F391093

General Info

Members Datasets Scaffolds Average Seq Length
292 200 288 230

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0079052|Ga0451576_0079052_2142_2939
Length 265
Sequence MGSVPAVHRQAAVALLSSVEIASPPAVVADHGHSRTYNRRVFTLDRVVPWGRSFDEYRRMFALSDADLNAFILGCGDGPASFNAEATANGHSVISCDPIYRFTPDQIRQRIRDTTEVVIGQTRRNQHQFVWTSIRSIEELRDIRLASMHTFLHDFDSDNRGGRYVAAELPQLPFVNASFRLALCSHFLFLYSEQLSEDFHVAAISAMTRVADEARIFPLLTLGGARSKHVAAVSERIQRAGHAVRIEKVDYEFQRGGNEMMRVRA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
181 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 0.68
Rhizoplane 1.71
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13790944 2162886012 Bacteria 886
2 JGI24740J21852_10017646 3300001979 Bacteria 2547
3 JGI24737J22298_10000179 3300001990 Bacteria 20450
4 JGI24735J21928_10000033 3300002067 Bacteria 70674
5 Ga0065714_10129107 3300005288 Bacteria 1267
6 Ga0065712_10076814 3300005290 Bacteria 3589
7 Ga0065715_10335970 3300005293 Bacteria 975
8 Ga0070676_10092376 3300005328 Bacteria 1856
9 Ga0070690_100022768 3300005330 Bacteria 3836
10 Ga0070670_100004661 3300005331 Bacteria 11503
11 Ga0070670_100010538 3300005331 Bacteria 7891
12 Ga0070677_10018941 3300005333 Bacteria 2487
13 Ga0070677_10050895 3300005333 Bacteria 1675
14 Ga0070666_10007995 3300005335 Bacteria 6540
15 Ga0068868_100005267 3300005338 Bacteria 9079
16 Ga0068868_100401542 3300005338 Bacteria 1183
17 Ga0070689_100017877 3300005340 Bacteria 5212
18 Ga0070689_100309544 3300005340 Unclassified 1317
19 Ga0070687_100030824 3300005343 Bacteria 2624
20 Ga0070661_100009829 3300005344 Bacteria 6635
21 Ga0070668_100139014 3300005347 Bacteria 1956
22 Ga0070669_100175385 3300005353 Bacteria 1674
23 Ga0070675_100087806 3300005354 Bacteria 2601
24 Ga0070675_100125823 3300005354 Bacteria 2180
25 Ga0070675_100522286 3300005354 Unclassified 1071
26 Ga0070671_100016677 3300005355 Bacteria 5939
27 Ga0070671_100146726 3300005355 Unclassified 1991
28 Ga0070671_100469004 3300005355 Bacteria 1081
29 Ga0070674_100002647 3300005356 Bacteria 9911
30 Ga0070674_100003793 3300005356 Bacteria 8537
31 Ga0070673_100047186 3300005364 Bacteria 3350
32 Ga0070673_100413049 3300005364 Bacteria 1209
33 Ga0070688_100190650 3300005365 Unclassified 1428
34 Ga0070667_100007940 3300005367 Bacteria 8802
35 Ga0070700_100412757 3300005441 Unclassified 1018
36 Ga0070694_100005754 3300005444 Bacteria 7524
37 Ga0070663_100022987 3300005455 Bacteria 4174
38 Ga0070662_100216300 3300005457 Bacteria 1527
39 Ga0070685_10105998 3300005466 Bacteria 1724
40 Ga0070698_100043060 3300005471 Bacteria 4630
41 Ga0070699_100026306 3300005518 Bacteria 5019
42 Ga0070699_100082096 3300005518 Bacteria 2809
43 Ga0068853_100149012 3300005539 Bacteria 2105
44 Ga0070672_100031758 3300005543 Bacteria 3978
45 Ga0070672_100036668 3300005543 Bacteria 3736
46 Ga0070672_100077902 3300005543 Bacteria 2652
47 Ga0070686_100265874 3300005544 Unclassified 1259
48 Ga0070695_100000551 3300005545 Bacteria 19830
49 Ga0070696_100030321 3300005546 Bacteria 3702
50 Ga0070665_100007106 3300005548 Bacteria 11378
51 Ga0070665_100497749 3300005548 Bacteria 1230
52 Ga0070704_100020970 3300005549 Bacteria 4226
53 Ga0070704_100292916 3300005549 Bacteria 1353
54 Ga0068855_100067575 3300005563 Bacteria 4163
55 Ga0070664_100073355 3300005564 Bacteria 2936
56 Ga0070664_100165864 3300005564 Bacteria 1957
57 Ga0070664_100267075 3300005564 Unclassified 1540
58 Ga0068857_100281413 3300005577 Bacteria 1530
59 Ga0070702_100158088 3300005615 Bacteria 1462
60 Ga0068859_100102945 3300005617 Bacteria 2913
61 Ga0068864_100042977 3300005618 Bacteria 3868
62 Ga0068864_100106411 3300005618 Bacteria 2494
63 Ga0068864_100525348 3300005618 Unclassified 1141
64 Ga0068866_10310908 3300005718 Unclassified 988
65 Ga0068861_100197676 3300005719 Bacteria 1685
66 Ga0068861_100485723 3300005719 Bacteria 1114
67 Ga0068870_10154263 3300005840 Bacteria 1355
68 Ga0068863_100047807 3300005841 Bacteria 4057
69 Ga0068863_100183660 3300005841 Unclassified 2008
70 Ga0068863_101140800 3300005841 Unclassified 785
71 Ga0068860_100410648 3300005843 Unclassified 1341
72 Ga0075368_10020064 3300006042 Bacteria 2528
73 Ga0075364_10010777 3300006051 Bacteria 5531
74 Ga0075362_10001240 3300006177 Bacteria 8049
75 Ga0075367_10000983 3300006178 Bacteria 11664
76 Ga0075367_10052636 3300006178 Bacteria 2410
77 Ga0075367_10136750 3300006178 Bacteria 1516
78 Ga0075366_10005435 3300006195 Bacteria 6902
79 Ga0075366_10012700 3300006195 Bacteria 4784
80 Ga0075366_10022493 3300006195 Bacteria 3668
81 Ga0075366_10025354 3300006195 Bacteria 3462
82 Ga0075366_10064713 3300006195 Bacteria 2175
83 Ga0097621_100209209 3300006237 Bacteria 1696
84 Ga0075370_10285928 3300006353 Unclassified 980
85 Ga0068871_100187710 3300006358 Bacteria 1779
86 Ga0068871_100262592 3300006358 Bacteria 1506
87 Ga0075428_100001856 3300006844 Bacteria 22643
88 Ga0075428_100587467 3300006844 Bacteria 1190
89 Ga0075430_100007933 3300006846 Bacteria 8976
90 Ga0075431_100000788 3300006847 Bacteria 27634
91 Ga0075431_100013782 3300006847 Bacteria 8164
92 Ga0075431_100311674 3300006847 Bacteria 1588
93 Ga0075433_10077678 3300006852 Bacteria 2924
94 Ga0075429_100004074 3300006880 Bacteria 12526
95 Ga0068865_100091511 3300006881 Bacteria 2208
96 Ga0068865_100123520 3300006881 Bacteria 1929
97 Ga0097620_100102937 3300006931 Bacteria 2913
98 Ga0079104_1000137 3300006946 Bacteria 103232
99 Ga0111539_10001068 3300009094 Bacteria 36134
100 Ga0105245_10794430 3300009098 Unclassified 984
101 Ga0105247_10375836 3300009101 Unclassified 1006
102 Ga0114129_10000705 3300009147 Bacteria 42129
103 Ga0114129_10068789 3300009147 Bacteria 4936
104 Ga0114129_10290336 3300009147 Bacteria 2183
105 Ga0105243_10010029 3300009148 Bacteria 7204
106 Ga0105248_10006489 3300009177 Bacteria 12828
107 Ga0105248_10058103 3300009177 Bacteria 4343
108 Ga0105248_10320057 3300009177 Bacteria 1747
109 Ga0105237_10106592 3300009545 Bacteria 2794
110 Ga0105237_10326248 3300009545 Unclassified 1539
111 Ga0105249_10034583 3300009553 Bacteria 4581
112 Ga0105249_10823221 3300009553 Bacteria 993
113 Ga0105239_10138069 3300010375 Bacteria 2714
114 Ga0157371_10004552 3300013102 Bacteria 12066
115 Ga0157370_10057043 3300013104 Unclassified 3715
116 Ga0157370_10650946 3300013104 Bacteria 963
117 Ga0157369_10204303 3300013105 Bacteria 2072
118 Ga0157369_10215079 3300013105 Bacteria 2013
119 Ga0157369_10442338 3300013105 Bacteria 1346
120 Ga0157369_10568148 3300013105 Bacteria 1172
121 Ga0157374_10159806 3300013296 Bacteria 2195
122 Ga0163162_10005760 3300013306 Bacteria 11987
123 Ga0163162_10160161 3300013306 Bacteria 2372
124 Ga0157372_10000016 3300013307 Bacteria 220177
125 Ga0157372_10000677 3300013307 Bacteria 37495
126 Ga0157375_10033686 3300013308 Bacteria 4871
127 Ga0157375_10072524 3300013308 Bacteria 3460
128 Ga0157375_10222862 3300013308 Bacteria 2044
129 Ga0163163_10031136 3300014325 Bacteria 5147
130 Ga0163163_10035142 3300014325 Bacteria 4860
131 Ga0163163_10104647 3300014325 Bacteria 2856
132 Ga0157377_10049857 3300014745 Bacteria 2355
133 Ga0157376_10056525 3300014969 Unclassified 3278
134 Ga0157376_11082599 3300014969 Unclassified 827
135 Ga0207682_10006359 3300025893 Bacteria 4766
136 Ga0207682_10046253 3300025893 Bacteria 1788
137 Ga0207680_10050909 3300025903 Bacteria 2474
138 Ga0207647_10013253 3300025904 Bacteria 5722
139 Ga0207645_10539461 3300025907 Bacteria 791
140 Ga0207643_10071174 3300025908 Bacteria 2001
141 Ga0207649_10159444 3300025920 Unclassified 1562
142 Ga0207650_10030291 3300025925 Bacteria 3896
143 Ga0207650_10036554 3300025925 Bacteria 3573
144 Ga0207687_10363344 3300025927 Unclassified 1182
145 Ga0207644_10090827 3300025931 Bacteria 2276
146 Ga0207644_10142757 3300025931 Bacteria 1845
147 Ga0207706_10272091 3300025933 Unclassified 1478
148 Ga0207686_10153660 3300025934 Bacteria 1605
149 Ga0207709_10027054 3300025935 Bacteria 3300
150 Ga0207670_10051029 3300025936 Bacteria 2775
151 Ga0207670_10084628 3300025936 Unclassified 2227
152 Ga0207669_10005088 3300025937 Bacteria 5857
153 Ga0207669_10065668 3300025937 Bacteria 2252
154 Ga0207669_10066866 3300025937 Bacteria 2237
155 Ga0207669_10094700 3300025937 Bacteria 1955
156 Ga0207704_10031233 3300025938 Bacteria 2998
157 Ga0207691_10020475 3300025940 Bacteria 6254
158 Ga0207691_10029909 3300025940 Bacteria 5094
159 Ga0207711_10285903 3300025941 Unclassified 1519
160 Ga0207711_10695282 3300025941 Bacteria 948
161 Ga0207679_10014958 3300025945 Bacteria 5114
162 Ga0207679_10017000 3300025945 Bacteria 4839
163 Ga0207667_10205499 3300025949 Bacteria 2019
164 Ga0207651_10030942 3300025960 Bacteria 3415
165 Ga0207651_10042376 3300025960 Bacteria 3029
166 Ga0207651_10215496 3300025960 Bacteria 1549
167 Ga0207712_10183203 3300025961 Bacteria 1647
168 Ga0207668_10279565 3300025972 Bacteria 1368
169 Ga0207668_10557599 3300025972 Unclassified 993
170 Ga0207658_10192510 3300025986 Unclassified 1696
171 Ga0207677_10002464 3300026023 Bacteria 9729
172 Ga0207677_10133918 3300026023 Bacteria 1886
173 Ga0207703_10084593 3300026035 Bacteria 2653
174 Ga0207639_10022443 3300026041 Bacteria 4547
175 Ga0207678_10041725 3300026067 Bacteria 3978
176 Ga0207678_10075842 3300026067 Bacteria 2880
177 Ga0207708_10160059 3300026075 Bacteria 1777
178 Ga0207708_10279335 3300026075 Unclassified 1353
179 Ga0207641_10556826 3300026088 Bacteria 1119
180 Ga0207648_10792315 3300026089 Unclassified 882
181 Ga0207676_10011460 3300026095 Bacteria 6337
182 Ga0207675_100213629 3300026118 Bacteria 1856
183 Ga0207683_10030843 3300026121 Bacteria 4648
184 Ga0209281_1000157 3300027111 Bacteria 162755
185 Ga0209813_10130127 3300027866 Bacteria 885
186 Ga0268266_10537279 3300028379 Unclassified 1119
187 Ga0268264_10425882 3300028381 Bacteria 1281
188 Ga0307515_10006153 3300028794 Bacteria 24121
189 Ga0265338_10036318 3300028800 Unclassified 4718
190 Ga0307408_100013270 3300031548 Bacteria 5468
191 Ga0307408_100035165 3300031548 Bacteria 3514
192 Ga0316578_10055840 3300031728 Unclassified 2318
193 Ga0307413_10072143 3300031824 Bacteria 2179
194 Ga0307410_10095054 3300031852 Bacteria 2124
195 Ga0307410_10469634 3300031852 Unclassified 1030
196 Ga0307412_10036435 3300031911 Bacteria 3152
197 Ga0307412_10528529 3300031911 Bacteria 987
198 Ga0307416_100006741 3300032002 Bacteria 7220
199 Ga0307416_100160799 3300032002 Bacteria 2076
200 Ga0307416_100178226 3300032002 Bacteria 1988
201 Ga0307416_100888250 3300032002 Bacteria 991
202 Ga0373953_0077443 3300035117 Bacteria 1379
203 Ga0373954_0163696 3300035118 Bacteria 1089
204 Ga0373943_0012798 3300035170 Bacteria 3782
205 Ga0373955_0006694 3300035172 Bacteria 5259
206 Ga0373955_0035569 3300035172 Bacteria 2638
207 Ga0373924_0093265 3300035410 Bacteria 1289
208 Ga0373933_0050988 3300035724 Bacteria 2472
209 Ga0373933_0274801 3300035724 Bacteria 1088
210 Ga0373947_0041041 3300035725 Bacteria 2758
211 Ga0373937_0001245 3300036401 Bacteria 21424
212 Ga0373937_0088325 3300036401 Bacteria 2870
213 Ga0373937_1079950 3300036401 Unclassified 751
214 Ga0373925_0007310 3300037068 Bacteria 8067
215 Ga0395899_0000283 3300037312 Bacteria 65893
216 Ga0436364_0217346 3300037853 Bacteria 3500
217 Ga0451791_0654446 3300041451 Bacteria 1695
218 Ga0451797_0549656 3300041453 Bacteria 963
219 Ga0450907_015214 3300042146 Bacteria 1284
220 Ga0450908_000173 3300042184 Bacteria 13512
221 Ga0439464_0021787 3300042439 Bacteria 1760
222 Ga0466961_0004051 3300044693 Bacteria 9182
223 Ga0466959_0092557 3300045049 Bacteria 2170
224 Ga0451576_0053846 3300045051 Bacteria 4213
225 Ga0451576_0079052 3300045051 Bacteria 3422
226 Ga0451576_0318119 3300045051 Unclassified 1628
227 Ga0495592_0040018 3300046454 Bacteria 3519
228 Ga0495629_0239593 3300046459 Bacteria 1249
229 Ga0495662_0013922 3300046476 Unclassified 3916
230 Ga0495608_0022613 3300046511 Bacteria 4312
231 Ga0495618_0468015 3300046514 Bacteria 763
232 Ga0495648_0013174 3300046524 Bacteria 6129
233 Ga0495621_0009094 3300046539 Unclassified 3004
234 Ga0495667_0000406 3300046559 Bacteria 27651
235 Ga0495668_0000073 3300046616 Bacteria 166105
236 Ga0495634_0134501 3300046642 Bacteria 1574
237 Ga0495657_0001815 3300046675 Bacteria 18247
238 Ga0495599_0048646 3300046678 Bacteria 2658
239 Ga0495647_0033200 3300046681 Bacteria 1928
240 Ga0495658_0038264 3300046683 Bacteria 2656
241 Ga0495613_0044931 3300046689 Unclassified 3267
242 Ga0495613_0168364 3300046689 Bacteria 1556
243 Ga0495674_0020105 3300047319 Bacteria 6186
244 Ga0495674_0224226 3300047319 Bacteria 1553
245 Ga0495675_0117189 3300047444 Bacteria 1660
246 Ga0495684_0179070 3300047471 Bacteria 1572
247 Ga0495684_0350978 3300047471 Bacteria 1047
248 Ga0496110_0142883 3300048913 Bacteria 2164
249 Ga0496115_0174379 3300048918 Bacteria 1778
250 Ga0501292_012596 3300049515 Bacteria 1292
251 Ga0501067_0192128 3300049583 Bacteria 1137
252 Ga0501073_0181252 3300049589 Unclassified 1457
253 Ga0501208_037662 3300049655 Bacteria 882
254 Ga0501235_019500 3300049669 Unclassified 1505
255 Ga0501249_012605 3300049679 Bacteria 1788
256 Ga0501083_0010520 3300049744 Bacteria 6510
257 Ga0501204_023555 3300049850 Unclassified 818
258 Ga0501212_002626 3300049851 Bacteria 2185
259 nmdc:mga03683_13449_c1 3300050489 Bacteria 3013
260 nmdc:mga03n38_162941_c1 3300050490 Unclassified 1130
261 nmdc:mga00v17_14576_c1 3300050491 Bacteria 4392
262 nmdc:mga0k408_18330_c1 3300050493 Bacteria 3906
263 nmdc:mga0k408_21901_c1 3300050493 Bacteria 3594
264 nmdc:mga0k408_25714_c1 3300050493 Bacteria 3335
265 nmdc:mga0k408_8520_c1 3300050493 Bacteria 5508
266 nmdc:mga06z11_16813_c1 3300050494 Bacteria 3305
267 nmdc:mga06z11_46848_c1 3300050494 Bacteria 2193
268 nmdc:mga07m45_215337_c1 3300050496 Unclassified 1117
269 nmdc:mga05p37_18555_c1 3300050507 Bacteria 8407
270 nmdc:mga05p37_219291_c1 3300050507 Unclassified 2296
271 nmdc:mga05p37_27106_c1 3300050507 Bacteria 6974
272 nmdc:mga05p37_8349_c1 3300050507 Bacteria 12245
273 nmdc:mga09592_15245_c1 3300050508 Bacteria 6279
274 nmdc:mga09592_210501_c1 3300050508 Unclassified 1684
275 nmdc:mga09592_60038_c1 3300050508 Bacteria 3214
276 nmdc:mga0qj67_2732_c1 3300050509 Bacteria 12650
277 nmdc:mga06r32_1087_c1 3300050510 Bacteria 24370
278 nmdc:mga06r32_19115_c1 3300050510 Bacteria 6285
279 nmdc:mga08y16_11972_c1 3300050511 Bacteria 9110
280 nmdc:mga0n895_28981_c1 3300050512 Bacteria 5274
281 nmdc:mga0n895_769800_c1 3300050512 Bacteria 955
282 nmdc:mga0a205_95821_c1 3300050515 Bacteria 2866
283 Ga0495619_0045551 3300053085 Bacteria 2882
284 Ga0500647_0193543 3300053091 Bacteria 926
285 Ga0590074_002452 3300059423 Bacteria 3041
286 Ga0590075_000504 3300059424 Bacteria 10599
287 Ga0590077_000037 3300059426 Bacteria 30721
288 Ga0501082_0285601 3300060353 Unclassified 1436

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0239593 Ga0495629_0239593_579_1196 204
2 3300014969 Ga0157376_10056525 Ga0157376_100565252 206
3 3300036401 Ga0373937_1079950 Ga0373937_1079950_106_738 206
4 3300048918 Ga0496115_0174379 Ga0496115_0174379_179_811 206
5 3300049515 Ga0501292_012596 Ga0501292_012596_57_689 206
6 3300049669 Ga0501235_019500 Ga0501235_019500_199_831 206
7 3300049850 Ga0501204_023555 Ga0501204_023555_83_715 206
8 3300050493 nmdc:mga0k408_25714_c1 nmdc:mga0k408_25714_c1_1151_1789 211
9 3300025927 Ga0207687_10363344 Ga0207687_103633442 213
10 3300006847 Ga0075431_100311674 Ga0075431_1003116742 220
11 iso_pu_bacteria 2599185184 2599481812 220
12 iso_pu_bacteria 2928078545 2928083963 220
13 iso_pu_bacteria 2928147474 2928152889 220
14 iso_pu_bacteria 2932082852 2932086046 220
15 3300001979 JGI24740J21852_10017646 JGI24740J21852_100176464 223
16 3300001990 JGI24737J22298_10000179 JGI24737J22298_1000017915 223
17 3300002067 JGI24735J21928_10000033 JGI24735J21928_1000003328 223
18 3300005455 Ga0070663_100022987 Ga0070663_1000229873 223
19 3300005539 Ga0068853_100149012 Ga0068853_1001490122 223
20 3300005563 Ga0068855_100067575 Ga0068855_1000675753 223
21 3300006195 Ga0075366_10005435 Ga0075366_100054353 223
22 3300006946 Ga0079104_1000137 Ga0079104_100013754 223
23 3300009545 Ga0105237_10106592 Ga0105237_101065922 223
24 3300010375 Ga0105239_10138069 Ga0105239_101380694 223
25 3300013102 Ga0157371_10004552 Ga0157371_100045524 223
26 3300013104 Ga0157370_10650946 Ga0157370_106509461 223
27 3300013105 Ga0157369_10204303 Ga0157369_102043033 223
28 3300013105 Ga0157369_10215079 Ga0157369_102150794 223
29 3300013307 Ga0157372_10000016 Ga0157372_10000016155 223
30 3300013307 Ga0157372_10000677 Ga0157372_1000067714 223
31 3300025904 Ga0207647_10013253 Ga0207647_100132532 223
32 3300025949 Ga0207667_10205499 Ga0207667_102054993 223
33 3300026041 Ga0207639_10022443 Ga0207639_100224436 223
34 3300026067 Ga0207678_10075842 Ga0207678_100758424 223
35 3300027111 Ga0209281_1000157 Ga0209281_1000157121 223
36 3300028794 Ga0307515_10006153 Ga0307515_1000615318 223
37 3300028800 Ga0265338_10036318 Ga0265338_100363183 223
38 3300037312 Ga0395899_0000283 Ga0395899_0000283_41300_41998 223
39 3300037853 Ga0436364_0217346 Ga0436364_0217346_1605_2279 223
40 3300044693 Ga0466961_0004051 Ga0466961_0004051_6801_7499 223
41 3300045049 Ga0466959_0092557 Ga0466959_0092557_1404_2102 223
42 3300046524 Ga0495648_0013174 Ga0495648_0013174_847_1524 223
43 3300046616 Ga0495668_0000073 Ga0495668_0000073_11136_11813 223
44 3300046683 Ga0495658_0038264 Ga0495658_0038264_469_1146 223
45 3300050493 nmdc:mga0k408_21901_c1 nmdc:mga0k408_21901_c1_816_1499 223
46 3300053091 Ga0500647_0193543 Ga0500647_0193543_22_699 223
47 3300028381 Ga0268264_10425882 Ga0268264_104258823 224
48 3300031911 Ga0307412_10528529 Ga0307412_105285292 224
49 3300032002 Ga0307416_100888250 Ga0307416_1008882502 224
50 3300045051 Ga0451576_0318119 Ga0451576_0318119_346_1023 224
51 3300053085 Ga0495619_0045551 Ga0495619_0045551_224_904 224
52 2162886012 MBSR1b_contig_13790944 MBSR1b_0901.00000190 225
53 3300005288 Ga0065714_10129107 Ga0065714_101291072 225
54 3300005290 Ga0065712_10076814 Ga0065712_100768142 225
55 3300005293 Ga0065715_10335970 Ga0065715_103359701 225
56 3300005328 Ga0070676_10092376 Ga0070676_100923761 225
57 3300005330 Ga0070690_100022768 Ga0070690_1000227683 225
58 3300005331 Ga0070670_100004661 Ga0070670_1000046619 225
59 3300005331 Ga0070670_100010538 Ga0070670_1000105385 225
60 3300005333 Ga0070677_10018941 Ga0070677_100189412 225
61 3300005333 Ga0070677_10050895 Ga0070677_100508953 225
62 3300005335 Ga0070666_10007995 Ga0070666_100079952 225
63 3300005338 Ga0068868_100005267 Ga0068868_1000052672 225
64 3300005338 Ga0068868_100401542 Ga0068868_1004015421 225
65 3300005340 Ga0070689_100017877 Ga0070689_1000178774 225
66 3300005340 Ga0070689_100309544 Ga0070689_1003095442 225
67 3300005343 Ga0070687_100030824 Ga0070687_1000308242 225
68 3300005344 Ga0070661_100009829 Ga0070661_1000098294 225
69 3300005347 Ga0070668_100139014 Ga0070668_1001390141 225
70 3300005353 Ga0070669_100175385 Ga0070669_1001753852 225
71 3300005354 Ga0070675_100087806 Ga0070675_1000878062 225
72 3300005354 Ga0070675_100125823 Ga0070675_1001258232 225
73 3300005354 Ga0070675_100522286 Ga0070675_1005222861 225
74 3300005355 Ga0070671_100016677 Ga0070671_1000166772 225
75 3300005355 Ga0070671_100146726 Ga0070671_1001467262 225
76 3300005355 Ga0070671_100469004 Ga0070671_1004690042 225
77 3300005356 Ga0070674_100002647 Ga0070674_10000264710 225
78 3300005356 Ga0070674_100003793 Ga0070674_1000037932 225
79 3300005364 Ga0070673_100047186 Ga0070673_1000471862 225
80 3300005364 Ga0070673_100413049 Ga0070673_1004130491 225
81 3300005365 Ga0070688_100190650 Ga0070688_1001906501 225
82 3300005367 Ga0070667_100007940 Ga0070667_1000079407 225
83 3300005441 Ga0070700_100412757 Ga0070700_1004127572 225
84 3300005444 Ga0070694_100005754 Ga0070694_1000057547 225
85 3300005457 Ga0070662_100216300 Ga0070662_1002163002 225
86 3300005466 Ga0070685_10105998 Ga0070685_101059982 225
87 3300005471 Ga0070698_100043060 Ga0070698_1000430603 225
88 3300005518 Ga0070699_100026306 Ga0070699_1000263063 225
89 3300005518 Ga0070699_100082096 Ga0070699_1000820963 225
90 3300005543 Ga0070672_100031758 Ga0070672_1000317583 225
91 3300005543 Ga0070672_100036668 Ga0070672_1000366683 225
92 3300005543 Ga0070672_100077902 Ga0070672_1000779022 225
93 3300005544 Ga0070686_100265874 Ga0070686_1002658742 225
94 3300005545 Ga0070695_100000551 Ga0070695_10000055116 225
95 3300005546 Ga0070696_100030321 Ga0070696_1000303213 225
96 3300005548 Ga0070665_100007106 Ga0070665_1000071064 225
97 3300005548 Ga0070665_100497749 Ga0070665_1004977492 225
98 3300005549 Ga0070704_100020970 Ga0070704_1000209703 225
99 3300005549 Ga0070704_100292916 Ga0070704_1002929161 225
100 3300005564 Ga0070664_100073355 Ga0070664_1000733552 225
101 3300005564 Ga0070664_100165864 Ga0070664_1001658643 225
102 3300005564 Ga0070664_100267075 Ga0070664_1002670752 225
103 3300005577 Ga0068857_100281413 Ga0068857_1002814132 225
104 3300005615 Ga0070702_100158088 Ga0070702_1001580882 225
105 3300005617 Ga0068859_100102945 Ga0068859_1001029452 225
106 3300005618 Ga0068864_100042977 Ga0068864_1000429774 225
107 3300005618 Ga0068864_100106411 Ga0068864_1001064112 225
108 3300005618 Ga0068864_100525348 Ga0068864_1005253481 225
109 3300005718 Ga0068866_10310908 Ga0068866_103109081 225
110 3300005719 Ga0068861_100197676 Ga0068861_1001976762 225
111 3300005719 Ga0068861_100485723 Ga0068861_1004857232 225
112 3300005840 Ga0068870_10154263 Ga0068870_101542632 225
113 3300005841 Ga0068863_100047807 Ga0068863_1000478074 225
114 3300005841 Ga0068863_100183660 Ga0068863_1001836602 225
115 3300005841 Ga0068863_101140800 Ga0068863_1011408001 225
116 3300005843 Ga0068860_100410648 Ga0068860_1004106482 225
117 3300006042 Ga0075368_10020064 Ga0075368_100200644 225
118 3300006051 Ga0075364_10010777 Ga0075364_100107772 225
119 3300006177 Ga0075362_10001240 Ga0075362_100012404 225
120 3300006178 Ga0075367_10000983 Ga0075367_1000098310 225
121 3300006178 Ga0075367_10052636 Ga0075367_100526363 225
122 3300006178 Ga0075367_10136750 Ga0075367_101367502 225
123 3300006195 Ga0075366_10012700 Ga0075366_100127006 225
124 3300006195 Ga0075366_10022493 Ga0075366_100224932 225
125 3300006195 Ga0075366_10025354 Ga0075366_100253542 225
126 3300006195 Ga0075366_10064713 Ga0075366_100647133 225
127 3300006237 Ga0097621_100209209 Ga0097621_1002092092 225
128 3300006353 Ga0075370_10285928 Ga0075370_102859282 225
129 3300006358 Ga0068871_100187710 Ga0068871_1001877102 225
130 3300006358 Ga0068871_100262592 Ga0068871_1002625922 225
131 3300006844 Ga0075428_100001856 Ga0075428_10000185611 225
132 3300006844 Ga0075428_100587467 Ga0075428_1005874672 225
133 3300006846 Ga0075430_100007933 Ga0075430_1000079332 225
134 3300006847 Ga0075431_100000788 Ga0075431_10000078819 225
135 3300006847 Ga0075431_100013782 Ga0075431_1000137825 225
136 3300006852 Ga0075433_10077678 Ga0075433_100776782 225
137 3300006880 Ga0075429_100004074 Ga0075429_1000040749 225
138 3300006881 Ga0068865_100091511 Ga0068865_1000915113 225
139 3300006881 Ga0068865_100123520 Ga0068865_1001235202 225
140 3300006931 Ga0097620_100102937 Ga0097620_1001029372 225
141 3300009094 Ga0111539_10001068 Ga0111539_1000106810 225
142 3300009098 Ga0105245_10794430 Ga0105245_107944302 225
143 3300009101 Ga0105247_10375836 Ga0105247_103758362 225
144 3300009147 Ga0114129_10000705 Ga0114129_1000070542 225
145 3300009147 Ga0114129_10068789 Ga0114129_100687893 225
146 3300009147 Ga0114129_10290336 Ga0114129_102903362 225
147 3300009148 Ga0105243_10010029 Ga0105243_100100296 225
148 3300009177 Ga0105248_10006489 Ga0105248_100064893 225
149 3300009177 Ga0105248_10058103 Ga0105248_100581034 225
150 3300009177 Ga0105248_10320057 Ga0105248_103200572 225
151 3300009545 Ga0105237_10326248 Ga0105237_103262482 225
152 3300009553 Ga0105249_10034583 Ga0105249_100345832 225
153 3300009553 Ga0105249_10823221 Ga0105249_108232212 225
154 3300013104 Ga0157370_10057043 Ga0157370_100570435 225
155 3300013105 Ga0157369_10442338 Ga0157369_104423382 225
156 3300013105 Ga0157369_10568148 Ga0157369_105681482 225
157 3300013296 Ga0157374_10159806 Ga0157374_101598061 225
158 3300013306 Ga0163162_10005760 Ga0163162_1000576011 225
159 3300013306 Ga0163162_10160161 Ga0163162_101601612 225
160 3300013308 Ga0157375_10033686 Ga0157375_100336863 225
161 3300013308 Ga0157375_10072524 Ga0157375_100725243 225
162 3300013308 Ga0157375_10222862 Ga0157375_102228621 225
163 3300014325 Ga0163163_10031136 Ga0163163_100311363 225
164 3300014325 Ga0163163_10035142 Ga0163163_100351423 225
165 3300014325 Ga0163163_10104647 Ga0163163_101046473 225
166 3300014745 Ga0157377_10049857 Ga0157377_100498572 225
167 3300014969 Ga0157376_11082599 Ga0157376_110825991 225
168 3300025893 Ga0207682_10006359 Ga0207682_100063594 225
169 3300025893 Ga0207682_10046253 Ga0207682_100462532 225
170 3300025903 Ga0207680_10050909 Ga0207680_100509092 225
171 3300025907 Ga0207645_10539461 Ga0207645_105394611 225
172 3300025908 Ga0207643_10071174 Ga0207643_100711742 225
173 3300025920 Ga0207649_10159444 Ga0207649_101594441 225
174 3300025925 Ga0207650_10030291 Ga0207650_100302912 225
175 3300025925 Ga0207650_10036554 Ga0207650_100365543 225
176 3300025931 Ga0207644_10090827 Ga0207644_100908272 225
177 3300025931 Ga0207644_10142757 Ga0207644_101427572 225
178 3300025933 Ga0207706_10272091 Ga0207706_102720912 225
179 3300025934 Ga0207686_10153660 Ga0207686_101536601 225
180 3300025935 Ga0207709_10027054 Ga0207709_100270543 225
181 3300025936 Ga0207670_10051029 Ga0207670_100510293 225
182 3300025936 Ga0207670_10084628 Ga0207670_100846282 225
183 3300025937 Ga0207669_10005088 Ga0207669_100050882 225
184 3300025937 Ga0207669_10065668 Ga0207669_100656683 225
185 3300025937 Ga0207669_10066866 Ga0207669_100668662 225
186 3300025937 Ga0207669_10094700 Ga0207669_100947002 225
187 3300025938 Ga0207704_10031233 Ga0207704_100312332 225
188 3300025940 Ga0207691_10020475 Ga0207691_100204756 225
189 3300025940 Ga0207691_10029909 Ga0207691_100299093 225
190 3300025941 Ga0207711_10285903 Ga0207711_102859031 225
191 3300025941 Ga0207711_10695282 Ga0207711_106952822 225
192 3300025945 Ga0207679_10014958 Ga0207679_100149584 225
193 3300025945 Ga0207679_10017000 Ga0207679_100170003 225
194 3300025960 Ga0207651_10030942 Ga0207651_100309422 225
195 3300025960 Ga0207651_10042376 Ga0207651_100423763 225
196 3300025960 Ga0207651_10215496 Ga0207651_102154962 225
197 3300025961 Ga0207712_10183203 Ga0207712_101832031 225
198 3300025972 Ga0207668_10279565 Ga0207668_102795652 225
199 3300025972 Ga0207668_10557599 Ga0207668_105575991 225
200 3300025986 Ga0207658_10192510 Ga0207658_101925102 225
201 3300026023 Ga0207677_10002464 Ga0207677_100024643 225
202 3300026023 Ga0207677_10133918 Ga0207677_101339183 225
203 3300026035 Ga0207703_10084593 Ga0207703_100845932 225
204 3300026067 Ga0207678_10041725 Ga0207678_100417253 225
205 3300026075 Ga0207708_10160059 Ga0207708_101600592 225
206 3300026075 Ga0207708_10279335 Ga0207708_102793351 225
207 3300026088 Ga0207641_10556826 Ga0207641_105568262 225
208 3300026089 Ga0207648_10792315 Ga0207648_107923151 225
209 3300026095 Ga0207676_10011460 Ga0207676_100114605 225
210 3300026118 Ga0207675_100213629 Ga0207675_1002136291 225
211 3300026121 Ga0207683_10030843 Ga0207683_100308436 225
212 3300027866 Ga0209813_10130127 Ga0209813_101301272 225
213 3300028379 Ga0268266_10537279 Ga0268266_105372792 225
214 3300031548 Ga0307408_100013270 Ga0307408_1000132703 225
215 3300031548 Ga0307408_100035165 Ga0307408_1000351652 225
216 3300031728 Ga0316578_10055840 Ga0316578_100558402 225
217 3300031824 Ga0307413_10072143 Ga0307413_100721431 225
218 3300031852 Ga0307410_10095054 Ga0307410_100950542 225
219 3300031852 Ga0307410_10469634 Ga0307410_104696342 225
220 3300031911 Ga0307412_10036435 Ga0307412_100364353 225
221 3300032002 Ga0307416_100006741 Ga0307416_1000067418 225
222 3300032002 Ga0307416_100160799 Ga0307416_1001607992 225
223 3300032002 Ga0307416_100178226 Ga0307416_1001782262 225
224 3300035117 Ga0373953_0077443 Ga0373953_0077443_116_808 225
225 3300035118 Ga0373954_0163696 Ga0373954_0163696_363_1055 225
226 3300035170 Ga0373943_0012798 Ga0373943_0012798_440_1135 225
227 3300035172 Ga0373955_0006694 Ga0373955_0006694_3499_4194 225
228 3300035172 Ga0373955_0035569 Ga0373955_0035569_513_1205 225
229 3300035410 Ga0373924_0093265 Ga0373924_0093265_314_1009 225
230 3300035724 Ga0373933_0050988 Ga0373933_0050988_1605_2297 225
231 3300035724 Ga0373933_0274801 Ga0373933_0274801_336_1031 225
232 3300035725 Ga0373947_0041041 Ga0373947_0041041_10_705 225
233 3300036401 Ga0373937_0001245 Ga0373937_0001245_11955_12647 225
234 3300036401 Ga0373937_0088325 Ga0373937_0088325_1666_2358 225
235 3300037068 Ga0373925_0007310 Ga0373925_0007310_6931_7626 225
236 3300041451 Ga0451791_0654446 Ga0451791_0654446_977_1672 225
237 3300041453 Ga0451797_0549656 Ga0451797_0549656_206_901 225
238 3300042146 Ga0450907_015214 Ga0450907_015214_218_913 225
239 3300042184 Ga0450908_000173 Ga0450908_000173_3198_3893 225
240 3300042439 Ga0439464_0021787 Ga0439464_0021787_619_1311 225
241 3300045051 Ga0451576_0053846 Ga0451576_0053846_1325_2002 225
242 3300045051 Ga0451576_0079052 Ga0451576_0079052_2142_2939 225
243 3300046454 Ga0495592_0040018 Ga0495592_0040018_396_1088 225
244 3300046476 Ga0495662_0013922 Ga0495662_0013922_1007_1699 225
245 3300046511 Ga0495608_0022613 Ga0495608_0022613_3088_3780 225
246 3300046514 Ga0495618_0468015 Ga0495618_0468015_11_703 225
247 3300046539 Ga0495621_0009094 Ga0495621_0009094_135_812 225
248 3300046559 Ga0495667_0000406 Ga0495667_0000406_7484_8176 225
249 3300046642 Ga0495634_0134501 Ga0495634_0134501_152_844 225
250 3300046675 Ga0495657_0001815 Ga0495657_0001815_5689_6381 225
251 3300046678 Ga0495599_0048646 Ga0495599_0048646_392_1084 225
252 3300046681 Ga0495647_0033200 Ga0495647_0033200_263_955 225
253 3300046689 Ga0495613_0044931 Ga0495613_0044931_1815_2507 225
254 3300046689 Ga0495613_0168364 Ga0495613_0168364_359_1051 225
255 3300047319 Ga0495674_0020105 Ga0495674_0020105_5471_6163 225
256 3300047319 Ga0495674_0224226 Ga0495674_0224226_471_1163 225
257 3300047444 Ga0495675_0117189 Ga0495675_0117189_371_1063 225
258 3300047471 Ga0495684_0179070 Ga0495684_0179070_116_808 225
259 3300047471 Ga0495684_0350978 Ga0495684_0350978_298_990 225
260 3300048913 Ga0496110_0142883 Ga0496110_0142883_512_1207 225
261 3300049583 Ga0501067_0192128 Ga0501067_0192128_16_711 225
262 3300049589 Ga0501073_0181252 Ga0501073_0181252_21_704 225
263 3300049655 Ga0501208_037662 Ga0501208_037662_167_859 225
264 3300049679 Ga0501249_012605 Ga0501249_012605_148_840 225
265 3300049744 Ga0501083_0010520 Ga0501083_0010520_4794_5477 225
266 3300049851 Ga0501212_002626 Ga0501212_002626_958_1650 225
267 3300050489 nmdc:mga03683_13449_c1 nmdc:mga03683_13449_c1_2206_2898 225
268 3300050490 nmdc:mga03n38_162941_c1 nmdc:mga03n38_162941_c1_329_1024 225
269 3300050491 nmdc:mga00v17_14576_c1 nmdc:mga00v17_14576_c1_1167_1859 225
270 3300050493 nmdc:mga0k408_18330_c1 nmdc:mga0k408_18330_c1_1263_1955 225
271 3300050493 nmdc:mga0k408_8520_c1 nmdc:mga0k408_8520_c1_734_1429 225
272 3300050494 nmdc:mga06z11_16813_c1 nmdc:mga06z11_16813_c1_2338_3033 225
273 3300050494 nmdc:mga06z11_46848_c1 nmdc:mga06z11_46848_c1_242_937 225
274 3300050496 nmdc:mga07m45_215337_c1 nmdc:mga07m45_215337_c1_292_987 225
275 3300050507 nmdc:mga05p37_18555_c1 nmdc:mga05p37_18555_c1_3234_3971 225
276 3300050507 nmdc:mga05p37_219291_c1 nmdc:mga05p37_219291_c1_513_1202 225
277 3300050507 nmdc:mga05p37_27106_c1 nmdc:mga05p37_27106_c1_1344_2027 225
278 3300050507 nmdc:mga05p37_8349_c1 nmdc:mga05p37_8349_c1_3984_4676 225
279 3300050508 nmdc:mga09592_15245_c1 nmdc:mga09592_15245_c1_2837_3529 225
280 3300050508 nmdc:mga09592_210501_c1 nmdc:mga09592_210501_c1_397_1080 225
281 3300050508 nmdc:mga09592_60038_c1 nmdc:mga09592_60038_c1_2223_2906 225
282 3300050509 nmdc:mga0qj67_2732_c1 nmdc:mga0qj67_2732_c1_2495_3187 225
283 3300050510 nmdc:mga06r32_1087_c1 nmdc:mga06r32_1087_c1_11540_12220 225
284 3300050510 nmdc:mga06r32_19115_c1 nmdc:mga06r32_19115_c1_2537_3229 225
285 3300050511 nmdc:mga08y16_11972_c1 nmdc:mga08y16_11972_c1_606_1298 225
286 3300050512 nmdc:mga0n895_28981_c1 nmdc:mga0n895_28981_c1_2727_3416 225
287 3300050512 nmdc:mga0n895_769800_c1 nmdc:mga0n895_769800_c1_30_767 225
288 3300050515 nmdc:mga0a205_95821_c1 nmdc:mga0a205_95821_c1_772_1455 225
289 3300059423 Ga0590074_002452 Ga0590074_002452_1032_1727 225
290 3300059424 Ga0590075_000504 Ga0590075_000504_8918_9613 225
291 3300059426 Ga0590077_000037 Ga0590077_000037_12749_13444 225
292 3300060353 Ga0501082_0285601 Ga0501082_0285601_690_1373 225

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qft-assembly1.cif.gz_A e.coli epsp synthase pro101ser liganded with s3p and glyphosate 0.673 157 223
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.6701 14 179
1mi4-assembly1.cif.gz_A glyphosate insensitive g96a mutant epsp synthase liganded with shikimate-3-phosphate 0.6663 157 223
5koc-assembly1.cif.gz_A pavine n-methyltransferase in complex with s-adenosylmethionine ph 7 0.6641 14 176
3cjq-assembly2.cif.gz_D ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.656 28 225
ID Description Score Start End Superfamily
af_Q60353_7_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9663 6 225 3.40.50.150
af_Q60353_7_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9575 6 225 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8028 27 171 3.40.50.150
af_A2APY7_47_247_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7883 124 171 3.40.50.150
af_A0A1D6ET91_93_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7759 124 171 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G8QF60-F1-model_v4 SAM-dependent methyltransferase 0.9953 21 224 GO:0008168
GO:0032259
AF-A0A0C9PRD7-F1-model_v4 deleted 0.9934 21 225
AF-A0A1Q4R902-F1-model_v4 SAM-dependent methyltransferase 0.993 2 225 GO:0008168
GO:0032259
AF-K9WB56-F1-model_v4 SAM-dependent methyltransferase 0.9928 2 223
AF-A0A4D9C973-F1-model_v4 deleted 0.9925 3 225

Feature Viewer

pLDDT pTM Quality
92.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map