F391093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 200 | 288 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0079052|Ga0451576_0079052_2142_2939 |
| Length | 265 |
| Sequence | MGSVPAVHRQAAVALLSSVEIASPPAVVADHGHSRTYNRRVFTLDRVVPWGRSFDEYRRMFALSDADLNAFILGCGDGPASFNAEATANGHSVISCDPIYRFTPDQIRQRIRDTTEVVIGQTRRNQHQFVWTSIRSIEELRDIRLASMHTFLHDFDSDNRGGRYVAAELPQLPFVNASFRLALCSHFLFLYSEQLSEDFHVAAISAMTRVADEARIFPLLTLGGARSKHVAAVSERIQRAGHAVRIEKVDYEFQRGGNEMMRVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 147 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 148 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 149 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 174 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 178 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 181 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 182 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 183 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 197 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 198 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 199 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 200 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.63 |
| Metatranscriptomes | 0 |
| Isolates | 1.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.22 |
| Nodule | 0.68 |
| Rhizoplane | 1.71 |
| Rhizosphere | 88.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13790944 | 2162886012 | Bacteria | 886 |
| 2 | JGI24740J21852_10017646 | 3300001979 | Bacteria | 2547 |
| 3 | JGI24737J22298_10000179 | 3300001990 | Bacteria | 20450 |
| 4 | JGI24735J21928_10000033 | 3300002067 | Bacteria | 70674 |
| 5 | Ga0065714_10129107 | 3300005288 | Bacteria | 1267 |
| 6 | Ga0065712_10076814 | 3300005290 | Bacteria | 3589 |
| 7 | Ga0065715_10335970 | 3300005293 | Bacteria | 975 |
| 8 | Ga0070676_10092376 | 3300005328 | Bacteria | 1856 |
| 9 | Ga0070690_100022768 | 3300005330 | Bacteria | 3836 |
| 10 | Ga0070670_100004661 | 3300005331 | Bacteria | 11503 |
| 11 | Ga0070670_100010538 | 3300005331 | Bacteria | 7891 |
| 12 | Ga0070677_10018941 | 3300005333 | Bacteria | 2487 |
| 13 | Ga0070677_10050895 | 3300005333 | Bacteria | 1675 |
| 14 | Ga0070666_10007995 | 3300005335 | Bacteria | 6540 |
| 15 | Ga0068868_100005267 | 3300005338 | Bacteria | 9079 |
| 16 | Ga0068868_100401542 | 3300005338 | Bacteria | 1183 |
| 17 | Ga0070689_100017877 | 3300005340 | Bacteria | 5212 |
| 18 | Ga0070689_100309544 | 3300005340 | Unclassified | 1317 |
| 19 | Ga0070687_100030824 | 3300005343 | Bacteria | 2624 |
| 20 | Ga0070661_100009829 | 3300005344 | Bacteria | 6635 |
| 21 | Ga0070668_100139014 | 3300005347 | Bacteria | 1956 |
| 22 | Ga0070669_100175385 | 3300005353 | Bacteria | 1674 |
| 23 | Ga0070675_100087806 | 3300005354 | Bacteria | 2601 |
| 24 | Ga0070675_100125823 | 3300005354 | Bacteria | 2180 |
| 25 | Ga0070675_100522286 | 3300005354 | Unclassified | 1071 |
| 26 | Ga0070671_100016677 | 3300005355 | Bacteria | 5939 |
| 27 | Ga0070671_100146726 | 3300005355 | Unclassified | 1991 |
| 28 | Ga0070671_100469004 | 3300005355 | Bacteria | 1081 |
| 29 | Ga0070674_100002647 | 3300005356 | Bacteria | 9911 |
| 30 | Ga0070674_100003793 | 3300005356 | Bacteria | 8537 |
| 31 | Ga0070673_100047186 | 3300005364 | Bacteria | 3350 |
| 32 | Ga0070673_100413049 | 3300005364 | Bacteria | 1209 |
| 33 | Ga0070688_100190650 | 3300005365 | Unclassified | 1428 |
| 34 | Ga0070667_100007940 | 3300005367 | Bacteria | 8802 |
| 35 | Ga0070700_100412757 | 3300005441 | Unclassified | 1018 |
| 36 | Ga0070694_100005754 | 3300005444 | Bacteria | 7524 |
| 37 | Ga0070663_100022987 | 3300005455 | Bacteria | 4174 |
| 38 | Ga0070662_100216300 | 3300005457 | Bacteria | 1527 |
| 39 | Ga0070685_10105998 | 3300005466 | Bacteria | 1724 |
| 40 | Ga0070698_100043060 | 3300005471 | Bacteria | 4630 |
| 41 | Ga0070699_100026306 | 3300005518 | Bacteria | 5019 |
| 42 | Ga0070699_100082096 | 3300005518 | Bacteria | 2809 |
| 43 | Ga0068853_100149012 | 3300005539 | Bacteria | 2105 |
| 44 | Ga0070672_100031758 | 3300005543 | Bacteria | 3978 |
| 45 | Ga0070672_100036668 | 3300005543 | Bacteria | 3736 |
| 46 | Ga0070672_100077902 | 3300005543 | Bacteria | 2652 |
| 47 | Ga0070686_100265874 | 3300005544 | Unclassified | 1259 |
| 48 | Ga0070695_100000551 | 3300005545 | Bacteria | 19830 |
| 49 | Ga0070696_100030321 | 3300005546 | Bacteria | 3702 |
| 50 | Ga0070665_100007106 | 3300005548 | Bacteria | 11378 |
| 51 | Ga0070665_100497749 | 3300005548 | Bacteria | 1230 |
| 52 | Ga0070704_100020970 | 3300005549 | Bacteria | 4226 |
| 53 | Ga0070704_100292916 | 3300005549 | Bacteria | 1353 |
| 54 | Ga0068855_100067575 | 3300005563 | Bacteria | 4163 |
| 55 | Ga0070664_100073355 | 3300005564 | Bacteria | 2936 |
| 56 | Ga0070664_100165864 | 3300005564 | Bacteria | 1957 |
| 57 | Ga0070664_100267075 | 3300005564 | Unclassified | 1540 |
| 58 | Ga0068857_100281413 | 3300005577 | Bacteria | 1530 |
| 59 | Ga0070702_100158088 | 3300005615 | Bacteria | 1462 |
| 60 | Ga0068859_100102945 | 3300005617 | Bacteria | 2913 |
| 61 | Ga0068864_100042977 | 3300005618 | Bacteria | 3868 |
| 62 | Ga0068864_100106411 | 3300005618 | Bacteria | 2494 |
| 63 | Ga0068864_100525348 | 3300005618 | Unclassified | 1141 |
| 64 | Ga0068866_10310908 | 3300005718 | Unclassified | 988 |
| 65 | Ga0068861_100197676 | 3300005719 | Bacteria | 1685 |
| 66 | Ga0068861_100485723 | 3300005719 | Bacteria | 1114 |
| 67 | Ga0068870_10154263 | 3300005840 | Bacteria | 1355 |
| 68 | Ga0068863_100047807 | 3300005841 | Bacteria | 4057 |
| 69 | Ga0068863_100183660 | 3300005841 | Unclassified | 2008 |
| 70 | Ga0068863_101140800 | 3300005841 | Unclassified | 785 |
| 71 | Ga0068860_100410648 | 3300005843 | Unclassified | 1341 |
| 72 | Ga0075368_10020064 | 3300006042 | Bacteria | 2528 |
| 73 | Ga0075364_10010777 | 3300006051 | Bacteria | 5531 |
| 74 | Ga0075362_10001240 | 3300006177 | Bacteria | 8049 |
| 75 | Ga0075367_10000983 | 3300006178 | Bacteria | 11664 |
| 76 | Ga0075367_10052636 | 3300006178 | Bacteria | 2410 |
| 77 | Ga0075367_10136750 | 3300006178 | Bacteria | 1516 |
| 78 | Ga0075366_10005435 | 3300006195 | Bacteria | 6902 |
| 79 | Ga0075366_10012700 | 3300006195 | Bacteria | 4784 |
| 80 | Ga0075366_10022493 | 3300006195 | Bacteria | 3668 |
| 81 | Ga0075366_10025354 | 3300006195 | Bacteria | 3462 |
| 82 | Ga0075366_10064713 | 3300006195 | Bacteria | 2175 |
| 83 | Ga0097621_100209209 | 3300006237 | Bacteria | 1696 |
| 84 | Ga0075370_10285928 | 3300006353 | Unclassified | 980 |
| 85 | Ga0068871_100187710 | 3300006358 | Bacteria | 1779 |
| 86 | Ga0068871_100262592 | 3300006358 | Bacteria | 1506 |
| 87 | Ga0075428_100001856 | 3300006844 | Bacteria | 22643 |
| 88 | Ga0075428_100587467 | 3300006844 | Bacteria | 1190 |
| 89 | Ga0075430_100007933 | 3300006846 | Bacteria | 8976 |
| 90 | Ga0075431_100000788 | 3300006847 | Bacteria | 27634 |
| 91 | Ga0075431_100013782 | 3300006847 | Bacteria | 8164 |
| 92 | Ga0075431_100311674 | 3300006847 | Bacteria | 1588 |
| 93 | Ga0075433_10077678 | 3300006852 | Bacteria | 2924 |
| 94 | Ga0075429_100004074 | 3300006880 | Bacteria | 12526 |
| 95 | Ga0068865_100091511 | 3300006881 | Bacteria | 2208 |
| 96 | Ga0068865_100123520 | 3300006881 | Bacteria | 1929 |
| 97 | Ga0097620_100102937 | 3300006931 | Bacteria | 2913 |
| 98 | Ga0079104_1000137 | 3300006946 | Bacteria | 103232 |
| 99 | Ga0111539_10001068 | 3300009094 | Bacteria | 36134 |
| 100 | Ga0105245_10794430 | 3300009098 | Unclassified | 984 |
| 101 | Ga0105247_10375836 | 3300009101 | Unclassified | 1006 |
| 102 | Ga0114129_10000705 | 3300009147 | Bacteria | 42129 |
| 103 | Ga0114129_10068789 | 3300009147 | Bacteria | 4936 |
| 104 | Ga0114129_10290336 | 3300009147 | Bacteria | 2183 |
| 105 | Ga0105243_10010029 | 3300009148 | Bacteria | 7204 |
| 106 | Ga0105248_10006489 | 3300009177 | Bacteria | 12828 |
| 107 | Ga0105248_10058103 | 3300009177 | Bacteria | 4343 |
| 108 | Ga0105248_10320057 | 3300009177 | Bacteria | 1747 |
| 109 | Ga0105237_10106592 | 3300009545 | Bacteria | 2794 |
| 110 | Ga0105237_10326248 | 3300009545 | Unclassified | 1539 |
| 111 | Ga0105249_10034583 | 3300009553 | Bacteria | 4581 |
| 112 | Ga0105249_10823221 | 3300009553 | Bacteria | 993 |
| 113 | Ga0105239_10138069 | 3300010375 | Bacteria | 2714 |
| 114 | Ga0157371_10004552 | 3300013102 | Bacteria | 12066 |
| 115 | Ga0157370_10057043 | 3300013104 | Unclassified | 3715 |
| 116 | Ga0157370_10650946 | 3300013104 | Bacteria | 963 |
| 117 | Ga0157369_10204303 | 3300013105 | Bacteria | 2072 |
| 118 | Ga0157369_10215079 | 3300013105 | Bacteria | 2013 |
| 119 | Ga0157369_10442338 | 3300013105 | Bacteria | 1346 |
| 120 | Ga0157369_10568148 | 3300013105 | Bacteria | 1172 |
| 121 | Ga0157374_10159806 | 3300013296 | Bacteria | 2195 |
| 122 | Ga0163162_10005760 | 3300013306 | Bacteria | 11987 |
| 123 | Ga0163162_10160161 | 3300013306 | Bacteria | 2372 |
| 124 | Ga0157372_10000016 | 3300013307 | Bacteria | 220177 |
| 125 | Ga0157372_10000677 | 3300013307 | Bacteria | 37495 |
| 126 | Ga0157375_10033686 | 3300013308 | Bacteria | 4871 |
| 127 | Ga0157375_10072524 | 3300013308 | Bacteria | 3460 |
| 128 | Ga0157375_10222862 | 3300013308 | Bacteria | 2044 |
| 129 | Ga0163163_10031136 | 3300014325 | Bacteria | 5147 |
| 130 | Ga0163163_10035142 | 3300014325 | Bacteria | 4860 |
| 131 | Ga0163163_10104647 | 3300014325 | Bacteria | 2856 |
| 132 | Ga0157377_10049857 | 3300014745 | Bacteria | 2355 |
| 133 | Ga0157376_10056525 | 3300014969 | Unclassified | 3278 |
| 134 | Ga0157376_11082599 | 3300014969 | Unclassified | 827 |
| 135 | Ga0207682_10006359 | 3300025893 | Bacteria | 4766 |
| 136 | Ga0207682_10046253 | 3300025893 | Bacteria | 1788 |
| 137 | Ga0207680_10050909 | 3300025903 | Bacteria | 2474 |
| 138 | Ga0207647_10013253 | 3300025904 | Bacteria | 5722 |
| 139 | Ga0207645_10539461 | 3300025907 | Bacteria | 791 |
| 140 | Ga0207643_10071174 | 3300025908 | Bacteria | 2001 |
| 141 | Ga0207649_10159444 | 3300025920 | Unclassified | 1562 |
| 142 | Ga0207650_10030291 | 3300025925 | Bacteria | 3896 |
| 143 | Ga0207650_10036554 | 3300025925 | Bacteria | 3573 |
| 144 | Ga0207687_10363344 | 3300025927 | Unclassified | 1182 |
| 145 | Ga0207644_10090827 | 3300025931 | Bacteria | 2276 |
| 146 | Ga0207644_10142757 | 3300025931 | Bacteria | 1845 |
| 147 | Ga0207706_10272091 | 3300025933 | Unclassified | 1478 |
| 148 | Ga0207686_10153660 | 3300025934 | Bacteria | 1605 |
| 149 | Ga0207709_10027054 | 3300025935 | Bacteria | 3300 |
| 150 | Ga0207670_10051029 | 3300025936 | Bacteria | 2775 |
| 151 | Ga0207670_10084628 | 3300025936 | Unclassified | 2227 |
| 152 | Ga0207669_10005088 | 3300025937 | Bacteria | 5857 |
| 153 | Ga0207669_10065668 | 3300025937 | Bacteria | 2252 |
| 154 | Ga0207669_10066866 | 3300025937 | Bacteria | 2237 |
| 155 | Ga0207669_10094700 | 3300025937 | Bacteria | 1955 |
| 156 | Ga0207704_10031233 | 3300025938 | Bacteria | 2998 |
| 157 | Ga0207691_10020475 | 3300025940 | Bacteria | 6254 |
| 158 | Ga0207691_10029909 | 3300025940 | Bacteria | 5094 |
| 159 | Ga0207711_10285903 | 3300025941 | Unclassified | 1519 |
| 160 | Ga0207711_10695282 | 3300025941 | Bacteria | 948 |
| 161 | Ga0207679_10014958 | 3300025945 | Bacteria | 5114 |
| 162 | Ga0207679_10017000 | 3300025945 | Bacteria | 4839 |
| 163 | Ga0207667_10205499 | 3300025949 | Bacteria | 2019 |
| 164 | Ga0207651_10030942 | 3300025960 | Bacteria | 3415 |
| 165 | Ga0207651_10042376 | 3300025960 | Bacteria | 3029 |
| 166 | Ga0207651_10215496 | 3300025960 | Bacteria | 1549 |
| 167 | Ga0207712_10183203 | 3300025961 | Bacteria | 1647 |
| 168 | Ga0207668_10279565 | 3300025972 | Bacteria | 1368 |
| 169 | Ga0207668_10557599 | 3300025972 | Unclassified | 993 |
| 170 | Ga0207658_10192510 | 3300025986 | Unclassified | 1696 |
| 171 | Ga0207677_10002464 | 3300026023 | Bacteria | 9729 |
| 172 | Ga0207677_10133918 | 3300026023 | Bacteria | 1886 |
| 173 | Ga0207703_10084593 | 3300026035 | Bacteria | 2653 |
| 174 | Ga0207639_10022443 | 3300026041 | Bacteria | 4547 |
| 175 | Ga0207678_10041725 | 3300026067 | Bacteria | 3978 |
| 176 | Ga0207678_10075842 | 3300026067 | Bacteria | 2880 |
| 177 | Ga0207708_10160059 | 3300026075 | Bacteria | 1777 |
| 178 | Ga0207708_10279335 | 3300026075 | Unclassified | 1353 |
| 179 | Ga0207641_10556826 | 3300026088 | Bacteria | 1119 |
| 180 | Ga0207648_10792315 | 3300026089 | Unclassified | 882 |
| 181 | Ga0207676_10011460 | 3300026095 | Bacteria | 6337 |
| 182 | Ga0207675_100213629 | 3300026118 | Bacteria | 1856 |
| 183 | Ga0207683_10030843 | 3300026121 | Bacteria | 4648 |
| 184 | Ga0209281_1000157 | 3300027111 | Bacteria | 162755 |
| 185 | Ga0209813_10130127 | 3300027866 | Bacteria | 885 |
| 186 | Ga0268266_10537279 | 3300028379 | Unclassified | 1119 |
| 187 | Ga0268264_10425882 | 3300028381 | Bacteria | 1281 |
| 188 | Ga0307515_10006153 | 3300028794 | Bacteria | 24121 |
| 189 | Ga0265338_10036318 | 3300028800 | Unclassified | 4718 |
| 190 | Ga0307408_100013270 | 3300031548 | Bacteria | 5468 |
| 191 | Ga0307408_100035165 | 3300031548 | Bacteria | 3514 |
| 192 | Ga0316578_10055840 | 3300031728 | Unclassified | 2318 |
| 193 | Ga0307413_10072143 | 3300031824 | Bacteria | 2179 |
| 194 | Ga0307410_10095054 | 3300031852 | Bacteria | 2124 |
| 195 | Ga0307410_10469634 | 3300031852 | Unclassified | 1030 |
| 196 | Ga0307412_10036435 | 3300031911 | Bacteria | 3152 |
| 197 | Ga0307412_10528529 | 3300031911 | Bacteria | 987 |
| 198 | Ga0307416_100006741 | 3300032002 | Bacteria | 7220 |
| 199 | Ga0307416_100160799 | 3300032002 | Bacteria | 2076 |
| 200 | Ga0307416_100178226 | 3300032002 | Bacteria | 1988 |
| 201 | Ga0307416_100888250 | 3300032002 | Bacteria | 991 |
| 202 | Ga0373953_0077443 | 3300035117 | Bacteria | 1379 |
| 203 | Ga0373954_0163696 | 3300035118 | Bacteria | 1089 |
| 204 | Ga0373943_0012798 | 3300035170 | Bacteria | 3782 |
| 205 | Ga0373955_0006694 | 3300035172 | Bacteria | 5259 |
| 206 | Ga0373955_0035569 | 3300035172 | Bacteria | 2638 |
| 207 | Ga0373924_0093265 | 3300035410 | Bacteria | 1289 |
| 208 | Ga0373933_0050988 | 3300035724 | Bacteria | 2472 |
| 209 | Ga0373933_0274801 | 3300035724 | Bacteria | 1088 |
| 210 | Ga0373947_0041041 | 3300035725 | Bacteria | 2758 |
| 211 | Ga0373937_0001245 | 3300036401 | Bacteria | 21424 |
| 212 | Ga0373937_0088325 | 3300036401 | Bacteria | 2870 |
| 213 | Ga0373937_1079950 | 3300036401 | Unclassified | 751 |
| 214 | Ga0373925_0007310 | 3300037068 | Bacteria | 8067 |
| 215 | Ga0395899_0000283 | 3300037312 | Bacteria | 65893 |
| 216 | Ga0436364_0217346 | 3300037853 | Bacteria | 3500 |
| 217 | Ga0451791_0654446 | 3300041451 | Bacteria | 1695 |
| 218 | Ga0451797_0549656 | 3300041453 | Bacteria | 963 |
| 219 | Ga0450907_015214 | 3300042146 | Bacteria | 1284 |
| 220 | Ga0450908_000173 | 3300042184 | Bacteria | 13512 |
| 221 | Ga0439464_0021787 | 3300042439 | Bacteria | 1760 |
| 222 | Ga0466961_0004051 | 3300044693 | Bacteria | 9182 |
| 223 | Ga0466959_0092557 | 3300045049 | Bacteria | 2170 |
| 224 | Ga0451576_0053846 | 3300045051 | Bacteria | 4213 |
| 225 | Ga0451576_0079052 | 3300045051 | Bacteria | 3422 |
| 226 | Ga0451576_0318119 | 3300045051 | Unclassified | 1628 |
| 227 | Ga0495592_0040018 | 3300046454 | Bacteria | 3519 |
| 228 | Ga0495629_0239593 | 3300046459 | Bacteria | 1249 |
| 229 | Ga0495662_0013922 | 3300046476 | Unclassified | 3916 |
| 230 | Ga0495608_0022613 | 3300046511 | Bacteria | 4312 |
| 231 | Ga0495618_0468015 | 3300046514 | Bacteria | 763 |
| 232 | Ga0495648_0013174 | 3300046524 | Bacteria | 6129 |
| 233 | Ga0495621_0009094 | 3300046539 | Unclassified | 3004 |
| 234 | Ga0495667_0000406 | 3300046559 | Bacteria | 27651 |
| 235 | Ga0495668_0000073 | 3300046616 | Bacteria | 166105 |
| 236 | Ga0495634_0134501 | 3300046642 | Bacteria | 1574 |
| 237 | Ga0495657_0001815 | 3300046675 | Bacteria | 18247 |
| 238 | Ga0495599_0048646 | 3300046678 | Bacteria | 2658 |
| 239 | Ga0495647_0033200 | 3300046681 | Bacteria | 1928 |
| 240 | Ga0495658_0038264 | 3300046683 | Bacteria | 2656 |
| 241 | Ga0495613_0044931 | 3300046689 | Unclassified | 3267 |
| 242 | Ga0495613_0168364 | 3300046689 | Bacteria | 1556 |
| 243 | Ga0495674_0020105 | 3300047319 | Bacteria | 6186 |
| 244 | Ga0495674_0224226 | 3300047319 | Bacteria | 1553 |
| 245 | Ga0495675_0117189 | 3300047444 | Bacteria | 1660 |
| 246 | Ga0495684_0179070 | 3300047471 | Bacteria | 1572 |
| 247 | Ga0495684_0350978 | 3300047471 | Bacteria | 1047 |
| 248 | Ga0496110_0142883 | 3300048913 | Bacteria | 2164 |
| 249 | Ga0496115_0174379 | 3300048918 | Bacteria | 1778 |
| 250 | Ga0501292_012596 | 3300049515 | Bacteria | 1292 |
| 251 | Ga0501067_0192128 | 3300049583 | Bacteria | 1137 |
| 252 | Ga0501073_0181252 | 3300049589 | Unclassified | 1457 |
| 253 | Ga0501208_037662 | 3300049655 | Bacteria | 882 |
| 254 | Ga0501235_019500 | 3300049669 | Unclassified | 1505 |
| 255 | Ga0501249_012605 | 3300049679 | Bacteria | 1788 |
| 256 | Ga0501083_0010520 | 3300049744 | Bacteria | 6510 |
| 257 | Ga0501204_023555 | 3300049850 | Unclassified | 818 |
| 258 | Ga0501212_002626 | 3300049851 | Bacteria | 2185 |
| 259 | nmdc:mga03683_13449_c1 | 3300050489 | Bacteria | 3013 |
| 260 | nmdc:mga03n38_162941_c1 | 3300050490 | Unclassified | 1130 |
| 261 | nmdc:mga00v17_14576_c1 | 3300050491 | Bacteria | 4392 |
| 262 | nmdc:mga0k408_18330_c1 | 3300050493 | Bacteria | 3906 |
| 263 | nmdc:mga0k408_21901_c1 | 3300050493 | Bacteria | 3594 |
| 264 | nmdc:mga0k408_25714_c1 | 3300050493 | Bacteria | 3335 |
| 265 | nmdc:mga0k408_8520_c1 | 3300050493 | Bacteria | 5508 |
| 266 | nmdc:mga06z11_16813_c1 | 3300050494 | Bacteria | 3305 |
| 267 | nmdc:mga06z11_46848_c1 | 3300050494 | Bacteria | 2193 |
| 268 | nmdc:mga07m45_215337_c1 | 3300050496 | Unclassified | 1117 |
| 269 | nmdc:mga05p37_18555_c1 | 3300050507 | Bacteria | 8407 |
| 270 | nmdc:mga05p37_219291_c1 | 3300050507 | Unclassified | 2296 |
| 271 | nmdc:mga05p37_27106_c1 | 3300050507 | Bacteria | 6974 |
| 272 | nmdc:mga05p37_8349_c1 | 3300050507 | Bacteria | 12245 |
| 273 | nmdc:mga09592_15245_c1 | 3300050508 | Bacteria | 6279 |
| 274 | nmdc:mga09592_210501_c1 | 3300050508 | Unclassified | 1684 |
| 275 | nmdc:mga09592_60038_c1 | 3300050508 | Bacteria | 3214 |
| 276 | nmdc:mga0qj67_2732_c1 | 3300050509 | Bacteria | 12650 |
| 277 | nmdc:mga06r32_1087_c1 | 3300050510 | Bacteria | 24370 |
| 278 | nmdc:mga06r32_19115_c1 | 3300050510 | Bacteria | 6285 |
| 279 | nmdc:mga08y16_11972_c1 | 3300050511 | Bacteria | 9110 |
| 280 | nmdc:mga0n895_28981_c1 | 3300050512 | Bacteria | 5274 |
| 281 | nmdc:mga0n895_769800_c1 | 3300050512 | Bacteria | 955 |
| 282 | nmdc:mga0a205_95821_c1 | 3300050515 | Bacteria | 2866 |
| 283 | Ga0495619_0045551 | 3300053085 | Bacteria | 2882 |
| 284 | Ga0500647_0193543 | 3300053091 | Bacteria | 926 |
| 285 | Ga0590074_002452 | 3300059423 | Bacteria | 3041 |
| 286 | Ga0590075_000504 | 3300059424 | Bacteria | 10599 |
| 287 | Ga0590077_000037 | 3300059426 | Bacteria | 30721 |
| 288 | Ga0501082_0285601 | 3300060353 | Unclassified | 1436 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0239593 | Ga0495629_0239593_579_1196 | 204 |
| 2 | 3300014969 | Ga0157376_10056525 | Ga0157376_100565252 | 206 |
| 3 | 3300036401 | Ga0373937_1079950 | Ga0373937_1079950_106_738 | 206 |
| 4 | 3300048918 | Ga0496115_0174379 | Ga0496115_0174379_179_811 | 206 |
| 5 | 3300049515 | Ga0501292_012596 | Ga0501292_012596_57_689 | 206 |
| 6 | 3300049669 | Ga0501235_019500 | Ga0501235_019500_199_831 | 206 |
| 7 | 3300049850 | Ga0501204_023555 | Ga0501204_023555_83_715 | 206 |
| 8 | 3300050493 | nmdc:mga0k408_25714_c1 | nmdc:mga0k408_25714_c1_1151_1789 | 211 |
| 9 | 3300025927 | Ga0207687_10363344 | Ga0207687_103633442 | 213 |
| 10 | 3300006847 | Ga0075431_100311674 | Ga0075431_1003116742 | 220 |
| 11 | iso_pu_bacteria | 2599185184 | 2599481812 | 220 |
| 12 | iso_pu_bacteria | 2928078545 | 2928083963 | 220 |
| 13 | iso_pu_bacteria | 2928147474 | 2928152889 | 220 |
| 14 | iso_pu_bacteria | 2932082852 | 2932086046 | 220 |
| 15 | 3300001979 | JGI24740J21852_10017646 | JGI24740J21852_100176464 | 223 |
| 16 | 3300001990 | JGI24737J22298_10000179 | JGI24737J22298_1000017915 | 223 |
| 17 | 3300002067 | JGI24735J21928_10000033 | JGI24735J21928_1000003328 | 223 |
| 18 | 3300005455 | Ga0070663_100022987 | Ga0070663_1000229873 | 223 |
| 19 | 3300005539 | Ga0068853_100149012 | Ga0068853_1001490122 | 223 |
| 20 | 3300005563 | Ga0068855_100067575 | Ga0068855_1000675753 | 223 |
| 21 | 3300006195 | Ga0075366_10005435 | Ga0075366_100054353 | 223 |
| 22 | 3300006946 | Ga0079104_1000137 | Ga0079104_100013754 | 223 |
| 23 | 3300009545 | Ga0105237_10106592 | Ga0105237_101065922 | 223 |
| 24 | 3300010375 | Ga0105239_10138069 | Ga0105239_101380694 | 223 |
| 25 | 3300013102 | Ga0157371_10004552 | Ga0157371_100045524 | 223 |
| 26 | 3300013104 | Ga0157370_10650946 | Ga0157370_106509461 | 223 |
| 27 | 3300013105 | Ga0157369_10204303 | Ga0157369_102043033 | 223 |
| 28 | 3300013105 | Ga0157369_10215079 | Ga0157369_102150794 | 223 |
| 29 | 3300013307 | Ga0157372_10000016 | Ga0157372_10000016155 | 223 |
| 30 | 3300013307 | Ga0157372_10000677 | Ga0157372_1000067714 | 223 |
| 31 | 3300025904 | Ga0207647_10013253 | Ga0207647_100132532 | 223 |
| 32 | 3300025949 | Ga0207667_10205499 | Ga0207667_102054993 | 223 |
| 33 | 3300026041 | Ga0207639_10022443 | Ga0207639_100224436 | 223 |
| 34 | 3300026067 | Ga0207678_10075842 | Ga0207678_100758424 | 223 |
| 35 | 3300027111 | Ga0209281_1000157 | Ga0209281_1000157121 | 223 |
| 36 | 3300028794 | Ga0307515_10006153 | Ga0307515_1000615318 | 223 |
| 37 | 3300028800 | Ga0265338_10036318 | Ga0265338_100363183 | 223 |
| 38 | 3300037312 | Ga0395899_0000283 | Ga0395899_0000283_41300_41998 | 223 |
| 39 | 3300037853 | Ga0436364_0217346 | Ga0436364_0217346_1605_2279 | 223 |
| 40 | 3300044693 | Ga0466961_0004051 | Ga0466961_0004051_6801_7499 | 223 |
| 41 | 3300045049 | Ga0466959_0092557 | Ga0466959_0092557_1404_2102 | 223 |
| 42 | 3300046524 | Ga0495648_0013174 | Ga0495648_0013174_847_1524 | 223 |
| 43 | 3300046616 | Ga0495668_0000073 | Ga0495668_0000073_11136_11813 | 223 |
| 44 | 3300046683 | Ga0495658_0038264 | Ga0495658_0038264_469_1146 | 223 |
| 45 | 3300050493 | nmdc:mga0k408_21901_c1 | nmdc:mga0k408_21901_c1_816_1499 | 223 |
| 46 | 3300053091 | Ga0500647_0193543 | Ga0500647_0193543_22_699 | 223 |
| 47 | 3300028381 | Ga0268264_10425882 | Ga0268264_104258823 | 224 |
| 48 | 3300031911 | Ga0307412_10528529 | Ga0307412_105285292 | 224 |
| 49 | 3300032002 | Ga0307416_100888250 | Ga0307416_1008882502 | 224 |
| 50 | 3300045051 | Ga0451576_0318119 | Ga0451576_0318119_346_1023 | 224 |
| 51 | 3300053085 | Ga0495619_0045551 | Ga0495619_0045551_224_904 | 224 |
| 52 | 2162886012 | MBSR1b_contig_13790944 | MBSR1b_0901.00000190 | 225 |
| 53 | 3300005288 | Ga0065714_10129107 | Ga0065714_101291072 | 225 |
| 54 | 3300005290 | Ga0065712_10076814 | Ga0065712_100768142 | 225 |
| 55 | 3300005293 | Ga0065715_10335970 | Ga0065715_103359701 | 225 |
| 56 | 3300005328 | Ga0070676_10092376 | Ga0070676_100923761 | 225 |
| 57 | 3300005330 | Ga0070690_100022768 | Ga0070690_1000227683 | 225 |
| 58 | 3300005331 | Ga0070670_100004661 | Ga0070670_1000046619 | 225 |
| 59 | 3300005331 | Ga0070670_100010538 | Ga0070670_1000105385 | 225 |
| 60 | 3300005333 | Ga0070677_10018941 | Ga0070677_100189412 | 225 |
| 61 | 3300005333 | Ga0070677_10050895 | Ga0070677_100508953 | 225 |
| 62 | 3300005335 | Ga0070666_10007995 | Ga0070666_100079952 | 225 |
| 63 | 3300005338 | Ga0068868_100005267 | Ga0068868_1000052672 | 225 |
| 64 | 3300005338 | Ga0068868_100401542 | Ga0068868_1004015421 | 225 |
| 65 | 3300005340 | Ga0070689_100017877 | Ga0070689_1000178774 | 225 |
| 66 | 3300005340 | Ga0070689_100309544 | Ga0070689_1003095442 | 225 |
| 67 | 3300005343 | Ga0070687_100030824 | Ga0070687_1000308242 | 225 |
| 68 | 3300005344 | Ga0070661_100009829 | Ga0070661_1000098294 | 225 |
| 69 | 3300005347 | Ga0070668_100139014 | Ga0070668_1001390141 | 225 |
| 70 | 3300005353 | Ga0070669_100175385 | Ga0070669_1001753852 | 225 |
| 71 | 3300005354 | Ga0070675_100087806 | Ga0070675_1000878062 | 225 |
| 72 | 3300005354 | Ga0070675_100125823 | Ga0070675_1001258232 | 225 |
| 73 | 3300005354 | Ga0070675_100522286 | Ga0070675_1005222861 | 225 |
| 74 | 3300005355 | Ga0070671_100016677 | Ga0070671_1000166772 | 225 |
| 75 | 3300005355 | Ga0070671_100146726 | Ga0070671_1001467262 | 225 |
| 76 | 3300005355 | Ga0070671_100469004 | Ga0070671_1004690042 | 225 |
| 77 | 3300005356 | Ga0070674_100002647 | Ga0070674_10000264710 | 225 |
| 78 | 3300005356 | Ga0070674_100003793 | Ga0070674_1000037932 | 225 |
| 79 | 3300005364 | Ga0070673_100047186 | Ga0070673_1000471862 | 225 |
| 80 | 3300005364 | Ga0070673_100413049 | Ga0070673_1004130491 | 225 |
| 81 | 3300005365 | Ga0070688_100190650 | Ga0070688_1001906501 | 225 |
| 82 | 3300005367 | Ga0070667_100007940 | Ga0070667_1000079407 | 225 |
| 83 | 3300005441 | Ga0070700_100412757 | Ga0070700_1004127572 | 225 |
| 84 | 3300005444 | Ga0070694_100005754 | Ga0070694_1000057547 | 225 |
| 85 | 3300005457 | Ga0070662_100216300 | Ga0070662_1002163002 | 225 |
| 86 | 3300005466 | Ga0070685_10105998 | Ga0070685_101059982 | 225 |
| 87 | 3300005471 | Ga0070698_100043060 | Ga0070698_1000430603 | 225 |
| 88 | 3300005518 | Ga0070699_100026306 | Ga0070699_1000263063 | 225 |
| 89 | 3300005518 | Ga0070699_100082096 | Ga0070699_1000820963 | 225 |
| 90 | 3300005543 | Ga0070672_100031758 | Ga0070672_1000317583 | 225 |
| 91 | 3300005543 | Ga0070672_100036668 | Ga0070672_1000366683 | 225 |
| 92 | 3300005543 | Ga0070672_100077902 | Ga0070672_1000779022 | 225 |
| 93 | 3300005544 | Ga0070686_100265874 | Ga0070686_1002658742 | 225 |
| 94 | 3300005545 | Ga0070695_100000551 | Ga0070695_10000055116 | 225 |
| 95 | 3300005546 | Ga0070696_100030321 | Ga0070696_1000303213 | 225 |
| 96 | 3300005548 | Ga0070665_100007106 | Ga0070665_1000071064 | 225 |
| 97 | 3300005548 | Ga0070665_100497749 | Ga0070665_1004977492 | 225 |
| 98 | 3300005549 | Ga0070704_100020970 | Ga0070704_1000209703 | 225 |
| 99 | 3300005549 | Ga0070704_100292916 | Ga0070704_1002929161 | 225 |
| 100 | 3300005564 | Ga0070664_100073355 | Ga0070664_1000733552 | 225 |
| 101 | 3300005564 | Ga0070664_100165864 | Ga0070664_1001658643 | 225 |
| 102 | 3300005564 | Ga0070664_100267075 | Ga0070664_1002670752 | 225 |
| 103 | 3300005577 | Ga0068857_100281413 | Ga0068857_1002814132 | 225 |
| 104 | 3300005615 | Ga0070702_100158088 | Ga0070702_1001580882 | 225 |
| 105 | 3300005617 | Ga0068859_100102945 | Ga0068859_1001029452 | 225 |
| 106 | 3300005618 | Ga0068864_100042977 | Ga0068864_1000429774 | 225 |
| 107 | 3300005618 | Ga0068864_100106411 | Ga0068864_1001064112 | 225 |
| 108 | 3300005618 | Ga0068864_100525348 | Ga0068864_1005253481 | 225 |
| 109 | 3300005718 | Ga0068866_10310908 | Ga0068866_103109081 | 225 |
| 110 | 3300005719 | Ga0068861_100197676 | Ga0068861_1001976762 | 225 |
| 111 | 3300005719 | Ga0068861_100485723 | Ga0068861_1004857232 | 225 |
| 112 | 3300005840 | Ga0068870_10154263 | Ga0068870_101542632 | 225 |
| 113 | 3300005841 | Ga0068863_100047807 | Ga0068863_1000478074 | 225 |
| 114 | 3300005841 | Ga0068863_100183660 | Ga0068863_1001836602 | 225 |
| 115 | 3300005841 | Ga0068863_101140800 | Ga0068863_1011408001 | 225 |
| 116 | 3300005843 | Ga0068860_100410648 | Ga0068860_1004106482 | 225 |
| 117 | 3300006042 | Ga0075368_10020064 | Ga0075368_100200644 | 225 |
| 118 | 3300006051 | Ga0075364_10010777 | Ga0075364_100107772 | 225 |
| 119 | 3300006177 | Ga0075362_10001240 | Ga0075362_100012404 | 225 |
| 120 | 3300006178 | Ga0075367_10000983 | Ga0075367_1000098310 | 225 |
| 121 | 3300006178 | Ga0075367_10052636 | Ga0075367_100526363 | 225 |
| 122 | 3300006178 | Ga0075367_10136750 | Ga0075367_101367502 | 225 |
| 123 | 3300006195 | Ga0075366_10012700 | Ga0075366_100127006 | 225 |
| 124 | 3300006195 | Ga0075366_10022493 | Ga0075366_100224932 | 225 |
| 125 | 3300006195 | Ga0075366_10025354 | Ga0075366_100253542 | 225 |
| 126 | 3300006195 | Ga0075366_10064713 | Ga0075366_100647133 | 225 |
| 127 | 3300006237 | Ga0097621_100209209 | Ga0097621_1002092092 | 225 |
| 128 | 3300006353 | Ga0075370_10285928 | Ga0075370_102859282 | 225 |
| 129 | 3300006358 | Ga0068871_100187710 | Ga0068871_1001877102 | 225 |
| 130 | 3300006358 | Ga0068871_100262592 | Ga0068871_1002625922 | 225 |
| 131 | 3300006844 | Ga0075428_100001856 | Ga0075428_10000185611 | 225 |
| 132 | 3300006844 | Ga0075428_100587467 | Ga0075428_1005874672 | 225 |
| 133 | 3300006846 | Ga0075430_100007933 | Ga0075430_1000079332 | 225 |
| 134 | 3300006847 | Ga0075431_100000788 | Ga0075431_10000078819 | 225 |
| 135 | 3300006847 | Ga0075431_100013782 | Ga0075431_1000137825 | 225 |
| 136 | 3300006852 | Ga0075433_10077678 | Ga0075433_100776782 | 225 |
| 137 | 3300006880 | Ga0075429_100004074 | Ga0075429_1000040749 | 225 |
| 138 | 3300006881 | Ga0068865_100091511 | Ga0068865_1000915113 | 225 |
| 139 | 3300006881 | Ga0068865_100123520 | Ga0068865_1001235202 | 225 |
| 140 | 3300006931 | Ga0097620_100102937 | Ga0097620_1001029372 | 225 |
| 141 | 3300009094 | Ga0111539_10001068 | Ga0111539_1000106810 | 225 |
| 142 | 3300009098 | Ga0105245_10794430 | Ga0105245_107944302 | 225 |
| 143 | 3300009101 | Ga0105247_10375836 | Ga0105247_103758362 | 225 |
| 144 | 3300009147 | Ga0114129_10000705 | Ga0114129_1000070542 | 225 |
| 145 | 3300009147 | Ga0114129_10068789 | Ga0114129_100687893 | 225 |
| 146 | 3300009147 | Ga0114129_10290336 | Ga0114129_102903362 | 225 |
| 147 | 3300009148 | Ga0105243_10010029 | Ga0105243_100100296 | 225 |
| 148 | 3300009177 | Ga0105248_10006489 | Ga0105248_100064893 | 225 |
| 149 | 3300009177 | Ga0105248_10058103 | Ga0105248_100581034 | 225 |
| 150 | 3300009177 | Ga0105248_10320057 | Ga0105248_103200572 | 225 |
| 151 | 3300009545 | Ga0105237_10326248 | Ga0105237_103262482 | 225 |
| 152 | 3300009553 | Ga0105249_10034583 | Ga0105249_100345832 | 225 |
| 153 | 3300009553 | Ga0105249_10823221 | Ga0105249_108232212 | 225 |
| 154 | 3300013104 | Ga0157370_10057043 | Ga0157370_100570435 | 225 |
| 155 | 3300013105 | Ga0157369_10442338 | Ga0157369_104423382 | 225 |
| 156 | 3300013105 | Ga0157369_10568148 | Ga0157369_105681482 | 225 |
| 157 | 3300013296 | Ga0157374_10159806 | Ga0157374_101598061 | 225 |
| 158 | 3300013306 | Ga0163162_10005760 | Ga0163162_1000576011 | 225 |
| 159 | 3300013306 | Ga0163162_10160161 | Ga0163162_101601612 | 225 |
| 160 | 3300013308 | Ga0157375_10033686 | Ga0157375_100336863 | 225 |
| 161 | 3300013308 | Ga0157375_10072524 | Ga0157375_100725243 | 225 |
| 162 | 3300013308 | Ga0157375_10222862 | Ga0157375_102228621 | 225 |
| 163 | 3300014325 | Ga0163163_10031136 | Ga0163163_100311363 | 225 |
| 164 | 3300014325 | Ga0163163_10035142 | Ga0163163_100351423 | 225 |
| 165 | 3300014325 | Ga0163163_10104647 | Ga0163163_101046473 | 225 |
| 166 | 3300014745 | Ga0157377_10049857 | Ga0157377_100498572 | 225 |
| 167 | 3300014969 | Ga0157376_11082599 | Ga0157376_110825991 | 225 |
| 168 | 3300025893 | Ga0207682_10006359 | Ga0207682_100063594 | 225 |
| 169 | 3300025893 | Ga0207682_10046253 | Ga0207682_100462532 | 225 |
| 170 | 3300025903 | Ga0207680_10050909 | Ga0207680_100509092 | 225 |
| 171 | 3300025907 | Ga0207645_10539461 | Ga0207645_105394611 | 225 |
| 172 | 3300025908 | Ga0207643_10071174 | Ga0207643_100711742 | 225 |
| 173 | 3300025920 | Ga0207649_10159444 | Ga0207649_101594441 | 225 |
| 174 | 3300025925 | Ga0207650_10030291 | Ga0207650_100302912 | 225 |
| 175 | 3300025925 | Ga0207650_10036554 | Ga0207650_100365543 | 225 |
| 176 | 3300025931 | Ga0207644_10090827 | Ga0207644_100908272 | 225 |
| 177 | 3300025931 | Ga0207644_10142757 | Ga0207644_101427572 | 225 |
| 178 | 3300025933 | Ga0207706_10272091 | Ga0207706_102720912 | 225 |
| 179 | 3300025934 | Ga0207686_10153660 | Ga0207686_101536601 | 225 |
| 180 | 3300025935 | Ga0207709_10027054 | Ga0207709_100270543 | 225 |
| 181 | 3300025936 | Ga0207670_10051029 | Ga0207670_100510293 | 225 |
| 182 | 3300025936 | Ga0207670_10084628 | Ga0207670_100846282 | 225 |
| 183 | 3300025937 | Ga0207669_10005088 | Ga0207669_100050882 | 225 |
| 184 | 3300025937 | Ga0207669_10065668 | Ga0207669_100656683 | 225 |
| 185 | 3300025937 | Ga0207669_10066866 | Ga0207669_100668662 | 225 |
| 186 | 3300025937 | Ga0207669_10094700 | Ga0207669_100947002 | 225 |
| 187 | 3300025938 | Ga0207704_10031233 | Ga0207704_100312332 | 225 |
| 188 | 3300025940 | Ga0207691_10020475 | Ga0207691_100204756 | 225 |
| 189 | 3300025940 | Ga0207691_10029909 | Ga0207691_100299093 | 225 |
| 190 | 3300025941 | Ga0207711_10285903 | Ga0207711_102859031 | 225 |
| 191 | 3300025941 | Ga0207711_10695282 | Ga0207711_106952822 | 225 |
| 192 | 3300025945 | Ga0207679_10014958 | Ga0207679_100149584 | 225 |
| 193 | 3300025945 | Ga0207679_10017000 | Ga0207679_100170003 | 225 |
| 194 | 3300025960 | Ga0207651_10030942 | Ga0207651_100309422 | 225 |
| 195 | 3300025960 | Ga0207651_10042376 | Ga0207651_100423763 | 225 |
| 196 | 3300025960 | Ga0207651_10215496 | Ga0207651_102154962 | 225 |
| 197 | 3300025961 | Ga0207712_10183203 | Ga0207712_101832031 | 225 |
| 198 | 3300025972 | Ga0207668_10279565 | Ga0207668_102795652 | 225 |
| 199 | 3300025972 | Ga0207668_10557599 | Ga0207668_105575991 | 225 |
| 200 | 3300025986 | Ga0207658_10192510 | Ga0207658_101925102 | 225 |
| 201 | 3300026023 | Ga0207677_10002464 | Ga0207677_100024643 | 225 |
| 202 | 3300026023 | Ga0207677_10133918 | Ga0207677_101339183 | 225 |
| 203 | 3300026035 | Ga0207703_10084593 | Ga0207703_100845932 | 225 |
| 204 | 3300026067 | Ga0207678_10041725 | Ga0207678_100417253 | 225 |
| 205 | 3300026075 | Ga0207708_10160059 | Ga0207708_101600592 | 225 |
| 206 | 3300026075 | Ga0207708_10279335 | Ga0207708_102793351 | 225 |
| 207 | 3300026088 | Ga0207641_10556826 | Ga0207641_105568262 | 225 |
| 208 | 3300026089 | Ga0207648_10792315 | Ga0207648_107923151 | 225 |
| 209 | 3300026095 | Ga0207676_10011460 | Ga0207676_100114605 | 225 |
| 210 | 3300026118 | Ga0207675_100213629 | Ga0207675_1002136291 | 225 |
| 211 | 3300026121 | Ga0207683_10030843 | Ga0207683_100308436 | 225 |
| 212 | 3300027866 | Ga0209813_10130127 | Ga0209813_101301272 | 225 |
| 213 | 3300028379 | Ga0268266_10537279 | Ga0268266_105372792 | 225 |
| 214 | 3300031548 | Ga0307408_100013270 | Ga0307408_1000132703 | 225 |
| 215 | 3300031548 | Ga0307408_100035165 | Ga0307408_1000351652 | 225 |
| 216 | 3300031728 | Ga0316578_10055840 | Ga0316578_100558402 | 225 |
| 217 | 3300031824 | Ga0307413_10072143 | Ga0307413_100721431 | 225 |
| 218 | 3300031852 | Ga0307410_10095054 | Ga0307410_100950542 | 225 |
| 219 | 3300031852 | Ga0307410_10469634 | Ga0307410_104696342 | 225 |
| 220 | 3300031911 | Ga0307412_10036435 | Ga0307412_100364353 | 225 |
| 221 | 3300032002 | Ga0307416_100006741 | Ga0307416_1000067418 | 225 |
| 222 | 3300032002 | Ga0307416_100160799 | Ga0307416_1001607992 | 225 |
| 223 | 3300032002 | Ga0307416_100178226 | Ga0307416_1001782262 | 225 |
| 224 | 3300035117 | Ga0373953_0077443 | Ga0373953_0077443_116_808 | 225 |
| 225 | 3300035118 | Ga0373954_0163696 | Ga0373954_0163696_363_1055 | 225 |
| 226 | 3300035170 | Ga0373943_0012798 | Ga0373943_0012798_440_1135 | 225 |
| 227 | 3300035172 | Ga0373955_0006694 | Ga0373955_0006694_3499_4194 | 225 |
| 228 | 3300035172 | Ga0373955_0035569 | Ga0373955_0035569_513_1205 | 225 |
| 229 | 3300035410 | Ga0373924_0093265 | Ga0373924_0093265_314_1009 | 225 |
| 230 | 3300035724 | Ga0373933_0050988 | Ga0373933_0050988_1605_2297 | 225 |
| 231 | 3300035724 | Ga0373933_0274801 | Ga0373933_0274801_336_1031 | 225 |
| 232 | 3300035725 | Ga0373947_0041041 | Ga0373947_0041041_10_705 | 225 |
| 233 | 3300036401 | Ga0373937_0001245 | Ga0373937_0001245_11955_12647 | 225 |
| 234 | 3300036401 | Ga0373937_0088325 | Ga0373937_0088325_1666_2358 | 225 |
| 235 | 3300037068 | Ga0373925_0007310 | Ga0373925_0007310_6931_7626 | 225 |
| 236 | 3300041451 | Ga0451791_0654446 | Ga0451791_0654446_977_1672 | 225 |
| 237 | 3300041453 | Ga0451797_0549656 | Ga0451797_0549656_206_901 | 225 |
| 238 | 3300042146 | Ga0450907_015214 | Ga0450907_015214_218_913 | 225 |
| 239 | 3300042184 | Ga0450908_000173 | Ga0450908_000173_3198_3893 | 225 |
| 240 | 3300042439 | Ga0439464_0021787 | Ga0439464_0021787_619_1311 | 225 |
| 241 | 3300045051 | Ga0451576_0053846 | Ga0451576_0053846_1325_2002 | 225 |
| 242 | 3300045051 | Ga0451576_0079052 | Ga0451576_0079052_2142_2939 | 225 |
| 243 | 3300046454 | Ga0495592_0040018 | Ga0495592_0040018_396_1088 | 225 |
| 244 | 3300046476 | Ga0495662_0013922 | Ga0495662_0013922_1007_1699 | 225 |
| 245 | 3300046511 | Ga0495608_0022613 | Ga0495608_0022613_3088_3780 | 225 |
| 246 | 3300046514 | Ga0495618_0468015 | Ga0495618_0468015_11_703 | 225 |
| 247 | 3300046539 | Ga0495621_0009094 | Ga0495621_0009094_135_812 | 225 |
| 248 | 3300046559 | Ga0495667_0000406 | Ga0495667_0000406_7484_8176 | 225 |
| 249 | 3300046642 | Ga0495634_0134501 | Ga0495634_0134501_152_844 | 225 |
| 250 | 3300046675 | Ga0495657_0001815 | Ga0495657_0001815_5689_6381 | 225 |
| 251 | 3300046678 | Ga0495599_0048646 | Ga0495599_0048646_392_1084 | 225 |
| 252 | 3300046681 | Ga0495647_0033200 | Ga0495647_0033200_263_955 | 225 |
| 253 | 3300046689 | Ga0495613_0044931 | Ga0495613_0044931_1815_2507 | 225 |
| 254 | 3300046689 | Ga0495613_0168364 | Ga0495613_0168364_359_1051 | 225 |
| 255 | 3300047319 | Ga0495674_0020105 | Ga0495674_0020105_5471_6163 | 225 |
| 256 | 3300047319 | Ga0495674_0224226 | Ga0495674_0224226_471_1163 | 225 |
| 257 | 3300047444 | Ga0495675_0117189 | Ga0495675_0117189_371_1063 | 225 |
| 258 | 3300047471 | Ga0495684_0179070 | Ga0495684_0179070_116_808 | 225 |
| 259 | 3300047471 | Ga0495684_0350978 | Ga0495684_0350978_298_990 | 225 |
| 260 | 3300048913 | Ga0496110_0142883 | Ga0496110_0142883_512_1207 | 225 |
| 261 | 3300049583 | Ga0501067_0192128 | Ga0501067_0192128_16_711 | 225 |
| 262 | 3300049589 | Ga0501073_0181252 | Ga0501073_0181252_21_704 | 225 |
| 263 | 3300049655 | Ga0501208_037662 | Ga0501208_037662_167_859 | 225 |
| 264 | 3300049679 | Ga0501249_012605 | Ga0501249_012605_148_840 | 225 |
| 265 | 3300049744 | Ga0501083_0010520 | Ga0501083_0010520_4794_5477 | 225 |
| 266 | 3300049851 | Ga0501212_002626 | Ga0501212_002626_958_1650 | 225 |
| 267 | 3300050489 | nmdc:mga03683_13449_c1 | nmdc:mga03683_13449_c1_2206_2898 | 225 |
| 268 | 3300050490 | nmdc:mga03n38_162941_c1 | nmdc:mga03n38_162941_c1_329_1024 | 225 |
| 269 | 3300050491 | nmdc:mga00v17_14576_c1 | nmdc:mga00v17_14576_c1_1167_1859 | 225 |
| 270 | 3300050493 | nmdc:mga0k408_18330_c1 | nmdc:mga0k408_18330_c1_1263_1955 | 225 |
| 271 | 3300050493 | nmdc:mga0k408_8520_c1 | nmdc:mga0k408_8520_c1_734_1429 | 225 |
| 272 | 3300050494 | nmdc:mga06z11_16813_c1 | nmdc:mga06z11_16813_c1_2338_3033 | 225 |
| 273 | 3300050494 | nmdc:mga06z11_46848_c1 | nmdc:mga06z11_46848_c1_242_937 | 225 |
| 274 | 3300050496 | nmdc:mga07m45_215337_c1 | nmdc:mga07m45_215337_c1_292_987 | 225 |
| 275 | 3300050507 | nmdc:mga05p37_18555_c1 | nmdc:mga05p37_18555_c1_3234_3971 | 225 |
| 276 | 3300050507 | nmdc:mga05p37_219291_c1 | nmdc:mga05p37_219291_c1_513_1202 | 225 |
| 277 | 3300050507 | nmdc:mga05p37_27106_c1 | nmdc:mga05p37_27106_c1_1344_2027 | 225 |
| 278 | 3300050507 | nmdc:mga05p37_8349_c1 | nmdc:mga05p37_8349_c1_3984_4676 | 225 |
| 279 | 3300050508 | nmdc:mga09592_15245_c1 | nmdc:mga09592_15245_c1_2837_3529 | 225 |
| 280 | 3300050508 | nmdc:mga09592_210501_c1 | nmdc:mga09592_210501_c1_397_1080 | 225 |
| 281 | 3300050508 | nmdc:mga09592_60038_c1 | nmdc:mga09592_60038_c1_2223_2906 | 225 |
| 282 | 3300050509 | nmdc:mga0qj67_2732_c1 | nmdc:mga0qj67_2732_c1_2495_3187 | 225 |
| 283 | 3300050510 | nmdc:mga06r32_1087_c1 | nmdc:mga06r32_1087_c1_11540_12220 | 225 |
| 284 | 3300050510 | nmdc:mga06r32_19115_c1 | nmdc:mga06r32_19115_c1_2537_3229 | 225 |
| 285 | 3300050511 | nmdc:mga08y16_11972_c1 | nmdc:mga08y16_11972_c1_606_1298 | 225 |
| 286 | 3300050512 | nmdc:mga0n895_28981_c1 | nmdc:mga0n895_28981_c1_2727_3416 | 225 |
| 287 | 3300050512 | nmdc:mga0n895_769800_c1 | nmdc:mga0n895_769800_c1_30_767 | 225 |
| 288 | 3300050515 | nmdc:mga0a205_95821_c1 | nmdc:mga0a205_95821_c1_772_1455 | 225 |
| 289 | 3300059423 | Ga0590074_002452 | Ga0590074_002452_1032_1727 | 225 |
| 290 | 3300059424 | Ga0590075_000504 | Ga0590075_000504_8918_9613 | 225 |
| 291 | 3300059426 | Ga0590077_000037 | Ga0590077_000037_12749_13444 | 225 |
| 292 | 3300060353 | Ga0501082_0285601 | Ga0501082_0285601_690_1373 | 225 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qft-assembly1.cif.gz_A | e.coli epsp synthase pro101ser liganded with s3p and glyphosate | 0.673 | 157 | 223 |
| 3ege-assembly1.cif.gz_A | crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution | 0.6701 | 14 | 179 |
| 1mi4-assembly1.cif.gz_A | glyphosate insensitive g96a mutant epsp synthase liganded with shikimate-3-phosphate | 0.6663 | 157 | 223 |
| 5koc-assembly1.cif.gz_A | pavine n-methyltransferase in complex with s-adenosylmethionine ph 7 | 0.6641 | 14 | 176 |
| 3cjq-assembly2.cif.gz_D | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 | 0.656 | 28 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60353_7_221_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9663 | 6 | 225 | 3.40.50.150 |
| af_Q60353_7_221_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9575 | 6 | 225 | 3.40.50.150 |
| af_Q9VBJ3_147_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8028 | 27 | 171 | 3.40.50.150 |
| af_A2APY7_47_247_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7883 | 124 | 171 | 3.40.50.150 |
| af_A0A1D6ET91_93_186_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7759 | 124 | 171 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G8QF60-F1-model_v4 | SAM-dependent methyltransferase | 0.9953 | 21 | 224 |
GO:0008168
GO:0032259 |
| AF-A0A0C9PRD7-F1-model_v4 | deleted | 0.9934 | 21 | 225 |
|
| AF-A0A1Q4R902-F1-model_v4 | SAM-dependent methyltransferase | 0.993 | 2 | 225 |
GO:0008168
GO:0032259 |
| AF-K9WB56-F1-model_v4 | SAM-dependent methyltransferase | 0.9928 | 2 | 223 |
|
| AF-A0A4D9C973-F1-model_v4 | deleted | 0.9925 | 3 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar