F390937

General Info

Members Datasets Scaffolds Average Seq Length
292 217 584 142

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10059652|Ga0163163_100596522
Length 172
Sequence MTIDIRTNQDETPSRAWQEGDMSDRDRGNDMSDKHIGKCFCGAVTVEVTGAPEAMGYCHCSSCRSWSAGPVNAFTLWKPQNVKVTKGAEFIGRFKKTETSDRQFCTKCGGHLMTDHPTFGLTDVYAATIPSLAFAPGVHVNYGETVLRMKDGLPKMKDFPAELGGSGVMLPE

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
217 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.16
Nodule 0
Rhizoplane 5.48
Rhizosphere 84.59
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10059652 3300014325 Bacteria 3775
2 JGI25406J46586_10012089 3300003203 Bacteria 3759
3 JGI25160J50197_1021166 3300003354 Bacteria 1941
4 Ga0055530_10113662 3300003791 Bacteria 531
5 Ga0058860_11830360 3300004801 Bacteria 595
6 Ga0065165_1007267 3300005262 Bacteria 5501
7 Ga0065714_10131453 3300005288 Bacteria 1246
8 Ga0070683_101110590 3300005329 Bacteria 760
9 Ga0070690_100736332 3300005330 Bacteria 760
10 Ga0070677_10329502 3300005333 Bacteria 785
11 Ga0070666_10216131 3300005335 Bacteria 1351
12 Ga0070680_101841589 3300005336 Unclassified 524
13 Ga0068868_101696748 3300005338 Bacteria 595
14 Ga0070668_100113325 3300005347 Bacteria 2160
15 Ga0070671_100011383 3300005355 Bacteria 7151
16 Ga0070671_100343774 3300005355 Bacteria 1273
17 Ga0070674_100039799 3300005356 Bacteria 3177
18 Ga0070674_100424119 3300005356 Bacteria 1092
19 Ga0070673_100335545 3300005364 Bacteria 1338
20 Ga0070659_100118164 3300005366 Bacteria 2144
21 Ga0070659_101980514 3300005366 Bacteria 523
22 Ga0070667_100000173 3300005367 Bacteria 79829
23 Ga0070713_100014400 3300005436 Bacteria 5874
24 Ga0070710_10719898 3300005437 Bacteria 706
25 Ga0070711_100002668 3300005439 Bacteria 10233
26 Ga0070708_100026570 3300005445 Bacteria 4957
27 Ga0070708_100916385 3300005445 Bacteria 823
28 Ga0070663_100000068 3300005455 Bacteria 44842
29 Ga0070662_100338119 3300005457 Bacteria 1231
30 Ga0070681_10275718 3300005458 Bacteria 1593
31 Ga0068867_100703821 3300005459 Bacteria 892
32 Ga0070706_100186629 3300005467 Bacteria 1938
33 Ga0070706_100679521 3300005467 Bacteria 955
34 Ga0070706_101465341 3300005467 Bacteria 624
35 Ga0070679_100366008 3300005530 Bacteria 1389
36 Ga0070697_100929148 3300005536 Bacteria 772
37 Ga0070697_101945677 3300005536 Bacteria 526
38 Ga0068853_100000582 3300005539 Bacteria 24978
39 Ga0068853_100004383 3300005539 Bacteria 10927
40 Ga0068853_100154847 3300005539 Bacteria 2065
41 Ga0068853_101300606 3300005539 Bacteria 703
42 Ga0070672_100419555 3300005543 Bacteria 1149
43 Ga0070686_100339814 3300005544 Bacteria 1125
44 Ga0070693_101376486 3300005547 Bacteria 548
45 Ga0070665_100011669 3300005548 Bacteria 8879
46 Ga0068855_100020705 3300005563 Bacteria 7887
47 Ga0070664_100018035 3300005564 Bacteria 5794
48 Ga0068856_100252755 3300005614 Bacteria 1778
49 Ga0068856_100900040 3300005614 Bacteria 904
50 Ga0068856_102460383 3300005614 Bacteria 528
51 Ga0068859_100473502 3300005617 Bacteria 1348
52 Ga0068863_100008424 3300005841 Bacteria 10068
53 Ga0068863_100042517 3300005841 Bacteria 4318
54 Ga0068863_100875236 3300005841 Bacteria 898
55 Ga0068862_100441787 3300005844 Bacteria 1225
56 Ga0081539_10000060 3300005985 Bacteria 252799
57 Ga0075365_10048642 3300006038 Bacteria 2792
58 Ga0070715_10355844 3300006163 Bacteria 801
59 Ga0070716_100769161 3300006173 Bacteria 743
60 Ga0070712_100117291 3300006175 Bacteria 1997
61 Ga0068871_100117012 3300006358 Bacteria 2248
62 Ga0068871_100810890 3300006358 Bacteria 863
63 Ga0075430_100805021 3300006846 Unclassified 774
64 Ga0075431_100099189 3300006847 Bacteria 3006
65 Ga0075429_101237331 3300006880 Unclassified 651
66 Ga0075436_100069961 3300006914 Bacteria 2425
67 Ga0097620_100473576 3300006931 Bacteria 1348
68 Ga0075435_100381954 3300007076 Bacteria 1210
69 Ga0105240_10310837 3300009093 Bacteria 1800
70 Ga0105245_10200050 3300009098 Bacteria 1918
71 Ga0105247_10087054 3300009101 Bacteria 1978
72 Ga0105243_10235452 3300009148 Bacteria 1627
73 Ga0105241_12095984 3300009174 Bacteria 559
74 Ga0105242_10272437 3300009176 Bacteria 1534
75 Ga0105242_11082134 3300009176 Bacteria 815
76 Ga0105248_10000216 3300009177 Bacteria 66621
77 Ga0105248_11556156 3300009177 Bacteria 749
78 Ga0105237_10001539 3300009545 Bacteria 30116
79 Ga0105237_10059750 3300009545 Bacteria 3814
80 Ga0105249_10000175 3300009553 Bacteria 74934
81 Ga0105249_10267044 3300009553 Bacteria 1703
82 Ga0105239_10075264 3300010375 Bacteria 3712
83 Ga0105239_10194538 3300010375 Bacteria 2271
84 Ga0105239_10416169 3300010375 Bacteria 1522
85 Ga0157373_10923358 3300013100 Bacteria 648
86 Ga0157370_10814267 3300013104 Bacteria 849
87 Ga0157378_10086122 3300013297 Bacteria 2848
88 Ga0163162_10455100 3300013306 Bacteria 1412
89 Ga0163162_11955651 3300013306 Bacteria 672
90 Ga0163163_10672089 3300014325 Bacteria 1099
91 Ga0157380_10198061 3300014326 Bacteria 1779
92 Ga0157379_10139922 3300014968 Bacteria 2182
93 Ga0157379_11042092 3300014968 Bacteria 781
94 Ga0157376_10045827 3300014969 Bacteria 3603
95 Ga0163161_10231727 3300017792 Bacteria 1433
96 Ga0163161_11397391 3300017792 Bacteria 611
97 Ga0213876_10683714 3300021384 Bacteria 546
98 Ga0209564_1091201 3300025295 Bacteria 557
99 Ga0209758_1021524 3300025297 Bacteria 3002
100 Ga0209050_1012391 3300025298 Bacteria 3917
101 Ga0207426_1001044 3300025302 Bacteria 26304
102 Ga0207426_1043454 3300025302 Bacteria 1380
103 Ga0209257_1000923 3300025304 Bacteria 40837
104 Ga0207697_10241699 3300025315 Bacteria 798
105 Ga0207682_10090349 3300025893 Bacteria 1327
106 Ga0207710_10136796 3300025900 Bacteria 1180
107 Ga0207680_10032467 3300025903 Bacteria 2968
108 Ga0207685_10657454 3300025905 Bacteria 567
109 Ga0207699_10159683 3300025906 Bacteria 1500
110 Ga0207645_10020187 3300025907 Bacteria 4363
111 Ga0207705_10339569 3300025909 Bacteria 1156
112 Ga0207705_11241216 3300025909 Bacteria 571
113 Ga0207654_11001568 3300025911 Bacteria 608
114 Ga0207695_10186385 3300025913 Bacteria 1994
115 Ga0207671_10008277 3300025914 Bacteria 8845
116 Ga0207671_10426909 3300025914 Bacteria 1055
117 Ga0207663_10055490 3300025916 Bacteria 2486
118 Ga0207663_10855717 3300025916 Bacteria 726
119 Ga0207681_10194221 3300025923 Bacteria 1555
120 Ga0207700_10197094 3300025928 Bacteria 1695
121 Ga0207664_10660819 3300025929 Bacteria 939
122 Ga0207644_10002735 3300025931 Bacteria 11356
123 Ga0207644_10271606 3300025931 Bacteria 1359
124 Ga0207706_10360993 3300025933 Bacteria 1262
125 Ga0207686_10571279 3300025934 Bacteria 886
126 Ga0207669_10471448 3300025937 Bacteria 999
127 Ga0207704_10363549 3300025938 Bacteria 1130
128 Ga0207711_10022872 3300025941 Bacteria 5232
129 Ga0207711_10043491 3300025941 Bacteria 3832
130 Ga0207711_11086329 3300025941 Bacteria 741
131 Ga0207661_10944721 3300025944 Bacteria 794
132 Ga0207679_10061892 3300025945 Bacteria 2787
133 Ga0207667_10033630 3300025949 Bacteria 5511
134 Ga0207651_10244777 3300025960 Bacteria 1464
135 Ga0207651_10354783 3300025960 Bacteria 1236
136 Ga0207712_10000548 3300025961 Bacteria 30382
137 Ga0207712_10268903 3300025961 Bacteria 1386
138 Ga0207668_11022691 3300025972 Bacteria 739
139 Ga0207668_11537782 3300025972 Bacteria 600
140 Ga0207658_10003063 3300025986 Bacteria 11965
141 Ga0207677_11575576 3300026023 Bacteria 608
142 Ga0207639_10006457 3300026041 Bacteria 7976
143 Ga0207639_10018371 3300026041 Bacteria 4968
144 Ga0207678_10002332 3300026067 Bacteria 17201
145 Ga0207678_10285542 3300026067 Bacteria 1417
146 Ga0207708_10408950 3300026075 Bacteria 1123
147 Ga0207708_11605405 3300026075 Bacteria 571
148 Ga0207702_12174820 3300026078 Bacteria 544
149 Ga0207641_10022511 3300026088 Bacteria 5186
150 Ga0207641_10634457 3300026088 Bacteria 1048
151 Ga0207641_11725845 3300026088 Unclassified 628
152 Ga0207648_10258443 3300026089 Bacteria 1553
153 Ga0207648_10340797 3300026089 Bacteria 1350
154 Ga0207675_100521971 3300026118 Bacteria 1184
155 Ga0207683_10726632 3300026121 Bacteria 921
156 Ga0207698_10961456 3300026142 Bacteria 863
157 Ga0268266_10013203 3300028379 Bacteria 7121
158 Ga0268266_10787736 3300028379 Bacteria 918
159 Ga0268265_10133386 3300028380 Bacteria 2068
160 Ga0268264_10301556 3300028381 Bacteria 1508
161 Ga0265334_10000890 3300028573 Bacteria 14921
162 Ga0307515_10454560 3300028794 Bacteria 896
163 Ga0265338_10017178 3300028800 Bacteria 7816
164 Ga0307513_10137445 3300031456 Bacteria 2377
165 Ga0265314_10030929 3300031711 Bacteria 3958
166 Ga0373930_0036473 3300034816 Bacteria 1032
167 Ga0373926_0322718 3300035083 Bacteria 604
168 Ga0373932_0036886 3300035112 Bacteria 1390
169 Ga0373936_0000737 3300035113 Bacteria 11463
170 Ga0373953_0023694 3300035117 Bacteria 2325
171 Ga0373954_0044891 3300035118 Bacteria 2064
172 Ga0373956_0012580 3300035119 Bacteria 3510
173 Ga0373943_0081362 3300035170 Bacteria 1661
174 Ga0373946_0000783 3300035171 Bacteria 10828
175 Ga0373955_0000078 3300035172 Bacteria 40040
176 Ga0373924_0006732 3300035410 Bacteria 4126
177 Ga0373935_0000113 3300035692 Bacteria 36955
178 Ga0373935_0723218 3300035692 Bacteria 733
179 Ga0373927_0206614 3300035695 Bacteria 1290
180 Ga0373947_0016546 3300035725 Bacteria 4238
181 Ga0373937_0000007 3300036401 Bacteria 183537
182 Ga0373937_0626537 3300036401 Bacteria 1021
183 Ga0373925_0000011 3300037068 Bacteria 209840
184 Ga0373925_1291761 3300037068 Bacteria 599
185 Ga0395898_1197432 3300037466 Bacteria 691
186 Ga0395901_1136845 3300038443 Bacteria 750
187 Ga0451793_1104745 3300041452 Bacteria 1787
188 Ga0451793_1170506 3300041452 Bacteria 954
189 Ga0451797_0958960 3300041453 Bacteria 1311
190 Ga0451802_1673662 3300041460 Bacteria 1044
191 Ga0466963_0351910 3300044694 Bacteria 1037
192 Ga0495592_0000067 3300046454 Bacteria 95019
193 Ga0495592_0021861 3300046454 Bacteria 4868
194 Ga0495629_0004504 3300046459 Bacteria 10425
195 Ga0495651_0002020 3300046462 Bacteria 15666
196 Ga0495651_0189284 3300046462 Bacteria 1449
197 Ga0495653_0000070 3300046463 Bacteria 88725
198 Ga0495653_0122664 3300046463 Bacteria 1849
199 Ga0495650_0296784 3300046471 Bacteria 542
200 Ga0495662_0001085 3300046476 Bacteria 13377
201 Ga0495662_0099964 3300046476 Bacteria 1419
202 Ga0495662_0456606 3300046476 Bacteria 627
203 Ga0495664_0000019 3300046477 Bacteria 153012
204 Ga0495664_0151137 3300046477 Bacteria 1408
205 Ga0495596_0106334 3300046500 Bacteria 1090
206 Ga0495608_0000026 3300046511 Bacteria 156234
207 Ga0495608_0251719 3300046511 Bacteria 1101
208 Ga0495618_0000015 3300046514 Bacteria 152478
209 Ga0495628_0000006 3300046516 Bacteria 306606
210 Ga0495628_0040027 3300046516 Bacteria 3747
211 Ga0495630_0009063 3300046517 Bacteria 7151
212 Ga0495652_0000030 3300046529 Bacteria 152921
213 Ga0495652_0515339 3300046529 Bacteria 827
214 Ga0495652_0523900 3300046529 Bacteria 819
215 Ga0495640_0000013 3300046533 Bacteria 172438
216 Ga0495586_0030405 3300046535 Bacteria 2890
217 Ga0495587_0000021 3300046536 Bacteria 152895
218 Ga0495587_0117271 3300046536 Bacteria 1526
219 Ga0495609_0255116 3300046538 Bacteria 721
220 Ga0495645_0000001 3300046543 Bacteria 657910
221 Ga0495645_0155994 3300046543 Bacteria 1581
222 Ga0495622_0005864 3300046557 Bacteria 5702
223 Ga0495667_0000027 3300046559 Bacteria 152535
224 Ga0495667_0012209 3300046559 Bacteria 5819
225 Ga0495634_0000008 3300046642 Bacteria 163983
226 Ga0495634_0161845 3300046642 Bacteria 1410
227 Ga0495635_0000028 3300046663 Bacteria 121669
228 Ga0495635_0499278 3300046663 Bacteria 801
229 Ga0495661_0071421 3300046665 Bacteria 2029
230 Ga0495588_0038625 3300046674 Bacteria 2429
231 Ga0495657_0000150 3300046675 Bacteria 63076
232 Ga0495657_0004541 3300046675 Bacteria 11089
233 Ga0495599_0000014 3300046678 Bacteria 177414
234 Ga0495599_0586113 3300046678 Bacteria 650
235 Ga0495623_0000006 3300046679 Bacteria 140385
236 Ga0495623_0007996 3300046679 Bacteria 6871
237 Ga0495646_0000026 3300046680 Bacteria 100569
238 Ga0495613_0019285 3300046689 Bacteria 5085
239 Ga0495624_0019443 3300046690 Bacteria 4533
240 Ga0495600_0000005 3300046809 Bacteria 171675
241 Ga0495600_0000770 3300046809 Bacteria 16882
242 Ga0495581_0017835 3300047315 Bacteria 4125
243 Ga0495604_0000002 3300047317 Bacteria 530904
244 Ga0495604_0021321 3300047317 Bacteria 5172
245 Ga0495674_0000004 3300047319 Bacteria 531855
246 Ga0495674_0696846 3300047319 Bacteria 797
247 Ga0495676_0167960 3300047321 Bacteria 1546
248 Ga0495680_0000402 3300047322 Bacteria 48430
249 Ga0495680_0028551 3300047322 Bacteria 4573
250 Ga0495675_0000114 3300047444 Bacteria 57905
251 Ga0495675_0023180 3300047444 Bacteria 3956
252 Ga0495673_0218583 3300047469 Bacteria 706
253 Ga0495684_0000004 3300047471 Bacteria 307093
254 Ga0495686_0002017 3300047472 Bacteria 20064
255 Ga0495593_0002445 3300047673 Bacteria 11171
256 Ga0495602_0000001 3300048088 Bacteria 510904
257 Ga0495602_0043082 3300048088 Bacteria 4107
258 Ga0495626_0099283 3300048091 Bacteria 1271
259 Ga0496100_0552482 3300048903 Bacteria 891
260 Ga0496101_0972118 3300048904 Bacteria 668
261 Ga0496104_0367835 3300048907 Bacteria 1350
262 Ga0496105_0029100 3300048908 Bacteria 4521
263 Ga0496105_0031767 3300048908 Bacteria 4330
264 Ga0496105_0523991 3300048908 Unclassified 928
265 Ga0496108_1114777 3300048911 Bacteria 670
266 Ga0496110_0253161 3300048913 Bacteria 1603
267 Ga0496111_0106195 3300048914 Bacteria 2067
268 Ga0496111_0224164 3300048914 Bacteria 1397
269 Ga0496114_0026431 3300048917 Bacteria 4752
270 Ga0496115_0405245 3300048918 Bacteria 1106
271 Ga0496117_0058473 3300048920 Bacteria 2670
272 Ga0496118_0345545 3300048921 Bacteria 795
273 Ga0496121_0022428 3300048924 Bacteria 6128
274 Ga0496121_0058770 3300048924 Bacteria 3176
275 Ga0496122_0000129 3300048925 Bacteria 173688
276 Ga0496123_0000113 3300048926 Bacteria 163689
277 Ga0496126_0215722 3300048929 Bacteria 1614
278 Ga0501036_1256389 3300049572 Bacteria 603
279 nmdc:mga0yw44_38696_c1 3300050492 Bacteria 2824
280 nmdc:mga06r32_155022_c1 3300050510 Bacteria 2271
281 Ga0495601_0000023 3300053077 Bacteria 140141
282 Ga0495612_0000005 3300053078 Bacteria 286943
283 Ga0495595_0000013 3300053084 Bacteria 160811
284 Ga0495619_0000003 3300053085 Bacteria 515784
285 Ga0495619_0821653 3300053085 Bacteria 628
286 Ga0500643_000685 3300053087 Bacteria 22591
287 Ga0500651_0259273 3300053093 Bacteria 1008
288 Ga0500594_0045050 3300053118 Bacteria 1222
289 Ga0500597_004236 3300053120 Bacteria 4404
290 Ga0500622_0181028 3300053156 Bacteria 974
291 Ga0500552_000529 3300053733 Bacteria 3548
292 Ga0500661_038090 3300055283 Bacteria 851
293 Ga0163163_10059652
294 JGI25406J46586_10012089
295 JGI25160J50197_1021166
296 Ga0055530_10113662
297 Ga0058860_11830360
298 Ga0065165_1007267
299 Ga0065714_10131453
300 Ga0070683_101110590
301 Ga0070690_100736332
302 Ga0070677_10329502
303 Ga0070666_10216131
304 Ga0070680_101841589
305 Ga0068868_101696748
306 Ga0070668_100113325
307 Ga0070671_100011383
308 Ga0070671_100343774
309 Ga0070674_100039799
310 Ga0070674_100424119
311 Ga0070673_100335545
312 Ga0070659_100118164
313 Ga0070659_101980514
314 Ga0070667_100000173
315 Ga0070713_100014400
316 Ga0070710_10719898
317 Ga0070711_100002668
318 Ga0070708_100026570
319 Ga0070708_100916385
320 Ga0070663_100000068
321 Ga0070662_100338119
322 Ga0070681_10275718
323 Ga0068867_100703821
324 Ga0070706_100186629
325 Ga0070706_100679521
326 Ga0070706_101465341
327 Ga0070679_100366008
328 Ga0070697_100929148
329 Ga0070697_101945677
330 Ga0068853_100000582
331 Ga0068853_100004383
332 Ga0068853_100154847
333 Ga0068853_101300606
334 Ga0070672_100419555
335 Ga0070686_100339814
336 Ga0070693_101376486
337 Ga0070665_100011669
338 Ga0068855_100020705
339 Ga0070664_100018035
340 Ga0068856_100252755
341 Ga0068856_100900040
342 Ga0068856_102460383
343 Ga0068859_100473502
344 Ga0068863_100008424
345 Ga0068863_100042517
346 Ga0068863_100875236
347 Ga0068862_100441787
348 Ga0081539_10000060
349 Ga0075365_10048642
350 Ga0070715_10355844
351 Ga0070716_100769161
352 Ga0070712_100117291
353 Ga0068871_100117012
354 Ga0068871_100810890
355 Ga0075430_100805021
356 Ga0075431_100099189
357 Ga0075429_101237331
358 Ga0075436_100069961
359 Ga0097620_100473576
360 Ga0075435_100381954
361 Ga0105240_10310837
362 Ga0105245_10200050
363 Ga0105247_10087054
364 Ga0105243_10235452
365 Ga0105241_12095984
366 Ga0105242_10272437
367 Ga0105242_11082134
368 Ga0105248_10000216
369 Ga0105248_11556156
370 Ga0105237_10001539
371 Ga0105237_10059750
372 Ga0105249_10000175
373 Ga0105249_10267044
374 Ga0105239_10075264
375 Ga0105239_10194538
376 Ga0105239_10416169
377 Ga0157373_10923358
378 Ga0157370_10814267
379 Ga0157378_10086122
380 Ga0163162_10455100
381 Ga0163162_11955651
382 Ga0163163_10672089
383 Ga0157380_10198061
384 Ga0157379_10139922
385 Ga0157379_11042092
386 Ga0157376_10045827
387 Ga0163161_10231727
388 Ga0163161_11397391
389 Ga0213876_10683714
390 Ga0209564_1091201
391 Ga0209758_1021524
392 Ga0209050_1012391
393 Ga0207426_1001044
394 Ga0207426_1043454
395 Ga0209257_1000923
396 Ga0207697_10241699
397 Ga0207682_10090349
398 Ga0207710_10136796
399 Ga0207680_10032467
400 Ga0207685_10657454
401 Ga0207699_10159683
402 Ga0207645_10020187
403 Ga0207705_10339569
404 Ga0207705_11241216
405 Ga0207654_11001568
406 Ga0207695_10186385
407 Ga0207671_10008277
408 Ga0207671_10426909
409 Ga0207663_10055490
410 Ga0207663_10855717
411 Ga0207681_10194221
412 Ga0207700_10197094
413 Ga0207664_10660819
414 Ga0207644_10002735
415 Ga0207644_10271606
416 Ga0207706_10360993
417 Ga0207686_10571279
418 Ga0207669_10471448
419 Ga0207704_10363549
420 Ga0207711_10022872
421 Ga0207711_10043491
422 Ga0207711_11086329
423 Ga0207661_10944721
424 Ga0207679_10061892
425 Ga0207667_10033630
426 Ga0207651_10244777
427 Ga0207651_10354783
428 Ga0207712_10000548
429 Ga0207712_10268903
430 Ga0207668_11022691
431 Ga0207668_11537782
432 Ga0207658_10003063
433 Ga0207677_11575576
434 Ga0207639_10006457
435 Ga0207639_10018371
436 Ga0207678_10002332
437 Ga0207678_10285542
438 Ga0207708_10408950
439 Ga0207708_11605405
440 Ga0207702_12174820
441 Ga0207641_10022511
442 Ga0207641_10634457
443 Ga0207641_11725845
444 Ga0207648_10258443
445 Ga0207648_10340797
446 Ga0207675_100521971
447 Ga0207683_10726632
448 Ga0207698_10961456
449 Ga0268266_10013203
450 Ga0268266_10787736
451 Ga0268265_10133386
452 Ga0268264_10301556
453 Ga0265334_10000890
454 Ga0307515_10454560
455 Ga0265338_10017178
456 Ga0307513_10137445
457 Ga0265314_10030929
458 Ga0373930_0036473
459 Ga0373926_0322718
460 Ga0373932_0036886
461 Ga0373936_0000737
462 Ga0373953_0023694
463 Ga0373954_0044891
464 Ga0373956_0012580
465 Ga0373943_0081362
466 Ga0373946_0000783
467 Ga0373955_0000078
468 Ga0373924_0006732
469 Ga0373935_0000113
470 Ga0373935_0723218
471 Ga0373927_0206614
472 Ga0373947_0016546
473 Ga0373937_0000007
474 Ga0373937_0626537
475 Ga0373925_0000011
476 Ga0373925_1291761
477 Ga0395898_1197432
478 Ga0395901_1136845
479 Ga0451793_1104745
480 Ga0451793_1170506
481 Ga0451797_0958960
482 Ga0451802_1673662
483 Ga0466963_0351910
484 Ga0495592_0000067
485 Ga0495592_0021861
486 Ga0495629_0004504
487 Ga0495651_0002020
488 Ga0495651_0189284
489 Ga0495653_0000070
490 Ga0495653_0122664
491 Ga0495650_0296784
492 Ga0495662_0001085
493 Ga0495662_0099964
494 Ga0495662_0456606
495 Ga0495664_0000019
496 Ga0495664_0151137
497 Ga0495596_0106334
498 Ga0495608_0000026
499 Ga0495608_0251719
500 Ga0495618_0000015
501 Ga0495628_0000006
502 Ga0495628_0040027
503 Ga0495630_0009063
504 Ga0495652_0000030
505 Ga0495652_0515339
506 Ga0495652_0523900
507 Ga0495640_0000013
508 Ga0495586_0030405
509 Ga0495587_0000021
510 Ga0495587_0117271
511 Ga0495609_0255116
512 Ga0495645_0000001
513 Ga0495645_0155994
514 Ga0495622_0005864
515 Ga0495667_0000027
516 Ga0495667_0012209
517 Ga0495634_0000008
518 Ga0495634_0161845
519 Ga0495635_0000028
520 Ga0495635_0499278
521 Ga0495661_0071421
522 Ga0495588_0038625
523 Ga0495657_0000150
524 Ga0495657_0004541
525 Ga0495599_0000014
526 Ga0495599_0586113
527 Ga0495623_0000006
528 Ga0495623_0007996
529 Ga0495646_0000026
530 Ga0495613_0019285
531 Ga0495624_0019443
532 Ga0495600_0000005
533 Ga0495600_0000770
534 Ga0495581_0017835
535 Ga0495604_0000002
536 Ga0495604_0021321
537 Ga0495674_0000004
538 Ga0495674_0696846
539 Ga0495676_0167960
540 Ga0495680_0000402
541 Ga0495680_0028551
542 Ga0495675_0000114
543 Ga0495675_0023180
544 Ga0495673_0218583
545 Ga0495684_0000004
546 Ga0495686_0002017
547 Ga0495593_0002445
548 Ga0495602_0000001
549 Ga0495602_0043082
550 Ga0495626_0099283
551 Ga0496100_0552482
552 Ga0496101_0972118
553 Ga0496104_0367835
554 Ga0496105_0029100
555 Ga0496105_0031767
556 Ga0496105_0523991
557 Ga0496108_1114777
558 Ga0496110_0253161
559 Ga0496111_0106195
560 Ga0496111_0224164
561 Ga0496114_0026431
562 Ga0496115_0405245
563 Ga0496117_0058473
564 Ga0496118_0345545
565 Ga0496121_0022428
566 Ga0496121_0058770
567 Ga0496122_0000129
568 Ga0496123_0000113
569 Ga0496126_0215722
570 Ga0501036_1256389
571 nmdc:mga0yw44_38696_c1
572 nmdc:mga06r32_155022_c1
573 Ga0495601_0000023
574 Ga0495612_0000005
575 Ga0495595_0000013
576 Ga0495619_0000003
577 Ga0495619_0821653
578 Ga0500643_000685
579 Ga0500651_0259273
580 Ga0500594_0045050
581 Ga0500597_004236
582 Ga0500622_0181028
583 Ga0500552_000529
584 Ga0500661_038090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

56

142

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.894 1 129
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8497 4 114
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8237 1 129
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8209 6 103
3f42-assembly1.cif.gz_B-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.8144 4 19
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8523 3 126 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8491 5 114 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8247 7 103 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8201 6 103 2.170.150.70
af_Q54K75_474_668_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8111 59 84 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A530AJC1-F1-model_v4 GFA family protein 0.9965 3 110 GO:0016846
GO:0046872
AF-A0A530GKI3-F1-model_v4 GFA family protein 0.9915 3 99 GO:0016846
GO:0046872
AF-A0A1M6W7J2-F1-model_v4 Uncharacterized conserved protein 0.9914 2 142 GO:0016846
GO:0046872
AF-A0A436RC34-F1-model_v4 GFA family protein 0.9872 2 87 GO:0016846
GO:0046872
AF-A0A4R3GC13-F1-model_v4 deleted 0.986 25 142

Map