951 Ga0070673_1000069515 318
147 3300005364 Ga0070673_100068833 Ga0070673_1000688332 318
148 3300005364 Ga0070673_100161024 Ga0070673_1001610242 318
149 3300005365 Ga0070688_100009832 Ga0070688_1000098323 318
150 3300005365 Ga0070688_100029662 Ga0070688_1000296624 318
151 3300005365 Ga0070688_100250678 Ga0070688_1002506781 318
152 3300005438 Ga0070701_10106675 Ga0070701_101066753 318
153 3300005456 Ga0070678_100390788 Ga0070678_1003907881 318
154 3300005457 Ga0070662_100062289 Ga0070662_1000622893 318
155 3300005459 Ga0068867_100064547 Ga0068867_1000645472 318
156 3300005466 Ga0070685_10002124 Ga0070685_100021246 318
157 3300005466 Ga0070685_10049298 Ga0070685_100492981 318
158 3300005471 Ga0070698_100028616 Ga0070698_1000286165 318
159 3300005539 Ga0068853_100143116 Ga0068853_1001431162 318
160 3300005543 Ga0070672_100005625 Ga0070672_1000056254 318
161 3300005543 Ga0070672_100040699 Ga0070672_1000406992 318
162 3300005544 Ga0070686_100106677 Ga0070686_1001066772 318
163 3300005549 Ga0070704_100466850 Ga0070704_1004668501 318
164 3300005617 Ga0068859_100033782 Ga0068859_1000337822 318
165 3300005617 Ga0068859_100102432 Ga0068859_1001024322 318
166 3300005617 Ga0068859_100245390 Ga0068859_1002453902 318
167 3300005617 Ga0068859_100327687 Ga0068859_1003276872 318
168 3300005618 Ga0068864_100070677 Ga0068864_1000706772 318
169 3300005618 Ga0068864_100119265 Ga0068864_1001192652 318
170 3300005719 Ga0068861_100017331 Ga0068861_1000173311 318
171 3300005719 Ga0068861_100043378 Ga0068861_1000433782 318
172 3300005719 Ga0068861_100231947 Ga0068861_1002319473 318
173 3300005840 Ga0068870_10021666 Ga0068870_100216662 318
174 3300005840 Ga0068870_10046336 Ga0068870_100463362 318
175 3300005841 Ga0068863_100017886 Ga0068863_1000178865 318
176 3300005841 Ga0068863_100082301 Ga0068863_1000823012 318
177 3300005841 Ga0068863_100309416 Ga0068863_1003094162 318
178 3300005841 Ga0068863_100517184 Ga0068863_1005171841 318
179 3300005843 Ga0068860_100075022 Ga0068860_1000750221 318
180 3300005843 Ga0068860_100102254 Ga0068860_1001022541 318
181 3300005844 Ga0068862_100015024 Ga0068862_1000150244 318
182 3300005844 Ga0068862_100260908 Ga0068862_1002609082 318
183 3300006844 Ga0075428_100166763 Ga0075428_1001667632 318
184 3300006881 Ga0068865_100029721 Ga0068865_1000297211 318
185 3300006881 Ga0068865_100209911 Ga0068865_1002099112 318
186 3300006931 Ga0097620_100033784 Ga0097620_1000337842 318
187 3300006931 Ga0097620_100102430 Ga0097620_1001024302 318
188 3300006931 Ga0097620_100245386 Ga0097620_1002453862 318
189 3300006931 Ga0097620_100327681 Ga0097620_1003276812 318
190 3300009094 Ga0111539_10027777 Ga0111539_100277774 318
191 3300009094 Ga0111539_10316717 Ga0111539_103167172 318
192 3300009176 Ga0105242_10003357 Ga0105242_100033578 318
193 3300009176 Ga0105242_10051350 Ga0105242_100513502 318
194 3300009176 Ga0105242_10067753 Ga0105242_100677534 318
195 3300009176 Ga0105242_10364375 Ga0105242_103643751 318
196 3300009553 Ga0105249_10002023 Ga0105249_100020234 318
197 3300009553 Ga0105249_10032709 Ga0105249_100327094 318
198 3300009553 Ga0105249_10051202 Ga0105249_100512023 318
199 3300009553 Ga0105249_10319217 Ga0105249_103192171 318
200 3300011119 Ga0105246_10115728 Ga0105246_101157282 318
201 3300013105 Ga0157369_10283479 Ga0157369_102834792 318
202 3300013306 Ga0163162_10021490 Ga0163162_100214903 318
203 3300013306 Ga0163162_10144966 Ga0163162_101449662 318
204 3300013308 Ga0157375_10182040 Ga0157375_101820402 318
205 3300013308 Ga0157375_10279293 Ga0157375_102792932 318
206 3300014326 Ga0157380_10015227 Ga0157380_100152272 318
207 3300014326 Ga0157380_10209342 Ga0157380_102093422 318
208 3300014326 Ga0157380_10307338 Ga0157380_103073381 318
209 3300014745 Ga0157377_10003418 Ga0157377_100034183 318
210 3300014745 Ga0157377_10017694 Ga0157377_100176943 318
211 3300014969 Ga0157376_10245387 Ga0157376_102453872 318
212 3300017792 Ga0163161_10003969 Ga0163161_100039695 318
213 3300025893 Ga0207682_10049567 Ga0207682_100495671 318
214 3300025908 Ga0207643_10000864 Ga0207643_1000086415 318
215 3300025908 Ga0207643_10016491 Ga0207643_100164912 318
216 3300025918 Ga0207662_10012284 Ga0207662_100122844 318
217 3300025918 Ga0207662_10089036 Ga0207662_100890362 318
218 3300025923 Ga0207681_10037568 Ga0207681_100375683 318
219 3300025925 Ga0207650_10061423 Ga0207650_100614233 318
220 3300025925 Ga0207650_10116745 Ga0207650_101167452 318
221 3300025926 Ga0207659_10015698 Ga0207659_100156982 318
222 3300025926 Ga0207659_10019046 Ga0207659_100190463 318
223 3300025933 Ga0207706_10008793 Ga0207706_100087936 318
224 3300025934 Ga0207686_10002528 Ga0207686_100025285 318
225 3300025934 Ga0207686_10043956 Ga0207686_100439562 318
226 3300025938 Ga0207704_10215949 Ga0207704_102159492 318
227 3300025940 Ga0207691_10010848 Ga0207691_100108483 318
228 3300025940 Ga0207691_10054484 Ga0207691_100544842 318
229 3300025941 Ga0207711_10102306 Ga0207711_101023062 318
230 3300025942 Ga0207689_10001418 Ga0207689_100014182 318
231 3300025942 Ga0207689_10003300 Ga0207689_100033008 318
232 3300025942 Ga0207689_10011075 Ga0207689_100110752 318
233 3300025942 Ga0207689_10041536 Ga0207689_100415364 318
234 3300025960 Ga0207651_10044241 Ga0207651_100442413 318
235 3300025960 Ga0207651_10105324 Ga0207651_101053242 318
236 3300025961 Ga0207712_10000442 Ga0207712_1000044232 318
237 3300025961 Ga0207712_10001446 Ga0207712_1000144615 318
238 3300025961 Ga0207712_10039401 Ga0207712_100394013 318
239 3300025981 Ga0207640_10031214 Ga0207640_100312142 318
240 3300026035 Ga0207703_10043082 Ga0207703_100430821 318
241 3300026075 Ga0207708_10165646 Ga0207708_101656462 318
242 3300026088 Ga0207641_10000318 Ga0207641_1000031817 318
243 3300026088 Ga0207641_10077868 Ga0207641_100778682 318
244 3300026088 Ga0207641_10108100 Ga0207641_101081001 318
245 3300026089 Ga0207648_10063064 Ga0207648_100630642 318
246 3300026089 Ga0207648_10069573 Ga0207648_100695732 318
247 3300026089 Ga0207648_10086979 Ga0207648_100869792 318
248 3300026095 Ga0207676_10063458 Ga0207676_100634582 318
249 3300026095 Ga0207676_10077238 Ga0207676_100772382 318
250 3300026095 Ga0207676_10178706 Ga0207676_101787062 318
251 3300026116 Ga0207674_10006535 Ga0207674_1000653510 318
252 3300026118 Ga0207675_100001072 Ga0207675_10000107220 318
253 3300026118 Ga0207675_100034818 Ga0207675_1000348184 318
254 3300026118 Ga0207675_100113699 Ga0207675_1001136992 318
255 3300026118 Ga0207675_100307120 Ga0207675_1003071202 318
256 3300027907 Ga0207428_10026023 Ga0207428_100260233 318
257 3300027907 Ga0207428_10233722 Ga0207428_102337221 318
258 3300031456 Ga0307513_10331782 Ga0307513_103317821 318
259 3300041463 Ga0451804_1008878 Ga0451804_1008878_15_1013 318
260 3300041486 Ga0451807_0040917 Ga0451807_0040917_668_1666 318
261 3300047320 Ga0495672_0014316 Ga0495672_0014316_1387_2385 318
262 3300049571 Ga0501034_0023917 Ga0501034_0023917_4859_5860 318
263 3300049572 Ga0501036_0185318 Ga0501036_0185318_54_1052 318
264 3300049573 Ga0501037_0003825 Ga0501037_0003825_696_1694 318
265 3300049573 Ga0501037_0173421 Ga0501037_0173421_381_1403 318
266 3300049574 Ga0501038_0018429 Ga0501038_0018429_1925_2923 318
267 3300049579 Ga0501043_0012691 Ga0501043_0012691_2371_3369 318
268 3300049581 Ga0501047_0159731 Ga0501047_0159731_437_1435 318
269 3300049744 Ga0501083_0027706 Ga0501083_0027706_1982_2980 318
270 3300049823 Ga0501044_0041341 Ga0501044_0041341_3105_4103 318
271 3300049823 Ga0501044_0083232 Ga0501044_0083232_91_1092 318
272 3300049823 Ga0501044_0094297 Ga0501044_0094297_259_1281 318
273 3300050511 nmdc:mga08y16_23624_c1 nmdc:mga08y16_23624_c1_3708_4706 318
274 3300050511 nmdc:mga08y16_308467_c1 nmdc:mga08y16_308467_c1_313_1311 318
275 3300050511 nmdc:mga08y16_44626_c1 nmdc:mga08y16_44626_c1_3012_4010 318
276 3300003322 rootL2_10063526 rootL2_100635262 319
277 3300042004 Ga0439445_0006620 Ga0439445_0006620_838_1845 319
278 3300042014 Ga0439457_019446 Ga0439457_019446_257_1264 319
279 3300042131 Ga0450894_003898 Ga0450894_003898_131_1138 319
280 3300014326 Ga0157380_10242387 Ga0157380_102423872 320
281 3300003320 rootH2_10119508 rootH2_101195083 322
282 3300006844 Ga0075428_100023311 Ga0075428_1000233113 323
283 3300006846 Ga0075430_100015053 Ga0075430_1000150532 323
284 3300009147 Ga0114129_10114892 Ga0114129_101148922 323
285 3300050509 nmdc:mga0qj67_96385_c1 nmdc:mga0qj67_96385_c1_591_1625 323
286 3300003354 JGI25160J50197_1000452 JGI25160J50197_100045223 324
287 3300025302 Ga0207426_1000026 Ga0207426_1000026375 324
288 3300031251 Ga0265327_10000048 Ga0265327_1000004840 326
289 3300049571 Ga0501034_0171657 Ga0501034_0171657_989_2035 326
290 3300049571 Ga0501034_0379215 Ga0501034_0379215_259_1305 326
291 3300049581 Ga0501047_0290443 Ga0501047_0290443_345_1391 326
292 3300003316 rootH1_10169734 rootH1_101697341 327
293 3300000545 CNXas_1001949 CNXas_10019491 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

111

240

0.72

PF12146

Hydrolase_4

Serine aminopeptidase, S33

163

319

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ke7-assembly1.cif.gz_A crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with an 1-myristoyl glycerol analogue 0.872 46 310
4ke6-assembly5.cif.gz_E crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.8678 46 310
4ke6-assembly5.cif.gz_E crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.8606 46 310
7e0n-assembly4.cif.gz_D crystal structure of monoacylglycerol lipase chimera 0.8591 47 312
4ke6-assembly6.cif.gz_F crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.854 46 314
ID Description Score Start End Superfamily
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8678 46 310 3.40.50.1820
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8606 46 310 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8303 47 312 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8058 47 312 3.40.50.1820
af_Q2FXG5_1_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7586 66 312 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A651GUE1-F1-model_v4 Alpha/beta hydrolase 0.9871 2 315 GO:0016787
AF-A0A519TNB5-F1-model_v4 Alpha/beta hydrolase 0.9866 67 313 GO:0016020
GO:0016787
AF-A0A4Q3TVC9-F1-model_v4 deleted 0.9854 36 312
AF-A0A1S5Y0W0-F1-model_v4 Alpha/beta hydrolase 0.9837 152 314
AF-A0A352CJ08-F1-model_v4 Alpha/beta hydrolase 0.9807 125 314 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.71 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map