F390769

General Info

Members Datasets Scaffolds Average Seq Length
292 206 584 161

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100007396|Ga0070714_1000073964
Length 180
Sequence MQASTSGGTAEKQLAAFIRKFSPVDQRRIRAIRTALRKRLPTANELVYDNYNFFVIGYSPTERPSDAIVSMAARANGVGLCFIHGAKLPDPDKVLLGSGKQTRFIRLDSPQVLERPEVKALVAAAITQAPAPLPAAGRGKLIIRSVSAKQRPRTKPLRRGVHFSPQSSSKMLRKSRGMGL

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.08
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 31.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100007396 3300005435 Bacteria 8544
2 JGI24751J29686_10016305 3300002459 Unclassified 1533
3 Ga0065715_10015698 3300005293 Bacteria 3086
4 Ga0065715_10482629 3300005293 Unclassified 785
5 Ga0065715_10557054 3300005293 Unclassified 734
6 Ga0065707_10086260 3300005295 Bacteria 5566
7 Ga0065707_10183449 3300005295 Unclassified 1404
8 Ga0070676_10596056 3300005328 Unclassified 796
9 Ga0070683_100007411 3300005329 Bacteria 9269
10 Ga0070683_100015842 3300005329 Bacteria 6630
11 Ga0070670_100010814 3300005331 Bacteria 7795
12 Ga0070670_100053588 3300005331 Unclassified 3464
13 Ga0068869_100006403 3300005334 Bacteria 7465
14 Ga0070666_10084162 3300005335 Bacteria 2177
15 Ga0070666_10286928 3300005335 Unclassified 1170
16 Ga0070660_100464331 3300005339 Unclassified 1051
17 Ga0070689_100013514 3300005340 Bacteria 5911
18 Ga0070689_100015716 3300005340 Bacteria 5526
19 Ga0070689_100163356 3300005340 Bacteria 1801
20 Ga0070661_100000731 3300005344 Bacteria 23961
21 Ga0070661_100010762 3300005344 Bacteria 6368
22 Ga0070661_100311629 3300005344 Unclassified 1227
23 Ga0070692_10008651 3300005345 Bacteria 4549
24 Ga0070668_100733880 3300005347 Unclassified 873
25 Ga0070675_100031300 3300005354 Bacteria 4300
26 Ga0070675_100055968 3300005354 Bacteria 3248
27 Ga0070675_100163086 3300005354 Bacteria 1918
28 Ga0070675_100518671 3300005354 Unclassified 1075
29 Ga0070675_101204004 3300005354 Unclassified 697
30 Ga0070688_100072012 3300005365 Bacteria 2214
31 Ga0070688_100283803 3300005365 Bacteria 1191
32 Ga0070659_100048102 3300005366 Bacteria 3349
33 Ga0070667_100066198 3300005367 Unclassified 3069
34 Ga0070667_100121337 3300005367 Bacteria 2274
35 Ga0070667_101857439 3300005367 Bacteria 567
36 Ga0070709_10052787 3300005434 Bacteria 2557
37 Ga0070713_100245795 3300005436 Bacteria 1630
38 Ga0070713_101060896 3300005436 Bacteria 782
39 Ga0070710_10117808 3300005437 Bacteria 1603
40 Ga0070701_10282575 3300005438 Bacteria 1014
41 Ga0070711_100048851 3300005439 Bacteria 2895
42 Ga0070711_100608054 3300005439 Bacteria 913
43 Ga0070711_100875377 3300005439 Bacteria 765
44 Ga0070705_100012029 3300005440 Unclassified 4384
45 Ga0070708_100133339 3300005445 Bacteria 2300
46 Ga0070708_100701875 3300005445 Bacteria 952
47 Ga0070708_101320210 3300005445 Unclassified 674
48 Ga0070663_100029438 3300005455 Unclassified 3753
49 Ga0070681_10219476 3300005458 Bacteria 1816
50 Ga0070685_10034788 3300005466 Plasmid 2839
51 Ga0070685_10405881 3300005466 Unclassified 945
52 Ga0070685_10708515 3300005466 Bacteria 734
53 Ga0070707_100381748 3300005468 Bacteria 1369
54 Ga0070698_100330200 3300005471 Bacteria 1456
55 Ga0070679_100042101 3300005530 Unclassified 4548
56 Ga0070684_100000844 3300005535 Bacteria 21584
57 Ga0070684_100001494 3300005535 Bacteria 16887
58 Ga0070697_100044440 3300005536 Bacteria 3598
59 Ga0070697_100560343 3300005536 Unclassified 1002
60 Ga0070672_100264163 3300005543 Unclassified 1452
61 Ga0070686_100163337 3300005544 Unclassified 1570
62 Ga0070686_101462609 3300005544 Bacteria 575
63 Ga0070665_100057447 3300005548 Bacteria 3900
64 Ga0070665_101001384 3300005548 Unclassified 848
65 Ga0070704_102108857 3300005549 Bacteria 524
66 Ga0070664_100040778 3300005564 Bacteria 3916
67 Ga0070664_100093833 3300005564 Unclassified 2601
68 Ga0070664_100110367 3300005564 Bacteria 2400
69 Ga0068857_100017413 3300005577 Bacteria 6297
70 Ga0068857_100019771 3300005577 Bacteria 5916
71 Ga0068856_100333875 3300005614 Bacteria 1534
72 Ga0068852_100148278 3300005616 Bacteria 2178
73 Ga0068859_100472746 3300005617 Bacteria 1349
74 Ga0068859_100549435 3300005617 Bacteria 1249
75 Ga0068851_10065015 3300005834 Bacteria 1876
76 Ga0068863_100111983 3300005841 Unclassified 2599
77 Ga0068863_100153587 3300005841 Bacteria 2203
78 Ga0068858_100304296 3300005842 Unclassified 1521
79 Ga0070717_10717549 3300006028 Bacteria 908
80 Ga0070716_100652006 3300006173 Unclassified 798
81 Ga0070712_100163002 3300006175 Bacteria 1723
82 Ga0070712_101020068 3300006175 Unclassified 716
83 Ga0097621_100056100 3300006237 Bacteria 3218
84 Ga0068871_100039315 3300006358 Unclassified 3784
85 Ga0075428_100081435 3300006844 Bacteria 3533
86 Ga0075428_100575040 3300006844 Bacteria 1204
87 Ga0075428_100996866 3300006844 Unclassified 887
88 Ga0075428_102119167 3300006844 Unclassified 581
89 Ga0075431_100021909 3300006847 Bacteria 6533
90 Ga0075433_10009078 3300006852 Bacteria 7941
91 Ga0075433_10083133 3300006852 Bacteria 2825
92 Ga0075434_100007901 3300006871 Bacteria 9858
93 Ga0075429_101484745 3300006880 Bacteria 590
94 Ga0097620_100471405 3300006931 Bacteria 1351
95 Ga0097620_100472693 3300006931 Bacteria 1349
96 Ga0097620_100549422 3300006931 Bacteria 1249
97 Ga0075435_101192540 3300007076 Unclassified 666
98 Ga0105240_10624226 3300009093 Unclassified 1184
99 Ga0111539_10124471 3300009094 Bacteria 3021
100 Ga0111539_10193478 3300009094 Bacteria 2373
101 Ga0105245_10091248 3300009098 Bacteria 2803
102 Ga0114129_10005042 3300009147 Bacteria 18586
103 Ga0114129_10050222 3300009147 Bacteria 5859
104 Ga0105242_10040636 3300009176 Bacteria 3748
105 Ga0105242_10822859 3300009176 Unclassified 921
106 Ga0105248_10118489 3300009177 Bacteria 2986
107 Ga0105248_10247520 3300009177 Bacteria 2006
108 Ga0105249_10048458 3300009553 Unclassified 3873
109 Ga0105239_10681973 3300010375 Unclassified 1174
110 Ga0105246_10417477 3300011119 Unclassified 1119
111 Ga0157371_10394684 3300013102 Bacteria 1012
112 Ga0157370_10210029 3300013104 Bacteria 1804
113 Ga0157369_10430981 3300013105 Bacteria 1367
114 Ga0157374_10144370 3300013296 Bacteria 2311
115 Ga0157374_11097900 3300013296 Unclassified 816
116 Ga0157372_10098978 3300013307 Bacteria 3326
117 Ga0157375_10110710 3300013308 Bacteria 2844
118 Ga0157375_10116647 3300013308 Bacteria 2775
119 Ga0157375_11174718 3300013308 Bacteria 900
120 Ga0163163_10051533 3300014325 Bacteria 4058
121 Ga0163163_10664840 3300014325 Bacteria 1105
122 Ga0157380_10236495 3300014326 Unclassified 1644
123 Ga0157380_12813220 3300014326 Unclassified 553
124 Ga0157379_10254281 3300014968 Unclassified 1595
125 Ga0157376_10015164 3300014969 Bacteria 5812
126 Ga0157376_10084568 3300014969 Bacteria 2732
127 Ga0157376_10253704 3300014969 Bacteria 1644
128 Ga0157376_11167092 3300014969 Bacteria 797
129 Ga0224572_1000973 3300024225 Unclassified 3948
130 Ga0207697_10001844 3300025315 Bacteria 11342
131 Ga0207697_10119770 3300025315 Bacteria 1132
132 Ga0207656_10090565 3300025321 Bacteria 1388
133 Ga0207680_10063685 3300025903 Bacteria 2258
134 Ga0207680_10157808 3300025903 Bacteria 1519
135 Ga0207680_10281197 3300025903 Unclassified 1156
136 Ga0207647_10179725 3300025904 Bacteria 1229
137 Ga0207699_10250935 3300025906 Bacteria 1219
138 Ga0207645_10514371 3300025907 Bacteria 811
139 Ga0207684_10013792 3300025910 Bacteria 6981
140 Ga0207707_10057455 3300025912 Unclassified 3386
141 Ga0207663_10394044 3300025916 Bacteria 1057
142 Ga0207657_10586202 3300025919 Unclassified 871
143 Ga0207649_10011136 3300025920 Bacteria 4950
144 Ga0207649_10204522 3300025920 Unclassified 1397
145 Ga0207652_10109635 3300025921 Bacteria 2447
146 Ga0207646_10038359 3300025922 Bacteria 4316
147 Ga0207650_10001479 3300025925 Bacteria 16860
148 Ga0207650_10007872 3300025925 Bacteria 7257
149 Ga0207650_10829040 3300025925 Unclassified 784
150 Ga0207659_10041775 3300025926 Unclassified 3212
151 Ga0207659_10259070 3300025926 Bacteria 1414
152 Ga0207659_10408582 3300025926 Unclassified 1137
153 Ga0207659_10876414 3300025926 Bacteria 772
154 Ga0207700_10350113 3300025928 Bacteria 1286
155 Ga0207700_10590470 3300025928 Bacteria 988
156 Ga0207664_10320066 3300025929 Bacteria 1368
157 Ga0207644_11265152 3300025931 Bacteria 620
158 Ga0207690_10128329 3300025932 Bacteria 1852
159 Ga0207706_10682606 3300025933 Unclassified 878
160 Ga0207686_10755907 3300025934 Unclassified 776
161 Ga0207670_10065431 3300025936 Unclassified 2494
162 Ga0207670_10199383 3300025936 Bacteria 1520
163 Ga0207670_10691081 3300025936 Unclassified 844
164 Ga0207704_10253358 3300025938 Bacteria 1323
165 Ga0207665_10721574 3300025939 Unclassified 784
166 Ga0207691_10822599 3300025940 Unclassified 780
167 Ga0207711_10296423 3300025941 Bacteria 1491
168 Ga0207711_10835973 3300025941 Unclassified 857
169 Ga0207711_11850671 3300025941 Unclassified 547
170 Ga0207689_10047533 3300025942 Unclassified 3542
171 Ga0207661_10092424 3300025944 Bacteria 2522
172 Ga0207679_10007283 3300025945 Bacteria 7011
173 Ga0207679_10010382 3300025945 Bacteria 5993
174 Ga0207679_10043000 3300025945 Unclassified 3250
175 Ga0207651_10224692 3300025960 Bacteria 1520
176 Ga0207668_10661550 3300025972 Unclassified 915
177 Ga0207658_10109846 3300025986 Bacteria 2178
178 Ga0207677_10554981 3300026023 Bacteria 1002
179 Ga0207703_10112115 3300026035 Unclassified 2329
180 Ga0207678_10008984 3300026067 Bacteria 8795
181 Ga0207702_11091146 3300026078 Unclassified 792
182 Ga0207702_11376282 3300026078 Unclassified 700
183 Ga0207641_10611090 3300026088 Bacteria 1068
184 Ga0207674_10000768 3300026116 Bacteria 41933
185 Ga0207674_10072203 3300026116 Unclassified 3467
186 Ga0207683_10276819 3300026121 Bacteria 1533
187 Ga0207428_10479249 3300027907 Bacteria 905
188 Ga0268266_10023860 3300028379 Bacteria 5205
189 Ga0268266_10900803 3300028379 Unclassified 855
190 Ga0265337_1004622 3300028556 Bacteria 5670
191 Ga0265337_1028936 3300028556 Bacteria 1660
192 Ga0265326_10084040 3300028558 Unclassified 900
193 Ga0265319_1009766 3300028563 Unclassified 4052
194 Ga0265319_1081331 3300028563 Bacteria 1028
195 Ga0265334_10036326 3300028573 Bacteria 1946
196 Ga0265318_10001459 3300028577 Bacteria 13877
197 Ga0265323_10110444 3300028653 Unclassified 902
198 Ga0265322_10140298 3300028654 Unclassified 690
199 Ga0265336_10172815 3300028666 Archaea 643
200 Ga0265338_11052174 3300028800 Unclassified 549
201 Ga0265324_10041780 3300029957 Bacteria 1585
202 Ga0265762_1017994 3300030760 Bacteria 1289
203 Ga0265332_10098973 3300031238 Bacteria 1231
204 Ga0265320_10023037 3300031240 Unclassified 3322
205 Ga0265320_10032763 3300031240 Bacteria 2657
206 Ga0265325_10295123 3300031241 Bacteria 724
207 Ga0265340_10011914 3300031247 Plasmid 4605
208 Ga0265339_10054731 3300031249 Bacteria 2166
209 Ga0265339_10235699 3300031249 Bacteria 890
210 Ga0265316_10262125 3300031344 Unclassified 1267
211 Ga0265316_10385193 3300031344 Bacteria 1011
212 Ga0265313_10029781 3300031595 Bacteria 2818
213 Ga0307508_10000183 3300031616 Bacteria 75801
214 Ga0265314_10094344 3300031711 Bacteria 1940
215 Ga0265314_10418969 3300031711 Bacteria 720
216 Ga0265342_10098826 3300031712 Unclassified 1665
217 Ga0373934_0003570 3300035086 Bacteria 5719
218 Ga0373931_0098928 3300035691 Unclassified 1638
219 Ga0373933_0264001 3300035724 Bacteria 1110
220 Ga0373937_0519401 3300036401 Bacteria 1131
221 Ga0395905_0106482 3300037471 Bacteria 2633
222 Ga0451839_0778359 3300041496 Unclassified 546
223 Ga0451853_1937749 3300041512 Bacteria 679
224 Ga0439460_0235632 3300042461 Bacteria 630
225 Ga0495592_0171025 3300046454 Bacteria 1488
226 Ga0495641_0554884 3300046461 Unclassified 524
227 Ga0495651_0242758 3300046462 Bacteria 1234
228 Ga0495653_0201783 3300046463 Bacteria 1349
229 Ga0495580_0020743 3300046472 Bacteria 4858
230 Ga0495639_0065219 3300046475 Bacteria 1675
231 Ga0495664_0268320 3300046477 Bacteria 1031
232 Ga0495585_0358377 3300046492 Bacteria 708
233 Ga0495618_0224798 3300046514 Bacteria 1183
234 Ga0495628_0049984 3300046516 Bacteria 3308
235 Ga0495630_0092631 3300046517 Unclassified 2284
236 Ga0495630_0277691 3300046517 Unclassified 1280
237 Ga0495652_0111666 3300046529 Bacteria 2197
238 Ga0495640_0113197 3300046533 Bacteria 1771
239 Ga0495586_0022473 3300046535 Bacteria 3366
240 Ga0495586_0163376 3300046535 Bacteria 1256
241 Ga0495587_0031313 3300046536 Bacteria 3221
242 Ga0495645_0019641 3300046543 Bacteria 4866
243 Ga0495667_0466593 3300046559 Bacteria 792
244 Ga0495656_0508923 3300046615 Unclassified 639
245 Ga0495634_0062006 3300046642 Bacteria 2484
246 Ga0495635_0083405 3300046663 Bacteria 2187
247 Ga0495599_0014908 3300046678 Bacteria 4815
248 Ga0495623_0011389 3300046679 Bacteria 5755
249 Ga0495613_0142701 3300046689 Unclassified 1710
250 Ga0495604_0108955 3300047317 Bacteria 2022
251 Ga0495674_0025514 3300047319 Bacteria 5418
252 Ga0495674_0296717 3300047319 Unclassified 1321
253 Ga0495675_0211666 3300047444 Bacteria 1176
254 Ga0495684_0036836 3300047471 Bacteria 3751
255 Ga0495684_0067698 3300047471 Bacteria 2715
256 Ga0495602_0059364 3300048088 Bacteria 3339
257 Ga0496102_0199357 3300048905 Bacteria 1887
258 Ga0496102_1052987 3300048905 Unclassified 734
259 Ga0496105_0790633 3300048908 Bacteria 722
260 Ga0496109_0579792 3300048912 Bacteria 1057
261 Ga0496110_1247401 3300048913 Unclassified 652
262 Ga0496111_1105051 3300048914 Bacteria 565
263 Ga0496113_0466974 3300048916 Unclassified 1014
264 Ga0496114_0084172 3300048917 Bacteria 2693
265 Ga0496115_0561080 3300048918 Unclassified 912
266 Ga0501036_0162953 3300049572 Bacteria 1880
267 Ga0501036_0369445 3300049572 Unclassified 1197
268 Ga0501039_0150088 3300049575 Bacteria 1831
269 Ga0501041_0010370 3300049577 Bacteria 5492
270 Ga0501041_0400499 3300049577 Unclassified 869
271 Ga0501042_0493885 3300049578 Unclassified 889
272 Ga0501046_0260914 3300049580 Bacteria 1273
273 Ga0501048_0070513 3300049582 Unclassified 2468
274 Ga0501072_0047538 3300049588 Bacteria 3379
275 Ga0501072_0238497 3300049588 Bacteria 1448
276 Ga0501074_0678863 3300049590 Unclassified 727
277 Ga0501075_0105935 3300049591 Bacteria 2137
278 Ga0501079_0144014 3300049741 Bacteria 1857
279 Ga0501035_0422371 3300049822 Unclassified 1107
280 Ga0501045_0050137 3300049824 Bacteria 3045
281 nmdc:mga05p37_3390_c2 3300050507 Bacteria 18151
282 nmdc:mga05p37_523488_c1 3300050507 Bacteria 1356
283 nmdc:mga06r32_25854_c1 3300050510 Bacteria 5465
284 nmdc:mga08y16_251092_c1 3300050511 Bacteria 1828
285 nmdc:mga0n895_48856_c1 3300050512 Bacteria 4143
286 nmdc:mga0rr50_1708163_c1 3300050513 Unclassified 530
287 nmdc:mga08x19_571351_c1 3300050514 Unclassified 801
288 nmdc:mga0a205_18330_c1 3300050515 Bacteria 6579
289 Ga0495601_0109497 3300053077 Bacteria 1788
290 Ga0495612_0259898 3300053078 Bacteria 773
291 Ga0495619_0134836 3300053085 Bacteria 1698
292 Ga0501084_0884764 3300054114 Unclassified 751
293 Ga0070714_100007396
294 JGI24751J29686_10016305
295 Ga0065715_10015698
296 Ga0065715_10482629
297 Ga0065715_10557054
298 Ga0065707_10086260
299 Ga0065707_10183449
300 Ga0070676_10596056
301 Ga0070683_100007411
302 Ga0070683_100015842
303 Ga0070670_100010814
304 Ga0070670_100053588
305 Ga0068869_100006403
306 Ga0070666_10084162
307 Ga0070666_10286928
308 Ga0070660_100464331
309 Ga0070689_100013514
310 Ga0070689_100015716
311 Ga0070689_100163356
312 Ga0070661_100000731
313 Ga0070661_100010762
314 Ga0070661_100311629
315 Ga0070692_10008651
316 Ga0070668_100733880
317 Ga0070675_100031300
318 Ga0070675_100055968
319 Ga0070675_100163086
320 Ga0070675_100518671
321 Ga0070675_101204004
322 Ga0070688_100072012
323 Ga0070688_100283803
324 Ga0070659_100048102
325 Ga0070667_100066198
326 Ga0070667_100121337
327 Ga0070667_101857439
328 Ga0070709_10052787
329 Ga0070713_100245795
330 Ga0070713_101060896
331 Ga0070710_10117808
332 Ga0070701_10282575
333 Ga0070711_100048851
334 Ga0070711_100608054
335 Ga0070711_100875377
336 Ga0070705_100012029
337 Ga0070708_100133339
338 Ga0070708_100701875
339 Ga0070708_101320210
340 Ga0070663_100029438
341 Ga0070681_10219476
342 Ga0070685_10034788
343 Ga0070685_10405881
344 Ga0070685_10708515
345 Ga0070707_100381748
346 Ga0070698_100330200
347 Ga0070679_100042101
348 Ga0070684_100000844
349 Ga0070684_100001494
350 Ga0070697_100044440
351 Ga0070697_100560343
352 Ga0070672_100264163
353 Ga0070686_100163337
354 Ga0070686_101462609
355 Ga0070665_100057447
356 Ga0070665_101001384
357 Ga0070704_102108857
358 Ga0070664_100040778
359 Ga0070664_100093833
360 Ga0070664_100110367
361 Ga0068857_100017413
362 Ga0068857_100019771
363 Ga0068856_100333875
364 Ga0068852_100148278
365 Ga0068859_100472746
366 Ga0068859_100549435
367 Ga0068851_10065015
368 Ga0068863_100111983
369 Ga0068863_100153587
370 Ga0068858_100304296
371 Ga0070717_10717549
372 Ga0070716_100652006
373 Ga0070712_100163002
374 Ga0070712_101020068
375 Ga0097621_100056100
376 Ga0068871_100039315
377 Ga0075428_100081435
378 Ga0075428_100575040
379 Ga0075428_100996866
380 Ga0075428_102119167
381 Ga0075431_100021909
382 Ga0075433_10009078
383 Ga0075433_10083133
384 Ga0075434_100007901
385 Ga0075429_101484745
386 Ga0097620_100471405
387 Ga0097620_100472693
388 Ga0097620_100549422
389 Ga0075435_101192540
390 Ga0105240_10624226
391 Ga0111539_10124471
392 Ga0111539_10193478
393 Ga0105245_10091248
394 Ga0114129_10005042
395 Ga0114129_10050222
396 Ga0105242_10040636
397 Ga0105242_10822859
398 Ga0105248_10118489
399 Ga0105248_10247520
400 Ga0105249_10048458
401 Ga0105239_10681973
402 Ga0105246_10417477
403 Ga0157371_10394684
404 Ga0157370_10210029
405 Ga0157369_10430981
406 Ga0157374_10144370
407 Ga0157374_11097900
408 Ga0157372_10098978
409 Ga0157375_10110710
410 Ga0157375_10116647
411 Ga0157375_11174718
412 Ga0163163_10051533
413 Ga0163163_10664840
414 Ga0157380_10236495
415 Ga0157380_12813220
416 Ga0157379_10254281
417 Ga0157376_10015164
418 Ga0157376_10084568
419 Ga0157376_10253704
420 Ga0157376_11167092
421 Ga0224572_1000973
422 Ga0207697_10001844
423 Ga0207697_10119770
424 Ga0207656_10090565
425 Ga0207680_10063685
426 Ga0207680_10157808
427 Ga0207680_10281197
428 Ga0207647_10179725
429 Ga0207699_10250935
430 Ga0207645_10514371
431 Ga0207684_10013792
432 Ga0207707_10057455
433 Ga0207663_10394044
434 Ga0207657_10586202
435 Ga0207649_10011136
436 Ga0207649_10204522
437 Ga0207652_10109635
438 Ga0207646_10038359
439 Ga0207650_10001479
440 Ga0207650_10007872
441 Ga0207650_10829040
442 Ga0207659_10041775
443 Ga0207659_10259070
444 Ga0207659_10408582
445 Ga0207659_10876414
446 Ga0207700_10350113
447 Ga0207700_10590470
448 Ga0207664_10320066
449 Ga0207644_11265152
450 Ga0207690_10128329
451 Ga0207706_10682606
452 Ga0207686_10755907
453 Ga0207670_10065431
454 Ga0207670_10199383
455 Ga0207670_10691081
456 Ga0207704_10253358
457 Ga0207665_10721574
458 Ga0207691_10822599
459 Ga0207711_10296423
460 Ga0207711_10835973
461 Ga0207711_11850671
462 Ga0207689_10047533
463 Ga0207661_10092424
464 Ga0207679_10007283
465 Ga0207679_10010382
466 Ga0207679_10043000
467 Ga0207651_10224692
468 Ga0207668_10661550
469 Ga0207658_10109846
470 Ga0207677_10554981
471 Ga0207703_10112115
472 Ga0207678_10008984
473 Ga0207702_11091146
474 Ga0207702_11376282
475 Ga0207641_10611090
476 Ga0207674_10000768
477 Ga0207674_10072203
478 Ga0207683_10276819
479 Ga0207428_10479249
480 Ga0268266_10023860
481 Ga0268266_10900803
482 Ga0265337_1004622
483 Ga0265337_1028936
484 Ga0265326_10084040
485 Ga0265319_1009766
486 Ga0265319_1081331
487 Ga0265334_10036326
488 Ga0265318_10001459
489 Ga0265323_10110444
490 Ga0265322_10140298
491 Ga0265336_10172815
492 Ga0265338_11052174
493 Ga0265324_10041780
494 Ga0265762_1017994
495 Ga0265332_10098973
496 Ga0265320_10023037
497 Ga0265320_10032763
498 Ga0265325_10295123
499 Ga0265340_10011914
500 Ga0265339_10054731
501 Ga0265339_10235699
502 Ga0265316_10262125
503 Ga0265316_10385193
504 Ga0265313_10029781
505 Ga0307508_10000183
506 Ga0265314_10094344
507 Ga0265314_10418969
508 Ga0265342_10098826
509 Ga0373934_0003570
510 Ga0373931_0098928
511 Ga0373933_0264001
512 Ga0373937_0519401
513 Ga0395905_0106482
514 Ga0451839_0778359
515 Ga0451853_1937749
516 Ga0439460_0235632
517 Ga0495592_0171025
518 Ga0495641_0554884
519 Ga0495651_0242758
520 Ga0495653_0201783
521 Ga0495580_0020743
522 Ga0495639_0065219
523 Ga0495664_0268320
524 Ga0495585_0358377
525 Ga0495618_0224798
526 Ga0495628_0049984
527 Ga0495630_0092631
528 Ga0495630_0277691
529 Ga0495652_0111666
530 Ga0495640_0113197
531 Ga0495586_0022473
532 Ga0495586_0163376
533 Ga0495587_0031313
534 Ga0495645_0019641
535 Ga0495667_0466593
536 Ga0495656_0508923
537 Ga0495634_0062006
538 Ga0495635_0083405
539 Ga0495599_0014908
540 Ga0495623_0011389
541 Ga0495613_0142701
542 Ga0495604_0108955
543 Ga0495674_0025514
544 Ga0495674_0296717
545 Ga0495675_0211666
546 Ga0495684_0036836
547 Ga0495684_0067698
548 Ga0495602_0059364
549 Ga0496102_0199357
550 Ga0496102_1052987
551 Ga0496105_0790633
552 Ga0496109_0579792
553 Ga0496110_1247401
554 Ga0496111_1105051
555 Ga0496113_0466974
556 Ga0496114_0084172
557 Ga0496115_0561080
558 Ga0501036_0162953
559 Ga0501036_0369445
560 Ga0501039_0150088
561 Ga0501041_0010370
562 Ga0501041_0400499
563 Ga0501042_0493885
564 Ga0501046_0260914
565 Ga0501048_0070513
566 Ga0501072_0047538
567 Ga0501072_0238497
568 Ga0501074_0678863
569 Ga0501075_0105935
570 Ga0501079_0144014
571 Ga0501035_0422371
572 Ga0501045_0050137
573 nmdc:mga05p37_3390_c2
574 nmdc:mga05p37_523488_c1
575 nmdc:mga06r32_25854_c1
576 nmdc:mga08y16_251092_c1
577 nmdc:mga0n895_48856_c1
578 nmdc:mga0rr50_1708163_c1
579 nmdc:mga08x19_571351_c1
580 nmdc:mga0a205_18330_c1
581 Ga0495601_0109497
582 Ga0495612_0259898
583 Ga0495619_0134836
584 Ga0501084_0884764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

25

126

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p5d-assembly1.cif.gz_LD0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.6539 42 73
3i8b-assembly1.cif.gz_A the crystal structure of xylulose kinase from bifidobacterium adolescentis 0.6417 42 74
7pwo-assembly1.cif.gz_D2 cryo-em structure of giardia lamblia ribosome at 2.75 a resolution 0.6323 42 73
7epq-assembly1.cif.gz_B crystal structure of exopolyphosphatase (ppx) from porphyromonas gingivalis in complex with sulfate and magnesium ions 0.6313 43 73
6zu5-assembly1.cif.gz_LD0 structure of the paranosema locustae ribosome in complex with lso2 0.6288 43 73
ID Description Score Start End Superfamily
af_O94241_156_359_3.30.420.570 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7736 44 60 3.30.420.570
af_P9WHV5_1_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7465 43 74 3.30.420.40
af_Q04549_99_232_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7168 44 59 3.30.420.40
af_A0A1D8PMB3_8_308_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6906 43 77 3.30.420.40
af_P11553_2_245_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6846 42 74 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2V7SHS5-F1-model_v4 DUF1801 domain-containing protein 0.9938 10 74
AF-A0A1Q7UH75-F1-model_v4 YdhG-like domain-containing protein 0.9931 20 156
AF-Q1IV49-F1-model_v4 YdhG-like domain-containing protein 0.9891 10 154
AF-A0A2V6DPW7-F1-model_v4 YdhG-like domain-containing protein 0.9886 18 156
AF-A0A2V6CCC4-F1-model_v4 Uncharacterized protein 0.9872 10 156

Map