F390746

General Info

Members Datasets Scaffolds Average Seq Length
292 157 584 299

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100153017|Ga0070689_1001530172
Length 324
Sequence MSLVLFTRMRAGQYDVALSRMLGTWRHAMTNRTRFLWPASPAAQGEAPRIVHTDPAAFRQSSAVHAGAGSMAFAALLNRGAVTPEFNFLHRGVIPPGAGIGHHFHNVVEEMFVILDGEAQFTIDGRTATVKGPAGVVCRTGHSHAIYNAGSTPVQWMNLNVSVTAGVYDAFDLNDTRAAAALDAIPTFMTMRLDRALLRPAGARGRGAPAPASPTAVVSRRALGPSVFSTTWAYIDHVVVPPGASAPEQAHDAVGEAYYVLGGSGTVTIKGTAPETAAVRAGDAIPIRIGEASRFTNTGSEPLELFVMGVARDMAAKTRLLSGN

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 0
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 20.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100153017 3300005340 Bacteria 1861
2 Ga0065712_10188514 3300005290 Bacteria 1159
3 Ga0070676_10015436 3300005328 Bacteria 4214
4 Ga0070690_100005315 3300005330 Bacteria 7225
5 Ga0070690_100032361 3300005330 Unclassified 3266
6 Ga0070690_100115832 3300005330 Bacteria 1794
7 Ga0070670_100019729 3300005331 Bacteria 5789
8 Ga0070670_100070301 3300005331 Unclassified 3005
9 Ga0070670_100082899 3300005331 Bacteria 2755
10 Ga0070670_100158383 3300005331 Bacteria 1962
11 Ga0068869_100107018 3300005334 Bacteria 2123
12 Ga0070666_10108857 3300005335 Bacteria 1915
13 Ga0070666_10142292 3300005335 Unclassified 1671
14 Ga0070666_10150992 3300005335 Unclassified 1621
15 Ga0070666_10158652 3300005335 Bacteria 1581
16 Ga0068868_100044831 3300005338 Unclassified 3459
17 Ga0068868_100160545 3300005338 Unclassified 1856
18 Ga0070687_100010190 3300005343 Bacteria 4053
19 Ga0070687_100235019 3300005343 Bacteria 1130
20 Ga0070687_100294118 3300005343 Bacteria 1028
21 Ga0070661_100035352 3300005344 Bacteria 3628
22 Ga0070661_100075919 3300005344 Bacteria 2477
23 Ga0070669_100016823 3300005353 Bacteria 5219
24 Ga0070669_100139747 3300005353 Bacteria 1866
25 Ga0070669_100233450 3300005353 Bacteria 1459
26 Ga0070675_100020186 3300005354 Bacteria 5317
27 Ga0070675_100057764 3300005354 Bacteria 3199
28 Ga0070675_100062847 3300005354 Bacteria 3069
29 Ga0070675_100092110 3300005354 Bacteria 2541
30 Ga0070675_100333369 3300005354 Bacteria 1342
31 Ga0070671_100041534 3300005355 Bacteria 3823
32 Ga0070671_100059490 3300005355 Bacteria 3180
33 Ga0070674_100144535 3300005356 Bacteria 1789
34 Ga0070673_100028907 3300005364 Bacteria 4128
35 Ga0070673_100032683 3300005364 Bacteria 3922
36 Ga0070673_100078431 3300005364 Bacteria 2672
37 Ga0070673_100122577 3300005364 Bacteria 2171
38 Ga0070688_100053239 3300005365 Unclassified 2531
39 Ga0070688_100364420 3300005365 Unclassified 1061
40 Ga0070667_100012461 3300005367 Bacteria 7034
41 Ga0070667_100216754 3300005367 Bacteria 1703
42 Ga0070701_10058405 3300005438 Bacteria 2025
43 Ga0070700_100030511 3300005441 Bacteria 3223
44 Ga0070678_100068336 3300005456 Bacteria 2648
45 Ga0070678_100135974 3300005456 Unclassified 1960
46 Ga0068867_100005600 3300005459 Bacteria 8900
47 Ga0070685_10040158 3300005466 Bacteria 2662
48 Ga0070685_10205595 3300005466 Bacteria 1282
49 Ga0070699_100004746 3300005518 Bacteria 12014
50 Ga0070699_100381514 3300005518 Unclassified 1272
51 Ga0070684_100053145 3300005535 Bacteria 3525
52 Ga0070684_100094475 3300005535 Bacteria 2663
53 Ga0070672_100003582 3300005543 Bacteria 10057
54 Ga0070672_100129422 3300005543 Bacteria 2073
55 Ga0070672_100235320 3300005543 Bacteria 1540
56 Ga0070672_100552710 3300005543 Unclassified 1000
57 Ga0070686_100010991 3300005544 Bacteria 5125
58 Ga0070696_100228212 3300005546 Unclassified 1400
59 Ga0070664_100004138 3300005564 Bacteria 11653
60 Ga0070664_100007832 3300005564 Bacteria 8628
61 Ga0070664_100022853 3300005564 Bacteria 5158
62 Ga0070664_100070394 3300005564 Bacteria 2996
63 Ga0070664_100138187 3300005564 Bacteria 2144
64 Ga0068854_100089231 3300005578 Bacteria 2291
65 Ga0068859_100033104 3300005617 Bacteria 5192
66 Ga0068859_100094645 3300005617 Bacteria 3039
67 Ga0068859_100370387 3300005617 Unclassified 1528
68 Ga0068864_100008394 3300005618 Bacteria 8523
69 Ga0068864_100023448 3300005618 Bacteria 5182
70 Ga0068864_100055209 3300005618 Bacteria 3429
71 Ga0068864_100160595 3300005618 Bacteria 2043
72 Ga0068864_100201417 3300005618 Bacteria 1829
73 Ga0068866_10135674 3300005718 Unclassified 1406
74 Ga0068861_100213429 3300005719 Bacteria 1627
75 Ga0068861_100217154 3300005719 Bacteria 1614
76 Ga0068861_100280446 3300005719 Bacteria 1435
77 Ga0068851_10107515 3300005834 Bacteria 1486
78 Ga0068863_100041948 3300005841 Bacteria 4349
79 Ga0068863_100042238 3300005841 Bacteria 4332
80 Ga0068863_100051204 3300005841 Unclassified 3914
81 Ga0068863_100112140 3300005841 Bacteria 2597
82 Ga0068858_100102358 3300005842 Bacteria 2672
83 Ga0068858_100164563 3300005842 Bacteria 2090
84 Ga0068858_100248705 3300005842 Bacteria 1688
85 Ga0068860_100014236 3300005843 Bacteria 7797
86 Ga0068860_100057488 3300005843 Bacteria 3698
87 Ga0068862_100124729 3300005844 Bacteria 2273
88 Ga0068862_100666607 3300005844 Unclassified 1005
89 Ga0081539_10000065 3300005985 Bacteria 246571
90 Ga0081539_10000644 3300005985 Bacteria 70362
91 Ga0075364_10019960 3300006051 Bacteria 4212
92 Ga0075362_10000516 3300006177 Bacteria 11281
93 Ga0075367_10040215 3300006178 Unclassified 2729
94 Ga0075367_10170779 3300006178 Bacteria 1354
95 Ga0075427_10011678 3300006194 Bacteria 1326
96 Ga0075366_10001781 3300006195 Bacteria 10873
97 Ga0097621_100019723 3300006237 Bacteria 5183
98 Ga0097621_100041592 3300006237 Bacteria 3700
99 Ga0097621_100075912 3300006237 Unclassified 2787
100 Ga0097621_100139469 3300006237 Bacteria 2071
101 Ga0097621_100486541 3300006237 Bacteria 1116
102 Ga0097621_100491835 3300006237 Unclassified 1110
103 Ga0068871_100003278 3300006358 Bacteria 11106
104 Ga0068871_100006097 3300006358 Bacteria 8487
105 Ga0068871_100246411 3300006358 Bacteria 1555
106 Ga0075428_100364350 3300006844 Bacteria 1550
107 Ga0075428_100374344 3300006844 Bacteria 1527
108 Ga0075430_100021548 3300006846 Bacteria 5477
109 Ga0075431_100031108 3300006847 Bacteria 5497
110 Ga0075433_10018782 3300006852 Bacteria 5752
111 Ga0075434_100144367 3300006871 Bacteria 2400
112 Ga0068865_100038655 3300006881 Unclassified 3231
113 Ga0068865_100119271 3300006881 Bacteria 1959
114 Ga0097620_100033105 3300006931 Bacteria 5192
115 Ga0097620_100094644 3300006931 Bacteria 3039
116 Ga0097620_100370395 3300006931 Unclassified 1528
117 Ga0075435_100050622 3300007076 Bacteria 3343
118 Ga0075435_100257647 3300007076 Unclassified 1486
119 Ga0111539_10006628 3300009094 Bacteria 14917
120 Ga0111539_10263227 3300009094 Bacteria 2007
121 Ga0111539_10289681 3300009094 Bacteria 1905
122 Ga0105245_10026467 3300009098 Bacteria 5105
123 Ga0105247_10118648 3300009101 Bacteria 1712
124 Ga0114129_10058990 3300009147 Bacteria 5367
125 Ga0114129_10066456 3300009147 Bacteria 5030
126 Ga0114129_10281739 3300009147 Bacteria 2221
127 Ga0105242_10021525 3300009176 Bacteria 5065
128 Ga0105242_10074594 3300009176 Bacteria 2823
129 Ga0105242_10104770 3300009176 Unclassified 2401
130 Ga0105242_10242125 3300009176 Bacteria 1622
131 Ga0105248_10011732 3300009177 Bacteria 9663
132 Ga0105248_10022951 3300009177 Bacteria 6929
133 Ga0105238_10006341 3300009551 Bacteria 11762
134 Ga0105249_10460525 3300009553 Bacteria 1312
135 Ga0163162_10038892 3300013306 Bacteria 4749
136 Ga0163162_10086066 3300013306 Bacteria 3220
137 Ga0157375_10006153 3300013308 Bacteria 10459
138 Ga0157375_10009539 3300013308 Bacteria 8522
139 Ga0157375_10133201 3300013308 Bacteria 2606
140 Ga0157375_10197931 3300013308 Bacteria 2165
141 Ga0157375_10221707 3300013308 Bacteria 2049
142 Ga0163163_10079746 3300014325 Unclassified 3272
143 Ga0163163_10080326 3300014325 Bacteria 3261
144 Ga0163163_10093493 3300014325 Bacteria 3023
145 Ga0157380_10278402 3300014326 Bacteria 1529
146 Ga0157380_10283452 3300014326 Bacteria 1517
147 Ga0157380_10464529 3300014326 Bacteria 1219
148 Ga0157377_10042334 3300014745 Bacteria 2529
149 Ga0157379_10001821 3300014968 Bacteria 17601
150 Ga0157379_10106990 3300014968 Bacteria 2511
151 Ga0157376_10026164 3300014969 Bacteria 4607
152 Ga0157376_10076678 3300014969 Unclassified 2857
153 Ga0207680_10035034 3300025903 Bacteria 2878
154 Ga0207645_10019233 3300025907 Bacteria 4479
155 Ga0207643_10038558 3300025908 Unclassified 2684
156 Ga0207643_10287398 3300025908 Unclassified 1021
157 Ga0207662_10006085 3300025918 Bacteria 6492
158 Ga0207649_10034457 3300025920 Bacteria 3034
159 Ga0207649_10092087 3300025920 Bacteria 1987
160 Ga0207681_10115786 3300025923 Bacteria 1957
161 Ga0207681_10125916 3300025923 Unclassified 1886
162 Ga0207681_10236172 3300025923 Bacteria 1421
163 Ga0207681_10379607 3300025923 Bacteria 1137
164 Ga0207694_10034171 3300025924 Bacteria 3898
165 Ga0207650_10010824 3300025925 Bacteria 6267
166 Ga0207650_10040061 3300025925 Unclassified 3427
167 Ga0207650_10115039 3300025925 Bacteria 2087
168 Ga0207659_10022837 3300025926 Bacteria 4169
169 Ga0207659_10037009 3300025926 Bacteria 3385
170 Ga0207659_10070172 3300025926 Bacteria 2555
171 Ga0207659_10086382 3300025926 Bacteria 2332
172 Ga0207659_10417764 3300025926 Unclassified 1124
173 Ga0207687_10029776 3300025927 Bacteria 3674
174 Ga0207644_10004553 3300025931 Bacteria 9009
175 Ga0207644_10025835 3300025931 Bacteria 4041
176 Ga0207644_10039792 3300025931 Bacteria 3320
177 Ga0207644_10158999 3300025931 Bacteria 1755
178 Ga0207706_10314971 3300025933 Bacteria 1362
179 Ga0207686_10015134 3300025934 Bacteria 4308
180 Ga0207670_10039141 3300025936 Bacteria 3103
181 Ga0207669_10163177 3300025937 Unclassified 1577
182 Ga0207704_10152597 3300025938 Bacteria 1632
183 Ga0207691_10008888 3300025940 Bacteria 9646
184 Ga0207691_10032264 3300025940 Unclassified 4885
185 Ga0207691_10053569 3300025940 Bacteria 3683
186 Ga0207691_10205976 3300025940 Bacteria 1711
187 Ga0207711_10215610 3300025941 Bacteria 1754
188 Ga0207689_10000692 3300025942 Bacteria 32300
189 Ga0207689_10114413 3300025942 Bacteria 2217
190 Ga0207689_10315181 3300025942 Bacteria 1297
191 Ga0207661_10018277 3300025944 Bacteria 5207
192 Ga0207661_10255665 3300025944 Unclassified 1559
193 Ga0207679_10009290 3300025945 Bacteria 6291
194 Ga0207679_10013380 3300025945 Bacteria 5378
195 Ga0207679_10055933 3300025945 Unclassified 2911
196 Ga0207679_10089209 3300025945 Bacteria 2380
197 Ga0207651_10021060 3300025960 Bacteria 3952
198 Ga0207651_10027749 3300025960 Bacteria 3561
199 Ga0207651_10140047 3300025960 Unclassified 1867
200 Ga0207651_10331534 3300025960 Bacteria 1275
201 Ga0207651_10564714 3300025960 Bacteria 991
202 Ga0207640_10082527 3300025981 Bacteria 2201
203 Ga0207658_10112680 3300025986 Bacteria 2153
204 Ga0207658_10284085 3300025986 Bacteria 1420
205 Ga0207677_10043975 3300026023 Bacteria 2972
206 Ga0207677_10087895 3300026023 Unclassified 2252
207 Ga0207703_10039670 3300026035 Bacteria 3764
208 Ga0207703_10130785 3300026035 Bacteria 2167
209 Ga0207708_10003853 3300026075 Bacteria 11047
210 Ga0207641_10006889 3300026088 Bacteria 9510
211 Ga0207641_10046473 3300026088 Bacteria 3660
212 Ga0207641_10162782 3300026088 Unclassified 2030
213 Ga0207648_10006942 3300026089 Bacteria 11213
214 Ga0207676_10152371 3300026095 Bacteria 1993
215 Ga0207676_10156394 3300026095 Bacteria 1970
216 Ga0207676_10190877 3300026095 Bacteria 1802
217 Ga0207676_10374260 3300026095 Unclassified 1324
218 Ga0207674_10090156 3300026116 Bacteria 3058
219 Ga0207675_100028309 3300026118 Bacteria 5217
220 Ga0207675_100043271 3300026118 Bacteria 4206
221 Ga0207683_10032360 3300026121 Bacteria 4543
222 Ga0207683_10115344 3300026121 Bacteria 2408
223 Ga0207683_10395950 3300026121 Bacteria 1270
224 Ga0207428_10069293 3300027907 Unclassified 2774
225 Ga0268266_10167492 3300028379 Bacteria 1992
226 Ga0268265_10086166 3300028380 Bacteria 2496
227 Ga0268265_10419022 3300028380 Bacteria 1243
228 Ga0268264_10029494 3300028381 Bacteria 4494
229 Ga0268264_10052430 3300028381 Bacteria 3401
230 Ga0307408_100385729 3300031548 Bacteria 1199
231 Ga0307405_10098313 3300031731 Unclassified 1956
232 Ga0307407_10001342 3300031903 Bacteria 8833
233 Ga0307414_10133551 3300032004 Unclassified 1931
234 Ga0307415_100170908 3300032126 Unclassified 1695
235 Ga0373953_0055063 3300035117 Unclassified 1614
236 Ga0373957_0018023 3300035120 Unclassified 2468
237 Ga0373955_0116610 3300035172 Bacteria 1548
238 Ga0373931_0063875 3300035691 Bacteria 1991
239 Ga0373937_0018300 3300036401 Bacteria 6254
240 Ga0495629_0109974 3300046459 Unclassified 1921
241 Ga0495580_0134107 3300046472 Unclassified 1717
242 Ga0495580_0215390 3300046472 Bacteria 1321
243 Ga0495582_0121870 3300046473 Unclassified 1470
244 Ga0495664_0085419 3300046477 Bacteria 1895
245 Ga0495594_0009117 3300046499 Bacteria 5123
246 Ga0495594_0097551 3300046499 Bacteria 1652
247 Ga0495608_0075519 3300046511 Unclassified 2196
248 Ga0495618_0134400 3300046514 Unclassified 1582
249 Ga0495628_0101543 3300046516 Unclassified 2220
250 Ga0495652_0279111 3300046529 Unclassified 1224
251 Ga0495640_0124683 3300046533 Unclassified 1671
252 Ga0495667_0007082 3300046559 Bacteria 7606
253 Ga0495634_0038234 3300046642 Bacteria 3273
254 Ga0495634_0223515 3300046642 Bacteria 1161
255 Ga0495635_0149094 3300046663 Bacteria 1592
256 Ga0495657_0002546 3300046675 Bacteria 15293
257 Ga0495658_0066186 3300046683 Bacteria 2087
258 Ga0495684_0335979 3300047471 Unclassified 1076
259 Ga0501038_0090710 3300049574 Unclassified 2561
260 Ga0501039_0150233 3300049575 Bacteria 1830
261 Ga0501040_0261301 3300049576 Bacteria 1235
262 Ga0501042_0009757 3300049578 Bacteria 6414
263 Ga0501042_0260833 3300049578 Bacteria 1251
264 Ga0501046_0049798 3300049580 Bacteria 3313
265 Ga0501071_0012464 3300049587 Bacteria 5767
266 Ga0501071_0171372 3300049587 Bacteria 1625
267 Ga0501072_0024724 3300049588 Bacteria 4675
268 Ga0501075_0014018 3300049591 Bacteria 5738
269 Ga0501075_0140927 3300049591 Bacteria 1837
270 Ga0501076_0059679 3300049592 Bacteria 3034
271 Ga0501076_0096082 3300049592 Bacteria 2386
272 Ga0501077_0061824 3300049593 Bacteria 2377
273 Ga0501249_044119 3300049679 Bacteria 1015
274 Ga0501079_0116414 3300049741 Bacteria 2077
275 Ga0501081_0018588 3300049743 Bacteria 4618
276 Ga0501083_0152889 3300049744 Bacteria 1511
277 nmdc:mga03683_6327_c1 3300050489 Unclassified 4049
278 nmdc:mga0k408_40270_c1 3300050493 Unclassified 2687
279 nmdc:mga0k408_70261_c1 3300050493 Unclassified 2044
280 nmdc:mga06z11_121988_c1 3300050494 Unclassified 1455
281 nmdc:mga06z11_4079_c1 3300050494 Bacteria 5711
282 nmdc:mga05p37_29346_c1 3300050507 Bacteria 6712
283 nmdc:mga05p37_408265_c1 3300050507 Bacteria 1584
284 nmdc:mga05p37_589387_c1 3300050507 Unclassified 1257
285 nmdc:mga09592_102308_c1 3300050508 Bacteria 2454
286 nmdc:mga06r32_20397_c1 3300050510 Bacteria 6102
287 nmdc:mga0n895_25351_c1 3300050512 Bacteria 5601
288 nmdc:mga0a205_19455_c1 3300050515 Bacteria 6401
289 nmdc:mga0a205_212702_c1 3300050515 Unclassified 1821
290 Ga0495619_0393748 3300053085 Unclassified 957
291 Ga0501084_0126548 3300054114 Bacteria 2150
292 Ga0530510_0278644 3300061734 Bacteria 1249
293 Ga0070689_100153017
294 Ga0065712_10188514
295 Ga0070676_10015436
296 Ga0070690_100005315
297 Ga0070690_100032361
298 Ga0070690_100115832
299 Ga0070670_100019729
300 Ga0070670_100070301
301 Ga0070670_100082899
302 Ga0070670_100158383
303 Ga0068869_100107018
304 Ga0070666_10108857
305 Ga0070666_10142292
306 Ga0070666_10150992
307 Ga0070666_10158652
308 Ga0068868_100044831
309 Ga0068868_100160545
310 Ga0070687_100010190
311 Ga0070687_100235019
312 Ga0070687_100294118
313 Ga0070661_100035352
314 Ga0070661_100075919
315 Ga0070669_100016823
316 Ga0070669_100139747
317 Ga0070669_100233450
318 Ga0070675_100020186
319 Ga0070675_100057764
320 Ga0070675_100062847
321 Ga0070675_100092110
322 Ga0070675_100333369
323 Ga0070671_100041534
324 Ga0070671_100059490
325 Ga0070674_100144535
326 Ga0070673_100028907
327 Ga0070673_100032683
328 Ga0070673_100078431
329 Ga0070673_100122577
330 Ga0070688_100053239
331 Ga0070688_100364420
332 Ga0070667_100012461
333 Ga0070667_100216754
334 Ga0070701_10058405
335 Ga0070700_100030511
336 Ga0070678_100068336
337 Ga0070678_100135974
338 Ga0068867_100005600
339 Ga0070685_10040158
340 Ga0070685_10205595
341 Ga0070699_100004746
342 Ga0070699_100381514
343 Ga0070684_100053145
344 Ga0070684_100094475
345 Ga0070672_100003582
346 Ga0070672_100129422
347 Ga0070672_100235320
348 Ga0070672_100552710
349 Ga0070686_100010991
350 Ga0070696_100228212
351 Ga0070664_100004138
352 Ga0070664_100007832
353 Ga0070664_100022853
354 Ga0070664_100070394
355 Ga0070664_100138187
356 Ga0068854_100089231
357 Ga0068859_100033104
358 Ga0068859_100094645
359 Ga0068859_100370387
360 Ga0068864_100008394
361 Ga0068864_100023448
362 Ga0068864_100055209
363 Ga0068864_100160595
364 Ga0068864_100201417
365 Ga0068866_10135674
366 Ga0068861_100213429
367 Ga0068861_100217154
368 Ga0068861_100280446
369 Ga0068851_10107515
370 Ga0068863_100041948
371 Ga0068863_100042238
372 Ga0068863_100051204
373 Ga0068863_100112140
374 Ga0068858_100102358
375 Ga0068858_100164563
376 Ga0068858_100248705
377 Ga0068860_100014236
378 Ga0068860_100057488
379 Ga0068862_100124729
380 Ga0068862_100666607
381 Ga0081539_10000065
382 Ga0081539_10000644
383 Ga0075364_10019960
384 Ga0075362_10000516
385 Ga0075367_10040215
386 Ga0075367_10170779
387 Ga0075427_10011678
388 Ga0075366_10001781
389 Ga0097621_100019723
390 Ga0097621_100041592
391 Ga0097621_100075912
392 Ga0097621_100139469
393 Ga0097621_100486541
394 Ga0097621_100491835
395 Ga0068871_100003278
396 Ga0068871_100006097
397 Ga0068871_100246411
398 Ga0075428_100364350
399 Ga0075428_100374344
400 Ga0075430_100021548
401 Ga0075431_100031108
402 Ga0075433_10018782
403 Ga0075434_100144367
404 Ga0068865_100038655
405 Ga0068865_100119271
406 Ga0097620_100033105
407 Ga0097620_100094644
408 Ga0097620_100370395
409 Ga0075435_100050622
410 Ga0075435_100257647
411 Ga0111539_10006628
412 Ga0111539_10263227
413 Ga0111539_10289681
414 Ga0105245_10026467
415 Ga0105247_10118648
416 Ga0114129_10058990
417 Ga0114129_10066456
418 Ga0114129_10281739
419 Ga0105242_10021525
420 Ga0105242_10074594
421 Ga0105242_10104770
422 Ga0105242_10242125
423 Ga0105248_10011732
424 Ga0105248_10022951
425 Ga0105238_10006341
426 Ga0105249_10460525
427 Ga0163162_10038892
428 Ga0163162_10086066
429 Ga0157375_10006153
430 Ga0157375_10009539
431 Ga0157375_10133201
432 Ga0157375_10197931
433 Ga0157375_10221707
434 Ga0163163_10079746
435 Ga0163163_10080326
436 Ga0163163_10093493
437 Ga0157380_10278402
438 Ga0157380_10283452
439 Ga0157380_10464529
440 Ga0157377_10042334
441 Ga0157379_10001821
442 Ga0157379_10106990
443 Ga0157376_10026164
444 Ga0157376_10076678
445 Ga0207680_10035034
446 Ga0207645_10019233
447 Ga0207643_10038558
448 Ga0207643_10287398
449 Ga0207662_10006085
450 Ga0207649_10034457
451 Ga0207649_10092087
452 Ga0207681_10115786
453 Ga0207681_10125916
454 Ga0207681_10236172
455 Ga0207681_10379607
456 Ga0207694_10034171
457 Ga0207650_10010824
458 Ga0207650_10040061
459 Ga0207650_10115039
460 Ga0207659_10022837
461 Ga0207659_10037009
462 Ga0207659_10070172
463 Ga0207659_10086382
464 Ga0207659_10417764
465 Ga0207687_10029776
466 Ga0207644_10004553
467 Ga0207644_10025835
468 Ga0207644_10039792
469 Ga0207644_10158999
470 Ga0207706_10314971
471 Ga0207686_10015134
472 Ga0207670_10039141
473 Ga0207669_10163177
474 Ga0207704_10152597
475 Ga0207691_10008888
476 Ga0207691_10032264
477 Ga0207691_10053569
478 Ga0207691_10205976
479 Ga0207711_10215610
480 Ga0207689_10000692
481 Ga0207689_10114413
482 Ga0207689_10315181
483 Ga0207661_10018277
484 Ga0207661_10255665
485 Ga0207679_10009290
486 Ga0207679_10013380
487 Ga0207679_10055933
488 Ga0207679_10089209
489 Ga0207651_10021060
490 Ga0207651_10027749
491 Ga0207651_10140047
492 Ga0207651_10331534
493 Ga0207651_10564714
494 Ga0207640_10082527
495 Ga0207658_10112680
496 Ga0207658_10284085
497 Ga0207677_10043975
498 Ga0207677_10087895
499 Ga0207703_10039670
500 Ga0207703_10130785
501 Ga0207708_10003853
502 Ga0207641_10006889
503 Ga0207641_10046473
504 Ga0207641_10162782
505 Ga0207648_10006942
506 Ga0207676_10152371
507 Ga0207676_10156394
508 Ga0207676_10190877
509 Ga0207676_10374260
510 Ga0207674_10090156
511 Ga0207675_100028309
512 Ga0207675_100043271
513 Ga0207683_10032360
514 Ga0207683_10115344
515 Ga0207683_10395950
516 Ga0207428_10069293
517 Ga0268266_10167492
518 Ga0268265_10086166
519 Ga0268265_10419022
520 Ga0268264_10029494
521 Ga0268264_10052430
522 Ga0307408_100385729
523 Ga0307405_10098313
524 Ga0307407_10001342
525 Ga0307414_10133551
526 Ga0307415_100170908
527 Ga0373953_0055063
528 Ga0373957_0018023
529 Ga0373955_0116610
530 Ga0373931_0063875
531 Ga0373937_0018300
532 Ga0495629_0109974
533 Ga0495580_0134107
534 Ga0495580_0215390
535 Ga0495582_0121870
536 Ga0495664_0085419
537 Ga0495594_0009117
538 Ga0495594_0097551
539 Ga0495608_0075519
540 Ga0495618_0134400
541 Ga0495628_0101543
542 Ga0495652_0279111
543 Ga0495640_0124683
544 Ga0495667_0007082
545 Ga0495634_0038234
546 Ga0495634_0223515
547 Ga0495635_0149094
548 Ga0495657_0002546
549 Ga0495658_0066186
550 Ga0495684_0335979
551 Ga0501038_0090710
552 Ga0501039_0150233
553 Ga0501040_0261301
554 Ga0501042_0009757
555 Ga0501042_0260833
556 Ga0501046_0049798
557 Ga0501071_0012464
558 Ga0501071_0171372
559 Ga0501072_0024724
560 Ga0501075_0014018
561 Ga0501075_0140927
562 Ga0501076_0059679
563 Ga0501076_0096082
564 Ga0501077_0061824
565 Ga0501249_044119
566 Ga0501079_0116414
567 Ga0501081_0018588
568 Ga0501083_0152889
569 nmdc:mga03683_6327_c1
570 nmdc:mga0k408_40270_c1
571 nmdc:mga0k408_70261_c1
572 nmdc:mga06z11_121988_c1
573 nmdc:mga06z11_4079_c1
574 nmdc:mga05p37_29346_c1
575 nmdc:mga05p37_408265_c1
576 nmdc:mga05p37_589387_c1
577 nmdc:mga09592_102308_c1
578 nmdc:mga06r32_20397_c1
579 nmdc:mga0n895_25351_c1
580 nmdc:mga0a205_19455_c1
581 nmdc:mga0a205_212702_c1
582 Ga0495619_0393748
583 Ga0501084_0126548
584 Ga0530510_0278644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

236

309

0.95

PF07883

Cupin_2

Cupin domain

90

162

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9063 213 297
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.9005 217 297
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8951 201 294
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8924 201 294
6l2e-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form 0.8908 201 294
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9398 201 296 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9142 212 294 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9107 201 296 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9045 67 145 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8985 52 153 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3M8H479-F1-model_v4 Cupin domain-containing protein 0.9771 68 145
AF-A0A5C4T126-F1-model_v4 Cupin domain-containing protein 0.9634 216 295
AF-R9IQE9-F1-model_v4 Cupin type-2 domain-containing protein 0.9619 68 145
AF-A0A5N9DRK3-F1-model_v4 Cupin domain-containing protein 0.9614 68 145 GO:0046872
AF-A0A1P8XA04-F1-model_v4 Cupin type-2 domain-containing protein 0.9544 68 145

Map