F390707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 151 | 290 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10084168|Ga0065712_100841682 |
| Length | 399 |
| Sequence | LVYSLQLPAWFAASYLRGQSCDLVVYATLFIKIRQSSYSNQAYRTSFIFAPAMYNAIRRILFLFPPESIHYFLMNSLKALCSIGLIRKLIAWYFSPNDNRLNTTELHLKFQNPVGLGAGFDKNAKWLRELDTLGFGFVEIGTVTPLPQKGNEKPRLFRLPKDSALINRMGFNNDGVQAVAERLKKWRSGSQSTSSNLIVGGNIGKNKVTSNEDAWKDYESCFKELHPYVDYFVVNVSSPNTPGLRELQEKESLRKILRHLQMINNGKARSKPILLKISPDLMQDQIDDILELALEIKLDGLVCTNTTVSRAGLLTRKDEIEKIGQGGLSGKPIRERSTLIIEYIHKKTEGEIPIIASGGIFTGAHAKEKLNVGADLVQVWTGFIYEGPAIVKKICNSLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 122 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 123 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 124 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 125 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 126 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 142 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 150 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 151 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0 |
| Isolates | 0.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 95.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10207189 | 3300003322 | Bacteria | 2384 |
| 2 | rootL2_10323352 | 3300003322 | Unclassified | 1407 |
| 3 | JGI25160J50197_1002259 | 3300003354 | Bacteria | 9039 |
| 4 | Ga0065712_10009488 | 3300005290 | Bacteria | 5714 |
| 5 | Ga0065712_10013640 | 3300005290 | Bacteria | 2179 |
| 6 | Ga0065712_10084168 | 3300005290 | Bacteria | 2785 |
| 7 | Ga0070658_10004224 | 3300005327 | Bacteria | 11752 |
| 8 | Ga0070658_10103962 | 3300005327 | Bacteria | 2349 |
| 9 | Ga0070658_10128969 | 3300005327 | Bacteria | 2106 |
| 10 | Ga0070690_100077291 | 3300005330 | Bacteria | 2173 |
| 11 | Ga0070670_100069658 | 3300005331 | Bacteria | 3019 |
| 12 | Ga0070670_100154309 | 3300005331 | Unclassified | 1988 |
| 13 | Ga0068869_100006366 | 3300005334 | Bacteria | 7482 |
| 14 | Ga0068869_100070696 | 3300005334 | Unclassified | 2583 |
| 15 | Ga0068869_100210033 | 3300005334 | Bacteria | 1538 |
| 16 | Ga0068869_100211401 | 3300005334 | Bacteria | 1534 |
| 17 | Ga0068869_100234447 | 3300005334 | Bacteria | 1460 |
| 18 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 19 | Ga0070666_10041522 | 3300005335 | Bacteria | 3074 |
| 20 | Ga0070682_100076138 | 3300005337 | Bacteria | 2159 |
| 21 | Ga0068868_100354232 | 3300005338 | Unclassified | 1258 |
| 22 | Ga0070689_100007593 | 3300005340 | Bacteria | 7597 |
| 23 | Ga0070689_100074788 | 3300005340 | Bacteria | 2651 |
| 24 | Ga0070689_100166052 | 3300005340 | Bacteria | 1787 |
| 25 | Ga0070687_100029695 | 3300005343 | Bacteria | 2665 |
| 26 | Ga0070668_100031706 | 3300005347 | Bacteria | 4021 |
| 27 | Ga0070669_100000278 | 3300005353 | Bacteria | 40980 |
| 28 | Ga0070669_100062427 | 3300005353 | Bacteria | 2739 |
| 29 | Ga0070669_100068981 | 3300005353 | Bacteria | 2611 |
| 30 | Ga0070675_100020880 | 3300005354 | Bacteria | 5228 |
| 31 | Ga0070675_100030862 | 3300005354 | Unclassified | 4329 |
| 32 | Ga0070675_100263534 | 3300005354 | Bacteria | 1511 |
| 33 | Ga0070671_100041634 | 3300005355 | Bacteria | 3818 |
| 34 | Ga0070671_100084858 | 3300005355 | Bacteria | 2649 |
| 35 | Ga0070671_100128877 | 3300005355 | Bacteria | 2130 |
| 36 | Ga0070674_100034216 | 3300005356 | Unclassified | 3391 |
| 37 | Ga0070674_100058871 | 3300005356 | Bacteria | 2672 |
| 38 | Ga0070674_100193453 | 3300005356 | Bacteria | 1566 |
| 39 | Ga0070674_100230102 | 3300005356 | Bacteria | 1446 |
| 40 | Ga0070673_100022753 | 3300005364 | Bacteria | 4567 |
| 41 | Ga0070673_100080691 | 3300005364 | Bacteria | 2637 |
| 42 | Ga0070688_100001544 | 3300005365 | Bacteria | 11513 |
| 43 | Ga0070688_100009106 | 3300005365 | Bacteria | 5415 |
| 44 | Ga0070688_100010539 | 3300005365 | Bacteria | 5102 |
| 45 | Ga0070688_100069208 | 3300005365 | Bacteria | 2253 |
| 46 | Ga0070667_100071590 | 3300005367 | Bacteria | 2953 |
| 47 | Ga0070667_100135561 | 3300005367 | Bacteria | 2152 |
| 48 | Ga0070701_10009719 | 3300005438 | Bacteria | 4221 |
| 49 | Ga0070701_10056191 | 3300005438 | Bacteria | 2058 |
| 50 | Ga0070701_10096669 | 3300005438 | Bacteria | 1628 |
| 51 | Ga0070694_100190622 | 3300005444 | Unclassified | 1522 |
| 52 | Ga0070663_100122854 | 3300005455 | Bacteria | 1963 |
| 53 | Ga0070678_100021265 | 3300005456 | Bacteria | 4275 |
| 54 | Ga0070678_100103905 | 3300005456 | Bacteria | 2208 |
| 55 | Ga0068867_100082780 | 3300005459 | Bacteria | 2422 |
| 56 | Ga0070685_10164890 | 3300005466 | Bacteria | 1415 |
| 57 | Ga0070698_100003794 | 3300005471 | Bacteria | 16603 |
| 58 | Ga0070698_100009599 | 3300005471 | Bacteria | 10353 |
| 59 | Ga0070679_100251778 | 3300005530 | Bacteria | 1722 |
| 60 | Ga0070684_100022349 | 3300005535 | Bacteria | 5275 |
| 61 | Ga0070672_100010286 | 3300005543 | Bacteria | 6483 |
| 62 | Ga0070672_100073084 | 3300005543 | Bacteria | 2732 |
| 63 | Ga0070672_100395859 | 3300005543 | Bacteria | 1183 |
| 64 | Ga0070686_100006502 | 3300005544 | Bacteria | 6500 |
| 65 | Ga0070693_100096276 | 3300005547 | Bacteria | 1794 |
| 66 | Ga0068855_100385088 | 3300005563 | Unclassified | 1539 |
| 67 | Ga0070664_100264096 | 3300005564 | Unclassified | 1549 |
| 68 | Ga0068857_100032716 | 3300005577 | Bacteria | 4596 |
| 69 | Ga0068857_100179144 | 3300005577 | Bacteria | 1929 |
| 70 | Ga0068856_100150396 | 3300005614 | Bacteria | 2337 |
| 71 | Ga0070702_100006614 | 3300005615 | Bacteria | 5501 |
| 72 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 73 | Ga0068859_100068123 | 3300005617 | Bacteria | 3594 |
| 74 | Ga0068859_100438850 | 3300005617 | Bacteria | 1402 |
| 75 | Ga0068859_100577867 | 3300005617 | Bacteria | 1217 |
| 76 | Ga0068864_100001153 | 3300005618 | Bacteria | 21991 |
| 77 | Ga0068864_100021416 | 3300005618 | Bacteria | 5417 |
| 78 | Ga0068864_100048426 | 3300005618 | Bacteria | 3654 |
| 79 | Ga0068864_100141213 | 3300005618 | Bacteria | 2173 |
| 80 | Ga0068861_100001238 | 3300005719 | Bacteria | 15917 |
| 81 | Ga0068861_100037888 | 3300005719 | Unclassified | 3586 |
| 82 | Ga0068863_100002071 | 3300005841 | Bacteria | 19895 |
| 83 | Ga0068863_100013093 | 3300005841 | Bacteria | 8002 |
| 84 | Ga0068863_100046686 | 3300005841 | Bacteria | 4111 |
| 85 | Ga0068863_100140396 | 3300005841 | Bacteria | 2309 |
| 86 | Ga0068858_100002469 | 3300005842 | Bacteria | 18659 |
| 87 | Ga0068858_100154280 | 3300005842 | Bacteria | 2160 |
| 88 | Ga0068860_100004776 | 3300005843 | Bacteria | 13806 |
| 89 | Ga0068860_100034632 | 3300005843 | Bacteria | 4845 |
| 90 | Ga0068860_100057657 | 3300005843 | Bacteria | 3692 |
| 91 | Ga0068860_100177243 | 3300005843 | Unclassified | 2060 |
| 92 | Ga0068860_100246354 | 3300005843 | Unclassified | 1739 |
| 93 | Ga0068862_100001103 | 3300005844 | Bacteria | 25640 |
| 94 | Ga0068862_100005077 | 3300005844 | Bacteria | 11082 |
| 95 | Ga0068862_100431878 | 3300005844 | Bacteria | 1238 |
| 96 | Ga0081539_10000603 | 3300005985 | Bacteria | 73114 |
| 97 | Ga0097621_100000427 | 3300006237 | Bacteria | 29385 |
| 98 | Ga0097621_100277314 | 3300006237 | Bacteria | 1475 |
| 99 | Ga0068871_100021716 | 3300006358 | Bacteria | 4939 |
| 100 | Ga0068871_100094457 | 3300006358 | Bacteria | 2496 |
| 101 | Ga0075428_100006377 | 3300006844 | Bacteria | 13128 |
| 102 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 103 | Ga0097620_100068123 | 3300006931 | Bacteria | 3594 |
| 104 | Ga0097620_100438848 | 3300006931 | Bacteria | 1402 |
| 105 | Ga0097620_100577837 | 3300006931 | Bacteria | 1217 |
| 106 | Ga0105240_10041526 | 3300009093 | Bacteria | 5870 |
| 107 | Ga0111539_10010247 | 3300009094 | Bacteria | 11811 |
| 108 | Ga0111539_10386031 | 3300009094 | Bacteria | 1631 |
| 109 | Ga0105247_10009880 | 3300009101 | Bacteria | 5780 |
| 110 | Ga0105243_10130709 | 3300009148 | Bacteria | 2129 |
| 111 | Ga0105241_10003471 | 3300009174 | Bacteria | 11732 |
| 112 | Ga0105242_10008177 | 3300009176 | Bacteria | 8036 |
| 113 | Ga0105242_10062448 | 3300009176 | Bacteria | 3065 |
| 114 | Ga0105242_10420056 | 3300009176 | Bacteria | 1253 |
| 115 | Ga0105237_10002015 | 3300009545 | Bacteria | 25851 |
| 116 | Ga0105237_10019825 | 3300009545 | Bacteria | 6943 |
| 117 | Ga0105249_10001437 | 3300009553 | Bacteria | 20858 |
| 118 | Ga0105249_10002907 | 3300009553 | Bacteria | 14779 |
| 119 | Ga0105249_10008926 | 3300009553 | Bacteria | 8757 |
| 120 | Ga0105249_10243414 | 3300009553 | Bacteria | 1779 |
| 121 | Ga0105246_10012782 | 3300011119 | Bacteria | 5248 |
| 122 | Ga0157373_10023446 | 3300013100 | Bacteria | 4474 |
| 123 | Ga0157373_10152431 | 3300013100 | Bacteria | 1626 |
| 124 | Ga0157371_10002769 | 3300013102 | Bacteria | 16467 |
| 125 | Ga0157371_10002845 | 3300013102 | Bacteria | 16172 |
| 126 | Ga0157371_10003497 | 3300013102 | Bacteria | 14205 |
| 127 | Ga0157371_10007582 | 3300013102 | Bacteria | 8757 |
| 128 | Ga0157371_10019924 | 3300013102 | Bacteria | 4942 |
| 129 | Ga0157370_10152402 | 3300013104 | Bacteria | 2151 |
| 130 | Ga0157369_10169118 | 3300013105 | Bacteria | 2304 |
| 131 | Ga0157374_10023123 | 3300013296 | Bacteria | 5554 |
| 132 | Ga0157374_10256518 | 3300013296 | Bacteria | 1721 |
| 133 | Ga0157378_10013101 | 3300013297 | Bacteria | 7254 |
| 134 | Ga0157378_10015472 | 3300013297 | Bacteria | 6683 |
| 135 | Ga0157378_10023395 | 3300013297 | Bacteria | 5438 |
| 136 | Ga0163162_10001051 | 3300013306 | Bacteria | 25638 |
| 137 | Ga0163162_10005140 | 3300013306 | Bacteria | 12610 |
| 138 | Ga0163162_10007331 | 3300013306 | Bacteria | 10716 |
| 139 | Ga0163162_10009023 | 3300013306 | Bacteria | 9693 |
| 140 | Ga0163162_10030461 | 3300013306 | Bacteria | 5346 |
| 141 | Ga0163162_10049730 | 3300013306 | Bacteria | 4202 |
| 142 | Ga0163162_10136423 | 3300013306 | Unclassified | 2564 |
| 143 | Ga0163162_10233485 | 3300013306 | Unclassified | 1970 |
| 144 | Ga0163162_10454899 | 3300013306 | Bacteria | 1412 |
| 145 | Ga0157372_10142607 | 3300013307 | Bacteria | 2762 |
| 146 | Ga0157372_10165695 | 3300013307 | Bacteria | 2555 |
| 147 | Ga0157372_10329681 | 3300013307 | Bacteria | 1777 |
| 148 | Ga0157375_10000186 | 3300013308 | Bacteria | 58217 |
| 149 | Ga0157375_10012039 | 3300013308 | Bacteria | 7660 |
| 150 | Ga0163163_10005424 | 3300014325 | Bacteria | 11026 |
| 151 | Ga0163163_10010386 | 3300014325 | Bacteria | 8368 |
| 152 | Ga0157380_10001581 | 3300014326 | Bacteria | 14991 |
| 153 | Ga0157380_10073239 | 3300014326 | Bacteria | 2776 |
| 154 | Ga0157380_10167778 | 3300014326 | Bacteria | 1915 |
| 155 | Ga0157380_10241362 | 3300014326 | Bacteria | 1629 |
| 156 | Ga0157377_10004609 | 3300014745 | Bacteria | 6372 |
| 157 | Ga0157377_10004780 | 3300014745 | Bacteria | 6278 |
| 158 | Ga0157376_10000101 | 3300014969 | Bacteria | 62612 |
| 159 | Ga0157376_10145571 | 3300014969 | Bacteria | 2131 |
| 160 | Ga0163161_10015238 | 3300017792 | Bacteria | 5356 |
| 161 | Ga0163161_10262427 | 3300017792 | Bacteria | 1349 |
| 162 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 163 | Ga0207710_10025651 | 3300025900 | Bacteria | 2544 |
| 164 | Ga0207688_10001577 | 3300025901 | Bacteria | 12027 |
| 165 | Ga0207680_10000627 | 3300025903 | Bacteria | 16642 |
| 166 | Ga0207645_10034704 | 3300025907 | Bacteria | 3241 |
| 167 | Ga0207643_10005651 | 3300025908 | Bacteria | 6687 |
| 168 | Ga0207643_10229095 | 3300025908 | Bacteria | 1139 |
| 169 | Ga0207705_10027556 | 3300025909 | Bacteria | 4052 |
| 170 | Ga0207705_10139299 | 3300025909 | Unclassified | 1811 |
| 171 | Ga0207654_10014865 | 3300025911 | Bacteria | 4030 |
| 172 | Ga0207671_10001627 | 3300025914 | Bacteria | 25569 |
| 173 | Ga0207660_10257288 | 3300025917 | Bacteria | 1379 |
| 174 | Ga0207681_10074594 | 3300025923 | Bacteria | 2377 |
| 175 | Ga0207659_10115581 | 3300025926 | Unclassified | 2047 |
| 176 | Ga0207644_10051816 | 3300025931 | Bacteria | 2947 |
| 177 | Ga0207644_10073121 | 3300025931 | Bacteria | 2513 |
| 178 | Ga0207644_10092484 | 3300025931 | Bacteria | 2256 |
| 179 | Ga0207706_10032868 | 3300025933 | Bacteria | 4616 |
| 180 | Ga0207686_10003456 | 3300025934 | Bacteria | 8481 |
| 181 | Ga0207686_10034775 | 3300025934 | Bacteria | 3018 |
| 182 | Ga0207670_10137610 | 3300025936 | Bacteria | 1797 |
| 183 | Ga0207669_10007677 | 3300025937 | Bacteria | 5011 |
| 184 | Ga0207669_10103681 | 3300025937 | Bacteria | 1887 |
| 185 | Ga0207704_10205542 | 3300025938 | Bacteria | 1445 |
| 186 | Ga0207691_10023587 | 3300025940 | Bacteria | 5793 |
| 187 | Ga0207689_10012717 | 3300025942 | Bacteria | 7190 |
| 188 | Ga0207689_10075725 | 3300025942 | Bacteria | 2766 |
| 189 | Ga0207689_10098000 | 3300025942 | Bacteria | 2408 |
| 190 | Ga0207689_10106344 | 3300025942 | Bacteria | 2305 |
| 191 | Ga0207689_10134084 | 3300025942 | Unclassified | 2039 |
| 192 | Ga0207689_10268468 | 3300025942 | Bacteria | 1412 |
| 193 | Ga0207661_10136474 | 3300025944 | Bacteria | 2107 |
| 194 | Ga0207679_10074721 | 3300025945 | Bacteria | 2569 |
| 195 | Ga0207679_10126035 | 3300025945 | Bacteria | 2046 |
| 196 | Ga0207651_10074314 | 3300025960 | Unclassified | 2420 |
| 197 | Ga0207651_10097800 | 3300025960 | Bacteria | 2168 |
| 198 | Ga0207712_10001513 | 3300025961 | Bacteria | 15777 |
| 199 | Ga0207712_10066842 | 3300025961 | Bacteria | 2571 |
| 200 | Ga0207712_10149184 | 3300025961 | Unclassified | 1804 |
| 201 | Ga0207712_10160416 | 3300025961 | Bacteria | 1747 |
| 202 | Ga0207712_10388999 | 3300025961 | Bacteria | 1169 |
| 203 | Ga0207658_10048653 | 3300025986 | Bacteria | 3110 |
| 204 | Ga0207658_10084997 | 3300025986 | Bacteria | 2436 |
| 205 | Ga0207677_10052739 | 3300026023 | Bacteria | 2765 |
| 206 | Ga0207703_10003137 | 3300026035 | Bacteria | 13955 |
| 207 | Ga0207703_10031832 | 3300026035 | Bacteria | 4173 |
| 208 | Ga0207702_10044225 | 3300026078 | Bacteria | 3743 |
| 209 | Ga0207641_10000146 | 3300026088 | Bacteria | 100666 |
| 210 | Ga0207641_10002920 | 3300026088 | Bacteria | 15480 |
| 211 | Ga0207641_10021557 | 3300026088 | Bacteria | 5295 |
| 212 | Ga0207641_10035848 | 3300026088 | Bacteria | 4137 |
| 213 | Ga0207641_10126825 | 3300026088 | Bacteria | 2286 |
| 214 | Ga0207648_10004806 | 3300026089 | Bacteria | 13786 |
| 215 | Ga0207648_10022529 | 3300026089 | Bacteria | 5653 |
| 216 | Ga0207648_10061650 | 3300026089 | Bacteria | 3270 |
| 217 | Ga0207648_10061825 | 3300026089 | Bacteria | 3265 |
| 218 | Ga0207676_10007680 | 3300026095 | Bacteria | 7660 |
| 219 | Ga0207676_10136738 | 3300026095 | Bacteria | 2092 |
| 220 | Ga0207674_10026711 | 3300026116 | Bacteria | 6125 |
| 221 | Ga0207675_100000224 | 3300026118 | Bacteria | 53231 |
| 222 | Ga0207675_100044562 | 3300026118 | Bacteria | 4146 |
| 223 | Ga0207675_100323730 | 3300026118 | Bacteria | 1505 |
| 224 | Ga0207683_10083653 | 3300026121 | Bacteria | 2836 |
| 225 | Ga0207683_10172390 | 3300026121 | Bacteria | 1960 |
| 226 | Ga0207428_10140170 | 3300027907 | Bacteria | 1846 |
| 227 | Ga0268265_10081655 | 3300028380 | Bacteria | 2553 |
| 228 | Ga0268264_10003376 | 3300028381 | Bacteria | 13787 |
| 229 | Ga0268264_10025339 | 3300028381 | Bacteria | 4846 |
| 230 | Ga0268264_10035319 | 3300028381 | Bacteria | 4115 |
| 231 | Ga0268264_10042403 | 3300028381 | Bacteria | 3767 |
| 232 | Ga0268264_10314232 | 3300028381 | Bacteria | 1479 |
| 233 | Ga0307517_10003459 | 3300028786 | Bacteria | 24556 |
| 234 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 235 | Ga0307508_10016381 | 3300031616 | Bacteria | 6748 |
| 236 | Ga0395899_0092819 | 3300037312 | Bacteria | 2185 |
| 237 | Ga0395899_0120615 | 3300037312 | Bacteria | 1878 |
| 238 | Ga0395900_0023783 | 3300037418 | Bacteria | 6269 |
| 239 | Ga0395898_0074297 | 3300037466 | Bacteria | 3283 |
| 240 | Ga0395905_0014814 | 3300037471 | Bacteria | 7434 |
| 241 | Ga0395905_0122157 | 3300037471 | Bacteria | 2448 |
| 242 | Ga0395905_0199702 | 3300037471 | Bacteria | 1875 |
| 243 | Ga0395901_0025750 | 3300038443 | Bacteria | 6039 |
| 244 | Ga0395901_0027407 | 3300038443 | Bacteria | 5854 |
| 245 | Ga0439465_0040601 | 3300041413 | Bacteria | 1504 |
| 246 | Ga0439441_003931 | 3300042001 | Bacteria | 2221 |
| 247 | Ga0439449_0013272 | 3300042007 | Bacteria | 3100 |
| 248 | Ga0450898_002965 | 3300042134 | Bacteria | 2399 |
| 249 | Ga0451577_0007735 | 3300042876 | Bacteria | 10535 |
| 250 | Ga0451577_0104980 | 3300042876 | Bacteria | 2525 |
| 251 | Ga0451577_0160430 | 3300042876 | Unclassified | 2025 |
| 252 | Ga0466972_0000021 | 3300044658 | Bacteria | 196266 |
| 253 | Ga0466970_0001306 | 3300044765 | Bacteria | 12070 |
| 254 | Ga0451576_0000673 | 3300045051 | Bacteria | 69699 |
| 255 | Ga0495580_0061210 | 3300046472 | Bacteria | 2644 |
| 256 | Ga0495668_0000242 | 3300046616 | Bacteria | 78022 |
| 257 | Ga0495686_0010137 | 3300047472 | Bacteria | 6724 |
| 258 | Ga0496104_0101266 | 3300048907 | Bacteria | 2758 |
| 259 | Ga0496110_0380508 | 3300048913 | Bacteria | 1286 |
| 260 | Ga0501031_0005917 | 3300049568 | Bacteria | 7974 |
| 261 | Ga0501032_0187054 | 3300049569 | Bacteria | 1354 |
| 262 | Ga0501033_0052610 | 3300049570 | Bacteria | 3018 |
| 263 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 264 | Ga0501034_0029668 | 3300049571 | Bacteria | 5561 |
| 265 | Ga0501034_0046422 | 3300049571 | Bacteria | 4390 |
| 266 | Ga0501034_0049307 | 3300049571 | Unclassified | 4249 |
| 267 | Ga0501034_0055687 | 3300049571 | Bacteria | 3979 |
| 268 | Ga0501034_0199069 | 3300049571 | Bacteria | 1962 |
| 269 | Ga0501036_0055758 | 3300049572 | Bacteria | 3348 |
| 270 | Ga0501037_0014409 | 3300049573 | Bacteria | 5820 |
| 271 | Ga0501037_0124803 | 3300049573 | Bacteria | 1849 |
| 272 | Ga0501038_0006563 | 3300049574 | Bacteria | 10762 |
| 273 | Ga0501038_0315362 | 3300049574 | Bacteria | 1224 |
| 274 | Ga0501047_0017081 | 3300049581 | Bacteria | 6940 |
| 275 | Ga0501047_0110478 | 3300049581 | Bacteria | 2632 |
| 276 | Ga0501259_004214 | 3300049688 | Bacteria | 2288 |
| 277 | Ga0501080_0191905 | 3300049742 | Bacteria | 1877 |
| 278 | Ga0501083_0039404 | 3300049744 | Bacteria | 3210 |
| 279 | Ga0501035_0091761 | 3300049822 | Bacteria | 2673 |
| 280 | Ga0501035_0242293 | 3300049822 | Bacteria | 1533 |
| 281 | Ga0501044_0036967 | 3300049823 | Bacteria | 5105 |
| 282 | Ga0501044_0080670 | 3300049823 | Unclassified | 3295 |
| 283 | nmdc:mga05p37_88318_c1 | 3300050507 | Bacteria | 3821 |
| 284 | nmdc:mga06r32_184296_c1 | 3300050510 | Bacteria | 2074 |
| 285 | nmdc:mga08y16_110142_c1 | 3300050511 | Bacteria | 2867 |
| 286 | nmdc:mga08y16_68912_c1 | 3300050511 | Bacteria | 3688 |
| 287 | nmdc:mga08y16_95417_c1 | 3300050511 | Bacteria | 3098 |
| 288 | Ga0500568_0001221 | 3300053139 | Bacteria | 17154 |
| 289 | Ga0500588_0001821 | 3300053146 | Bacteria | 4161 |
| 290 | Ga0500616_0043554 | 3300053153 | Bacteria | 2398 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0007735 | Ga0451577_0007735_2629_3501 | 259 |
| 2 | 3300049571 | Ga0501034_0029668 | Ga0501034_0029668_4595_5497 | 268 |
| 3 | 3300014969 | Ga0157376_10000101 | Ga0157376_1000010137 | 281 |
| 4 | 3300025942 | Ga0207689_10098000 | Ga0207689_100980002 | 284 |
| 5 | 3300013297 | Ga0157378_10013101 | Ga0157378_100131013 | 285 |
| 6 | 3300014969 | Ga0157376_10145571 | Ga0157376_101455713 | 285 |
| 7 | 3300013306 | Ga0163162_10007331 | Ga0163162_100073312 | 286 |
| 8 | 3300042007 | Ga0439449_0013272 | Ga0439449_0013272_1601_2578 | 286 |
| 9 | 3300042134 | Ga0450898_002965 | Ga0450898_002965_276_1250 | 286 |
| 10 | 3300005617 | Ga0068859_100577867 | Ga0068859_1005778672 | 288 |
| 11 | 3300006931 | Ga0097620_100577837 | Ga0097620_1005778372 | 288 |
| 12 | 3300009553 | Ga0105249_10243414 | Ga0105249_102434142 | 288 |
| 13 | 3300013306 | Ga0163162_10233485 | Ga0163162_102334853 | 289 |
| 14 | 3300053146 | Ga0500588_0001821 | Ga0500588_0001821_343_1416 | 289 |
| 15 | 3300013100 | Ga0157373_10152431 | Ga0157373_101524312 | 290 |
| 16 | 3300013102 | Ga0157371_10019924 | Ga0157371_100199243 | 291 |
| 17 | 3300014326 | Ga0157380_10241362 | Ga0157380_102413621 | 291 |
| 18 | 3300050510 | nmdc:mga06r32_184296_c1 | nmdc:mga06r32_184296_c1_21_1028 | 292 |
| 19 | 3300009094 | Ga0111539_10010247 | Ga0111539_100102477 | 293 |
| 20 | 3300009101 | Ga0105247_10009880 | Ga0105247_100098803 | 293 |
| 21 | 3300009148 | Ga0105243_10130709 | Ga0105243_101307093 | 293 |
| 22 | 3300009174 | Ga0105241_10003471 | Ga0105241_100034715 | 293 |
| 23 | 3300009545 | Ga0105237_10002015 | Ga0105237_1000201510 | 293 |
| 24 | 3300009553 | Ga0105249_10001437 | Ga0105249_1000143712 | 293 |
| 25 | 3300009553 | Ga0105249_10002907 | Ga0105249_100029078 | 293 |
| 26 | 3300011119 | Ga0105246_10012782 | Ga0105246_100127828 | 293 |
| 27 | 3300013306 | Ga0163162_10005140 | Ga0163162_100051403 | 293 |
| 28 | 3300013308 | Ga0157375_10012039 | Ga0157375_100120395 | 293 |
| 29 | 3300014325 | Ga0163163_10010386 | Ga0163163_100103862 | 293 |
| 30 | 3300014326 | Ga0157380_10001581 | Ga0157380_100015817 | 293 |
| 31 | 3300014745 | Ga0157377_10004780 | Ga0157377_100047802 | 293 |
| 32 | 3300042001 | Ga0439441_003931 | Ga0439441_003931_472_1485 | 293 |
| 33 | 3300050511 | nmdc:mga08y16_95417_c1 | nmdc:mga08y16_95417_c1_1966_2946 | 293 |
| 34 | 3300047472 | Ga0495686_0010137 | Ga0495686_0010137_349_1335 | 294 |
| 35 | 3300005843 | Ga0068860_100034632 | Ga0068860_1000346322 | 295 |
| 36 | 3300013306 | Ga0163162_10001051 | Ga0163162_1000105124 | 295 |
| 37 | 3300028381 | Ga0268264_10025339 | Ga0268264_100253392 | 295 |
| 38 | 3300049573 | Ga0501037_0124803 | Ga0501037_0124803_835_1821 | 295 |
| 39 | 3300049574 | Ga0501038_0315362 | Ga0501038_0315362_47_1030 | 295 |
| 40 | 3300046472 | Ga0495580_0061210 | Ga0495580_0061210_80_1093 | 297 |
| 41 | 3300005543 | Ga0070672_100395859 | Ga0070672_1003958591 | 301 |
| 42 | 3300005327 | Ga0070658_10004224 | Ga0070658_1000422411 | 302 |
| 43 | 3300005563 | Ga0068855_100385088 | Ga0068855_1003850882 | 302 |
| 44 | 3300005614 | Ga0068856_100150396 | Ga0068856_1001503962 | 302 |
| 45 | 3300025909 | Ga0207705_10139299 | Ga0207705_101392992 | 302 |
| 46 | 3300026078 | Ga0207702_10044225 | Ga0207702_100442252 | 302 |
| 47 | 3300046616 | Ga0495668_0000242 | Ga0495668_0000242_28216_29295 | 305 |
| 48 | 3300005340 | Ga0070689_100074788 | Ga0070689_1000747883 | 306 |
| 49 | 3300005353 | Ga0070669_100068981 | Ga0070669_1000689812 | 306 |
| 50 | 3300005354 | Ga0070675_100263534 | Ga0070675_1002635341 | 306 |
| 51 | 3300005355 | Ga0070671_100128877 | Ga0070671_1001288771 | 306 |
| 52 | 3300005364 | Ga0070673_100022753 | Ga0070673_1000227533 | 306 |
| 53 | 3300005438 | Ga0070701_10096669 | Ga0070701_100966692 | 306 |
| 54 | 3300005544 | Ga0070686_100006502 | Ga0070686_1000065023 | 306 |
| 55 | 3300005564 | Ga0070664_100264096 | Ga0070664_1002640962 | 306 |
| 56 | 3300005615 | Ga0070702_100006614 | Ga0070702_1000066142 | 306 |
| 57 | 3300005617 | Ga0068859_100438850 | Ga0068859_1004388501 | 306 |
| 58 | 3300006358 | Ga0068871_100094457 | Ga0068871_1000944572 | 306 |
| 59 | 3300006931 | Ga0097620_100438848 | Ga0097620_1004388481 | 306 |
| 60 | 3300009176 | Ga0105242_10420056 | Ga0105242_104200561 | 306 |
| 61 | 3300013296 | Ga0157374_10256518 | Ga0157374_102565182 | 306 |
| 62 | 3300014745 | Ga0157377_10004609 | Ga0157377_100046091 | 306 |
| 63 | 3300017792 | Ga0163161_10262427 | Ga0163161_102624272 | 306 |
| 64 | 3300025901 | Ga0207688_10001577 | Ga0207688_100015776 | 306 |
| 65 | 3300025908 | Ga0207643_10229095 | Ga0207643_102290951 | 306 |
| 66 | 3300025931 | Ga0207644_10092484 | Ga0207644_100924842 | 306 |
| 67 | 3300025937 | Ga0207669_10103681 | Ga0207669_101036811 | 306 |
| 68 | 3300025940 | Ga0207691_10023587 | Ga0207691_100235873 | 306 |
| 69 | 3300025945 | Ga0207679_10074721 | Ga0207679_100747212 | 306 |
| 70 | 3300026023 | Ga0207677_10052739 | Ga0207677_100527392 | 306 |
| 71 | 3300005290 | Ga0065712_10013640 | Ga0065712_100136402 | 307 |
| 72 | 3300005330 | Ga0070690_100077291 | Ga0070690_1000772912 | 307 |
| 73 | 3300005334 | Ga0068869_100211401 | Ga0068869_1002114012 | 307 |
| 74 | 3300005364 | Ga0070673_100080691 | Ga0070673_1000806911 | 307 |
| 75 | 3300005365 | Ga0070688_100010539 | Ga0070688_1000105392 | 307 |
| 76 | 3300005367 | Ga0070667_100071590 | Ga0070667_1000715902 | 307 |
| 77 | 3300005459 | Ga0068867_100082780 | Ga0068867_1000827802 | 307 |
| 78 | 3300005535 | Ga0070684_100022349 | Ga0070684_1000223493 | 307 |
| 79 | 3300005617 | Ga0068859_100068123 | Ga0068859_1000681234 | 307 |
| 80 | 3300005618 | Ga0068864_100048426 | Ga0068864_1000484262 | 307 |
| 81 | 3300005841 | Ga0068863_100140396 | Ga0068863_1001403962 | 307 |
| 82 | 3300006931 | Ga0097620_100068123 | Ga0097620_1000681234 | 307 |
| 83 | 3300025942 | Ga0207689_10268468 | Ga0207689_102684681 | 307 |
| 84 | 3300025944 | Ga0207661_10136474 | Ga0207661_101364742 | 307 |
| 85 | 3300025945 | Ga0207679_10126035 | Ga0207679_101260352 | 307 |
| 86 | 3300025986 | Ga0207658_10084997 | Ga0207658_100849972 | 307 |
| 87 | 3300026088 | Ga0207641_10126825 | Ga0207641_101268252 | 307 |
| 88 | 3300031616 | Ga0307508_10016381 | Ga0307508_100163814 | 307 |
| 89 | 3300048907 | Ga0496104_0101266 | Ga0496104_0101266_758_1831 | 307 |
| 90 | 3300048913 | Ga0496110_0380508 | Ga0496110_0380508_67_1140 | 307 |
| 91 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_22680_23723 | 307 |
| 92 | 3300005365 | Ga0070688_100009106 | Ga0070688_1000091062 | 309 |
| 93 | 3300005438 | Ga0070701_10056191 | Ga0070701_100561911 | 309 |
| 94 | 3300005543 | Ga0070672_100073084 | Ga0070672_1000730842 | 309 |
| 95 | 3300013306 | Ga0163162_10049730 | Ga0163162_100497303 | 309 |
| 96 | 3300013306 | Ga0163162_10454899 | Ga0163162_104548992 | 309 |
| 97 | 3300025908 | Ga0207643_10005651 | Ga0207643_100056511 | 309 |
| 98 | 3300025934 | Ga0207686_10034775 | Ga0207686_100347752 | 309 |
| 99 | 3300025960 | Ga0207651_10097800 | Ga0207651_100978001 | 309 |
| 100 | 3300005327 | Ga0070658_10103962 | Ga0070658_101039622 | 310 |
| 101 | 3300005337 | Ga0070682_100076138 | Ga0070682_1000761384 | 310 |
| 102 | 3300005356 | Ga0070674_100034216 | Ga0070674_1000342162 | 310 |
| 103 | 3300005530 | Ga0070679_100251778 | Ga0070679_1002517782 | 310 |
| 104 | 3300013100 | Ga0157373_10023446 | Ga0157373_100234464 | 310 |
| 105 | 3300013102 | Ga0157371_10003497 | Ga0157371_1000349710 | 310 |
| 106 | 3300013105 | Ga0157369_10169118 | Ga0157369_101691181 | 310 |
| 107 | 3300014326 | Ga0157380_10167778 | Ga0157380_101677782 | 310 |
| 108 | 3300025909 | Ga0207705_10027556 | Ga0207705_100275564 | 310 |
| 109 | 3300025937 | Ga0207669_10007677 | Ga0207669_100076772 | 310 |
| 110 | 3300037312 | Ga0395899_0092819 | Ga0395899_0092819_853_1878 | 310 |
| 111 | 3300037312 | Ga0395899_0120615 | Ga0395899_0120615_418_1443 | 310 |
| 112 | 3300037418 | Ga0395900_0023783 | Ga0395900_0023783_13_1038 | 310 |
| 113 | 3300037466 | Ga0395898_0074297 | Ga0395898_0074297_2246_3271 | 310 |
| 114 | 3300037471 | Ga0395905_0014814 | Ga0395905_0014814_87_1112 | 310 |
| 115 | 3300037471 | Ga0395905_0199702 | Ga0395905_0199702_671_1696 | 310 |
| 116 | 3300038443 | Ga0395901_0025750 | Ga0395901_0025750_3929_4954 | 310 |
| 117 | 3300038443 | Ga0395901_0027407 | Ga0395901_0027407_3850_4875 | 310 |
| 118 | 3300041413 | Ga0439465_0040601 | Ga0439465_0040601_27_1082 | 310 |
| 119 | 3300050511 | nmdc:mga08y16_68912_c1 | nmdc:mga08y16_68912_c1_573_1613 | 310 |
| 120 | 3300005327 | Ga0070658_10128969 | Ga0070658_101289692 | 311 |
| 121 | 3300005618 | Ga0068864_100141213 | Ga0068864_1001412132 | 311 |
| 122 | 3300009176 | Ga0105242_10008177 | Ga0105242_100081774 | 311 |
| 123 | 3300013102 | Ga0157371_10002845 | Ga0157371_1000284510 | 311 |
| 124 | 3300014326 | Ga0157380_10073239 | Ga0157380_100732393 | 311 |
| 125 | 3300025917 | Ga0207660_10257288 | Ga0207660_102572882 | 311 |
| 126 | 3300025934 | Ga0207686_10003456 | Ga0207686_100034565 | 311 |
| 127 | 3300026088 | Ga0207641_10021557 | Ga0207641_100215572 | 311 |
| 128 | 3300028786 | Ga0307517_10003459 | Ga0307517_1000345911 | 311 |
| 129 | 3300042876 | Ga0451577_0160430 | Ga0451577_0160430_473_1507 | 311 |
| 130 | 3300005290 | Ga0065712_10009488 | Ga0065712_100094882 | 312 |
| 131 | 3300005334 | Ga0068869_100210033 | Ga0068869_1002100332 | 312 |
| 132 | 3300005334 | Ga0068869_100234447 | Ga0068869_1002344472 | 312 |
| 133 | 3300005340 | Ga0070689_100166052 | Ga0070689_1001660522 | 312 |
| 134 | 3300005365 | Ga0070688_100069208 | Ga0070688_1000692082 | 312 |
| 135 | 3300005466 | Ga0070685_10164890 | Ga0070685_101648901 | 312 |
| 136 | 3300005618 | Ga0068864_100021416 | Ga0068864_1000214165 | 312 |
| 137 | 3300005841 | Ga0068863_100013093 | Ga0068863_1000130938 | 312 |
| 138 | 3300005843 | Ga0068860_100246354 | Ga0068860_1002463541 | 312 |
| 139 | 3300005844 | Ga0068862_100005077 | Ga0068862_10000507711 | 312 |
| 140 | 3300009094 | Ga0111539_10386031 | Ga0111539_103860312 | 312 |
| 141 | 3300013102 | Ga0157371_10002769 | Ga0157371_100027696 | 312 |
| 142 | 3300013102 | Ga0157371_10007582 | Ga0157371_100075822 | 312 |
| 143 | 3300013104 | Ga0157370_10152402 | Ga0157370_101524022 | 312 |
| 144 | 3300013307 | Ga0157372_10329681 | Ga0157372_103296812 | 312 |
| 145 | 3300025936 | Ga0207670_10137610 | Ga0207670_101376102 | 312 |
| 146 | 3300025942 | Ga0207689_10134084 | Ga0207689_101340842 | 312 |
| 147 | 3300025961 | Ga0207712_10066842 | Ga0207712_100668422 | 312 |
| 148 | 3300026088 | Ga0207641_10002920 | Ga0207641_100029202 | 312 |
| 149 | 3300026089 | Ga0207648_10061650 | Ga0207648_100616502 | 312 |
| 150 | 3300026089 | Ga0207648_10061825 | Ga0207648_100618253 | 312 |
| 151 | 3300026095 | Ga0207676_10136738 | Ga0207676_101367382 | 312 |
| 152 | 3300026118 | Ga0207675_100323730 | Ga0207675_1003237302 | 312 |
| 153 | 3300027907 | Ga0207428_10140170 | Ga0207428_101401702 | 312 |
| 154 | 3300028380 | Ga0268265_10081655 | Ga0268265_100816552 | 312 |
| 155 | 3300028381 | Ga0268264_10035319 | Ga0268264_100353193 | 312 |
| 156 | 3300037471 | Ga0395905_0122157 | Ga0395905_0122157_1158_2258 | 312 |
| 157 | 3300049568 | Ga0501031_0005917 | Ga0501031_0005917_776_1825 | 312 |
| 158 | 3300049571 | Ga0501034_0199069 | Ga0501034_0199069_768_1799 | 312 |
| 159 | 3300049572 | Ga0501036_0055758 | Ga0501036_0055758_105_1154 | 312 |
| 160 | 3300049573 | Ga0501037_0014409 | Ga0501037_0014409_3572_4621 | 312 |
| 161 | 3300049574 | Ga0501038_0006563 | Ga0501038_0006563_6192_7241 | 312 |
| 162 | 3300049822 | Ga0501035_0091761 | Ga0501035_0091761_838_1887 | 312 |
| 163 | 3300049823 | Ga0501044_0080670 | Ga0501044_0080670_417_1466 | 312 |
| 164 | 3300050511 | nmdc:mga08y16_110142_c1 | nmdc:mga08y16_110142_c1_1372_2436 | 312 |
| 165 | 3300003322 | rootL2_10323352 | rootL2_103233521 | 313 |
| 166 | 3300003354 | JGI25160J50197_1002259 | JGI25160J50197_10022593 | 313 |
| 167 | 3300005334 | Ga0068869_100070696 | Ga0068869_1000706963 | 313 |
| 168 | 3300005338 | Ga0068868_100354232 | Ga0068868_1003542321 | 313 |
| 169 | 3300005347 | Ga0070668_100031706 | Ga0070668_1000317063 | 313 |
| 170 | 3300005719 | Ga0068861_100037888 | Ga0068861_1000378882 | 313 |
| 171 | 3300006844 | Ga0075428_100006377 | Ga0075428_1000063775 | 313 |
| 172 | 3300013307 | Ga0157372_10142607 | Ga0157372_101426072 | 313 |
| 173 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023173 | 313 |
| 174 | 3300025942 | Ga0207689_10012717 | Ga0207689_100127172 | 313 |
| 175 | 3300025942 | Ga0207689_10106344 | Ga0207689_101063443 | 313 |
| 176 | 3300025961 | Ga0207712_10388999 | Ga0207712_103889991 | 313 |
| 177 | 3300026118 | Ga0207675_100044562 | Ga0207675_1000445622 | 313 |
| 178 | 3300028381 | Ga0268264_10314232 | Ga0268264_103142322 | 313 |
| 179 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012164 | 313 |
| 180 | 3300050507 | nmdc:mga05p37_88318_c1 | nmdc:mga05p37_88318_c1_484_1554 | 313 |
| 181 | 3300053153 | Ga0500616_0043554 | Ga0500616_0043554_87_1178 | 313 |
| 182 | 3300005290 | Ga0065712_10084168 | Ga0065712_100841682 | 314 |
| 183 | 3300005331 | Ga0070670_100069658 | Ga0070670_1000696582 | 314 |
| 184 | 3300005334 | Ga0068869_100006366 | Ga0068869_1000063669 | 314 |
| 185 | 3300005335 | Ga0070666_10000031 | Ga0070666_1000003175 | 314 |
| 186 | 3300005340 | Ga0070689_100007593 | Ga0070689_1000075933 | 314 |
| 187 | 3300005343 | Ga0070687_100029695 | Ga0070687_1000296952 | 314 |
| 188 | 3300005353 | Ga0070669_100000278 | Ga0070669_10000027832 | 314 |
| 189 | 3300005353 | Ga0070669_100062427 | Ga0070669_1000624273 | 314 |
| 190 | 3300005354 | Ga0070675_100020880 | Ga0070675_1000208802 | 314 |
| 191 | 3300005355 | Ga0070671_100041634 | Ga0070671_1000416342 | 314 |
| 192 | 3300005355 | Ga0070671_100084858 | Ga0070671_1000848582 | 314 |
| 193 | 3300005356 | Ga0070674_100230102 | Ga0070674_1002301021 | 314 |
| 194 | 3300005365 | Ga0070688_100001544 | Ga0070688_1000015445 | 314 |
| 195 | 3300005438 | Ga0070701_10009719 | Ga0070701_100097193 | 314 |
| 196 | 3300005444 | Ga0070694_100190622 | Ga0070694_1001906221 | 314 |
| 197 | 3300005456 | Ga0070678_100021265 | Ga0070678_1000212652 | 314 |
| 198 | 3300005456 | Ga0070678_100103905 | Ga0070678_1001039052 | 314 |
| 199 | 3300005471 | Ga0070698_100009599 | Ga0070698_1000095994 | 314 |
| 200 | 3300005543 | Ga0070672_100010286 | Ga0070672_1000102862 | 314 |
| 201 | 3300005577 | Ga0068857_100032716 | Ga0068857_1000327164 | 314 |
| 202 | 3300005617 | Ga0068859_100000045 | Ga0068859_10000004561 | 314 |
| 203 | 3300005618 | Ga0068864_100001153 | Ga0068864_1000011538 | 314 |
| 204 | 3300005719 | Ga0068861_100001238 | Ga0068861_10000123817 | 314 |
| 205 | 3300005841 | Ga0068863_100002071 | Ga0068863_10000207110 | 314 |
| 206 | 3300005841 | Ga0068863_100046686 | Ga0068863_1000466864 | 314 |
| 207 | 3300005842 | Ga0068858_100002469 | Ga0068858_10000246913 | 314 |
| 208 | 3300005842 | Ga0068858_100154280 | Ga0068858_1001542802 | 314 |
| 209 | 3300005843 | Ga0068860_100004776 | Ga0068860_1000047763 | 314 |
| 210 | 3300005843 | Ga0068860_100177243 | Ga0068860_1001772432 | 314 |
| 211 | 3300005844 | Ga0068862_100001103 | Ga0068862_1000011038 | 314 |
| 212 | 3300006237 | Ga0097621_100000427 | Ga0097621_10000042724 | 314 |
| 213 | 3300006358 | Ga0068871_100021716 | Ga0068871_1000217162 | 314 |
| 214 | 3300006931 | Ga0097620_100000045 | Ga0097620_10000004580 | 314 |
| 215 | 3300009176 | Ga0105242_10062448 | Ga0105242_100624483 | 314 |
| 216 | 3300009553 | Ga0105249_10008926 | Ga0105249_100089265 | 314 |
| 217 | 3300013297 | Ga0157378_10015472 | Ga0157378_100154722 | 314 |
| 218 | 3300013306 | Ga0163162_10009023 | Ga0163162_100090235 | 314 |
| 219 | 3300013306 | Ga0163162_10136423 | Ga0163162_101364232 | 314 |
| 220 | 3300013307 | Ga0157372_10165695 | Ga0157372_101656952 | 314 |
| 221 | 3300013308 | Ga0157375_10000186 | Ga0157375_1000018634 | 314 |
| 222 | 3300014325 | Ga0163163_10005424 | Ga0163163_100054246 | 314 |
| 223 | 3300017792 | Ga0163161_10015238 | Ga0163161_100152385 | 314 |
| 224 | 3300025900 | Ga0207710_10025651 | Ga0207710_100256513 | 314 |
| 225 | 3300025903 | Ga0207680_10000627 | Ga0207680_1000062710 | 314 |
| 226 | 3300025911 | Ga0207654_10014865 | Ga0207654_100148653 | 314 |
| 227 | 3300025914 | Ga0207671_10001627 | Ga0207671_100016279 | 314 |
| 228 | 3300025923 | Ga0207681_10074594 | Ga0207681_100745942 | 314 |
| 229 | 3300025931 | Ga0207644_10051816 | Ga0207644_100518164 | 314 |
| 230 | 3300025931 | Ga0207644_10073121 | Ga0207644_100731213 | 314 |
| 231 | 3300025933 | Ga0207706_10032868 | Ga0207706_100328684 | 314 |
| 232 | 3300025938 | Ga0207704_10205542 | Ga0207704_102055422 | 314 |
| 233 | 3300025960 | Ga0207651_10074314 | Ga0207651_100743142 | 314 |
| 234 | 3300025961 | Ga0207712_10001513 | Ga0207712_100015133 | 314 |
| 235 | 3300025961 | Ga0207712_10160416 | Ga0207712_101604162 | 314 |
| 236 | 3300026035 | Ga0207703_10003137 | Ga0207703_100031374 | 314 |
| 237 | 3300026035 | Ga0207703_10031832 | Ga0207703_100318324 | 314 |
| 238 | 3300026088 | Ga0207641_10000146 | Ga0207641_1000014656 | 314 |
| 239 | 3300026088 | Ga0207641_10035848 | Ga0207641_100358484 | 314 |
| 240 | 3300026089 | Ga0207648_10022529 | Ga0207648_100225295 | 314 |
| 241 | 3300026095 | Ga0207676_10007680 | Ga0207676_100076804 | 314 |
| 242 | 3300026116 | Ga0207674_10026711 | Ga0207674_100267113 | 314 |
| 243 | 3300026118 | Ga0207675_100000224 | Ga0207675_10000022415 | 314 |
| 244 | 3300026121 | Ga0207683_10083653 | Ga0207683_100836534 | 314 |
| 245 | 3300026121 | Ga0207683_10172390 | Ga0207683_101723902 | 314 |
| 246 | 3300028381 | Ga0268264_10003376 | Ga0268264_1000337611 | 314 |
| 247 | 3300049688 | Ga0501259_004214 | Ga0501259_004214_625_1716 | 314 |
| 248 | iso_pu_bacteria | 2914759650 | 2914760575 | 314 |
| 249 | 3300005335 | Ga0070666_10041522 | Ga0070666_100415223 | 315 |
| 250 | 3300005471 | Ga0070698_100003794 | Ga0070698_1000037944 | 315 |
| 251 | 3300025961 | Ga0207712_10149184 | Ga0207712_101491842 | 315 |
| 252 | 3300025986 | Ga0207658_10048653 | Ga0207658_100486532 | 315 |
| 253 | 3300053139 | Ga0500568_0001221 | Ga0500568_0001221_2359_3438 | 315 |
| 254 | iso_pu_bacteria | 2818991444 | 2819585483 | 315 |
| 255 | 3300005455 | Ga0070663_100122854 | Ga0070663_1001228542 | 316 |
| 256 | 3300006237 | Ga0097621_100277314 | Ga0097621_1002773142 | 316 |
| 257 | 3300009093 | Ga0105240_10041526 | Ga0105240_100415264 | 316 |
| 258 | 3300009545 | Ga0105237_10019825 | Ga0105237_100198255 | 316 |
| 259 | 3300013296 | Ga0157374_10023123 | Ga0157374_100231235 | 316 |
| 260 | 3300042876 | Ga0451577_0104980 | Ga0451577_0104980_115_1182 | 316 |
| 261 | 3300044658 | Ga0466972_0000021 | Ga0466972_0000021_189881_190936 | 316 |
| 262 | 3300044765 | Ga0466970_0001306 | Ga0466970_0001306_10413_11468 | 316 |
| 263 | 3300049569 | Ga0501032_0187054 | Ga0501032_0187054_107_1153 | 316 |
| 264 | 3300049570 | Ga0501033_0052610 | Ga0501033_0052610_1159_2232 | 316 |
| 265 | 3300049571 | Ga0501034_0055687 | Ga0501034_0055687_1472_2521 | 316 |
| 266 | 3300049581 | Ga0501047_0110478 | Ga0501047_0110478_1236_2282 | 316 |
| 267 | 3300049742 | Ga0501080_0191905 | Ga0501080_0191905_684_1736 | 316 |
| 268 | 3300049744 | Ga0501083_0039404 | Ga0501083_0039404_1323_2405 | 316 |
| 269 | 3300049822 | Ga0501035_0242293 | Ga0501035_0242293_141_1187 | 316 |
| 270 | 3300049823 | Ga0501044_0036967 | Ga0501044_0036967_3940_5013 | 316 |
| 271 | 3300005367 | Ga0070667_100135561 | Ga0070667_1001355612 | 317 |
| 272 | 3300005843 | Ga0068860_100057657 | Ga0068860_1000576572 | 317 |
| 273 | 3300013297 | Ga0157378_10023395 | Ga0157378_100233952 | 317 |
| 274 | 3300028381 | Ga0268264_10042403 | Ga0268264_100424034 | 317 |
| 275 | 3300045051 | Ga0451576_0000673 | Ga0451576_0000673_23126_24226 | 317 |
| 276 | 3300005356 | Ga0070674_100058871 | Ga0070674_1000588712 | 318 |
| 277 | 3300005547 | Ga0070693_100096276 | Ga0070693_1000962761 | 318 |
| 278 | 3300005577 | Ga0068857_100179144 | Ga0068857_1001791442 | 318 |
| 279 | 3300005844 | Ga0068862_100431878 | Ga0068862_1004318781 | 318 |
| 280 | 3300025907 | Ga0207645_10034704 | Ga0207645_100347043 | 318 |
| 281 | 3300025942 | Ga0207689_10075725 | Ga0207689_100757252 | 318 |
| 282 | 3300026089 | Ga0207648_10004806 | Ga0207648_100048068 | 318 |
| 283 | 3300005331 | Ga0070670_100154309 | Ga0070670_1001543092 | 320 |
| 284 | 3300005354 | Ga0070675_100030862 | Ga0070675_1000308623 | 320 |
| 285 | 3300025926 | Ga0207659_10115581 | Ga0207659_101155812 | 320 |
| 286 | 3300049571 | Ga0501034_0046422 | Ga0501034_0046422_630_1721 | 320 |
| 287 | 3300049571 | Ga0501034_0049307 | Ga0501034_0049307_2522_3613 | 320 |
| 288 | 3300049581 | Ga0501047_0017081 | Ga0501047_0017081_4672_5763 | 320 |
| 289 | 3300003322 | rootL2_10207189 | rootL2_102071891 | 321 |
| 290 | 3300005356 | Ga0070674_100193453 | Ga0070674_1001934533 | 321 |
| 291 | 3300005985 | Ga0081539_10000603 | Ga0081539_1000060329 | 321 |
| 292 | 3300013306 | Ga0163162_10030461 | Ga0163162_100304613 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ofw-assembly1.cif.gz_A | crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis | 0.8951 | 4 | 317 |
| 8ofw-assembly2.cif.gz_B | crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis | 0.8858 | 4 | 317 |
| 6syp-assembly1.cif.gz_AAA | human dhodh bound to inhibitor ipp/cnrs-a017 | 0.8818 | 12 | 317 |
| 8ofw-assembly1.cif.gz_A | crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis | 0.8735 | 4 | 317 |
| 6aj5-assembly1.cif.gz_A | crystal structure of ligand-free type dhodh from eimeria tenella | 0.8712 | 35 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHL1_31_353_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8973 | 31 | 317 | 3.20.20.70 |
| af_Q2FV30_1_354_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8927 | 1 | 317 | 3.20.20.70 |
| af_Q2FV30_1_354_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8793 | 1 | 317 | 3.20.20.70 |
| af_P0A7E1_1_336_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8581 | 2 | 310 | 3.20.20.70 |
| 6i55B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8521 | 2 | 317 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3CWY0-F1-model_v4 | Dihydroorotate dehydrogenase (Quinone) | 0.9818 | 1 | 124 |
GO:0004152
GO:0005737 GO:0005886 GO:0006207 GO:0044205 |
| AF-A0A4Q6A9N9-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) | 0.9674 | 1 | 229 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
| AF-A0A455U4K3-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (Dihydroorotate oxidase) | 0.9642 | 43 | 183 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
| AF-A0A0G1P3W5-F1-model_v4 | Dihydroorotate dehydrogenase (Quinone) | 0.9613 | 28 | 187 |
GO:0004152
GO:0005737 GO:0005886 GO:0006207 GO:0044205 |
| AF-A0A2S9F9D6-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) | 0.9608 | 1 | 183 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar