F390697

General Info

Members Datasets Scaffolds Average Seq Length
292 174 584 268

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1006186|Ga0055542_10061862
Length 292
Sequence MFRALLNFIIFSSIYVACCAVLMVWQTNTLFHIRDVNHNFYIFVFFATICSYNFHWYLTPADYSASERILWGARHKALQLSLCAVGCIGAAYGFWFLKSHWLPLGGAAILTFLYSAPKLPQRAFVWLRKIAIGKTLFLSFVWTYVTTLLPVFIAGQAVTFSLVAYTLHRFFLVYAICILFDYRDLEADKKEGIRSLITYLSKHNLRRLYYCTLIFSAVFACCFPLPFMLFLLAPVLITALLTHYTMHTRSDLFYYSVLDGMVMLSALLHILVAKSCWLIPYFCTIINNNSNV

Samples

Sample ID Description Type Environment
1 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
155 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
161 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
162 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
163 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
164 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
165 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
166 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
167 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
168 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
169 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
170 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
171 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
172 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
173 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
174 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 0
Rhizosphere 74.32
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1006186 3300003762 Bacteria 2592
2 JGI24740J21852_10000667 3300001979 Bacteria 14865
3 JGI24739J22299_10000388 3300001989 Bacteria 15209
4 JGI25154J39366_1000014 3300002738 Bacteria 265287
5 JGI25157J39369_1002802 3300002741 Bacteria 3976
6 JGI25153J46596_10001638 3300003215 Bacteria 13289
7 JGI25153J46596_10009447 3300003215 Bacteria 4529
8 rootH2_10011084 3300003320 Bacteria 22647
9 rootH2_10020126 3300003320 Bacteria 16477
10 rootH2_10024559 3300003320 Bacteria 24277
11 rootH2_10110806 3300003320 Bacteria 7497
12 rootH2_10290256 3300003320 Bacteria 1073
13 rootH2_10292510 3300003320 Bacteria 1226
14 rootL2_10003127 3300003322 Bacteria 3214
15 rootL2_10003133 3300003322 Bacteria 3839
16 rootL2_10209918 3300003322 Bacteria 2276
17 rootH1_10013268 3300003323 Bacteria 8137
18 rootH1_10171198 3300003323 Bacteria 3033
19 JGI25160J50197_1007734 3300003354 Bacteria 4173
20 JGI25160J50197_1009501 3300003354 Bacteria 3601
21 JGI25160J50197_1011927 3300003354 Bacteria 3048
22 Ga0055526_1010664 3300003771 Bacteria 4245
23 Ga0055526_1029067 3300003771 Bacteria 1653
24 Ga0055528_1002063 3300003790 Bacteria 11222
25 Ga0055530_10000707 3300003791 Bacteria 28075
26 Ga0055531_10000093 3300003794 Bacteria 97901
27 Ga0055543_1013569 3300004625 Bacteria 1606
28 Ga0065165_1000036 3300005262 Bacteria 212900
29 Ga0065165_1010491 3300005262 Bacteria 3994
30 Ga0065704_10073424 3300005289 Bacteria 7177
31 Ga0065712_10023551 3300005290 Bacteria 1954
32 Ga0065715_10160046 3300005293 Bacteria 1638
33 Ga0070683_100010880 3300005329 Bacteria 7832
34 Ga0070683_100434843 3300005329 Bacteria 1252
35 Ga0070670_100018129 3300005331 Bacteria 6040
36 Ga0068869_100000615 3300005334 Bacteria 20138
37 Ga0068869_100125118 3300005334 Bacteria 1970
38 Ga0070666_10000043 3300005335 Bacteria 111402
39 Ga0068868_100098543 3300005338 Bacteria 2364
40 Ga0070689_100079553 3300005340 Bacteria 2571
41 Ga0070689_100131095 3300005340 Bacteria 2010
42 Ga0070668_100300614 3300005347 Bacteria 1346
43 Ga0070668_100328030 3300005347 Bacteria 1290
44 Ga0070669_100080572 3300005353 Bacteria 2423
45 Ga0070669_100300098 3300005353 Bacteria 1292
46 Ga0070675_100227692 3300005354 Bacteria 1625
47 Ga0070671_100061428 3300005355 Bacteria 3129
48 Ga0070673_100155414 3300005364 Bacteria 1941
49 Ga0070688_100040602 3300005365 Bacteria 2852
50 Ga0070688_100184488 3300005365 Bacteria 1449
51 Ga0070685_10003655 3300005466 Bacteria 7801
52 Ga0070706_100197305 3300005467 Bacteria 1880
53 Ga0070698_100000911 3300005471 Bacteria 32333
54 Ga0070698_100047958 3300005471 Bacteria 4366
55 Ga0070684_100007749 3300005535 Bacteria 8370
56 Ga0068853_100000730 3300005539 Bacteria 22729
57 Ga0068853_100031399 3300005539 Bacteria 4494
58 Ga0068853_100034863 3300005539 Bacteria 4273
59 Ga0070672_100094700 3300005543 Bacteria 2414
60 Ga0068855_100001370 3300005563 Bacteria 30171
61 Ga0068855_100010312 3300005563 Bacteria 11270
62 Ga0068855_100044562 3300005563 Bacteria 5250
63 Ga0068857_100002029 3300005577 Bacteria 16411
64 Ga0068857_100045481 3300005577 Bacteria 3895
65 Ga0068854_100038081 3300005578 Bacteria 3380
66 Ga0068854_100510524 3300005578 Unclassified 1014
67 Ga0068856_100076537 3300005614 Bacteria 3315
68 Ga0068852_100001241 3300005616 Bacteria 16992
69 Ga0068852_100031112 3300005616 Bacteria 4400
70 Ga0068852_100105231 3300005616 Bacteria 2556
71 Ga0068859_100000012 3300005617 Bacteria 300376
72 Ga0068864_100033143 3300005618 Bacteria 4391
73 Ga0068864_100113094 3300005618 Bacteria 2420
74 Ga0068851_10061569 3300005834 Bacteria 1924
75 Ga0068870_10056716 3300005840 Bacteria 2092
76 Ga0068863_100002451 3300005841 Bacteria 18437
77 Ga0068863_100015829 3300005841 Bacteria 7236
78 Ga0068863_100030038 3300005841 Bacteria 5191
79 Ga0068863_100318231 3300005841 Bacteria 1511
80 Ga0068858_100021233 3300005842 Bacteria 6064
81 Ga0068860_100000764 3300005843 Bacteria 36178
82 Ga0068860_100001749 3300005843 Bacteria 23145
83 Ga0068862_100199715 3300005844 Bacteria 1802
84 Ga0081540_1004389 3300005983 Bacteria 10778
85 Ga0097621_100007662 3300006237 Bacteria 7739
86 Ga0097621_100010692 3300006237 Bacteria 6726
87 Ga0097621_100042060 3300006237 Unclassified 3679
88 Ga0097621_100076544 3300006237 Bacteria 2776
89 Ga0068871_100006491 3300006358 Bacteria 8280
90 Ga0075428_100073643 3300006844 Bacteria 3731
91 Ga0097620_100000012 3300006931 Bacteria 300376
92 Ga0097620_100131626 3300006931 Bacteria 2573
93 Ga0105240_10000023 3300009093 Bacteria 385028
94 Ga0105240_10000893 3300009093 Bacteria 53349
95 Ga0105240_10001874 3300009093 Bacteria 34962
96 Ga0105240_10002999 3300009093 Bacteria 26556
97 Ga0105240_10015729 3300009093 Bacteria 10268
98 Ga0105240_10112506 3300009093 Bacteria 3291
99 Ga0111539_10157907 3300009094 Bacteria 2653
100 Ga0105245_10548668 3300009098 Unclassified 1177
101 Ga0105247_10027661 3300009101 Bacteria 3429
102 Ga0105241_10000518 3300009174 Bacteria 29032
103 Ga0105241_10000621 3300009174 Bacteria 26706
104 Ga0105241_10220503 3300009174 Bacteria 1594
105 Ga0105242_10260707 3300009176 Unclassified 1566
106 Ga0105237_10003522 3300009545 Bacteria 18555
107 Ga0105237_10004113 3300009545 Bacteria 16964
108 Ga0105237_10004328 3300009545 Bacteria 16462
109 Ga0105237_10010027 3300009545 Bacteria 10109
110 Ga0105237_10015546 3300009545 Bacteria 7915
111 Ga0105237_10226867 3300009545 Bacteria 1868
112 Ga0105238_10001036 3300009551 Bacteria 28205
113 Ga0105238_10216652 3300009551 Bacteria 1891
114 Ga0105249_10001020 3300009553 Bacteria 24765
115 Ga0105249_10004236 3300009553 Bacteria 12404
116 Ga0105249_10089620 3300009553 Bacteria 2875
117 Ga0105239_10001010 3300010375 Bacteria 39353
118 Ga0105239_10001887 3300010375 Bacteria 27397
119 Ga0105239_10003043 3300010375 Bacteria 20841
120 Ga0105239_10004031 3300010375 Bacteria 17766
121 Ga0105239_10006561 3300010375 Bacteria 13475
122 Ga0105239_10102298 3300010375 Bacteria 3171
123 Ga0105239_10141341 3300010375 Bacteria 2682
124 Ga0105239_10144152 3300010375 Bacteria 2655
125 Ga0105239_10321964 3300010375 Bacteria 1743
126 Ga0105246_10472500 3300011119 Bacteria 1059
127 Ga0105246_10662874 3300011119 Unclassified 910
128 Ga0157373_10259914 3300013100 Bacteria 1229
129 Ga0157371_10341482 3300013102 Bacteria 1089
130 Ga0157370_10142239 3300013104 Bacteria 2235
131 Ga0157370_10430724 3300013104 Bacteria 1213
132 Ga0157369_10010909 3300013105 Bacteria 10346
133 Ga0157374_10000002 3300013296 Bacteria 1054226
134 Ga0157374_10414292 3300013296 Bacteria 1345
135 Ga0157378_10106716 3300013297 Bacteria 2562
136 Ga0163162_10003131 3300013306 Bacteria 15803
137 Ga0163162_10076343 3300013306 Bacteria 3412
138 Ga0163162_10407469 3300013306 Bacteria 1492
139 Ga0163162_10785613 3300013306 Bacteria 1070
140 Ga0157372_10000573 3300013307 Bacteria 40317
141 Ga0157372_10001734 3300013307 Bacteria 23654
142 Ga0157372_10004245 3300013307 Bacteria 15321
143 Ga0157372_10061803 3300013307 Bacteria 4195
144 Ga0157375_10047784 3300013308 Bacteria 4182
145 Ga0157375_10196673 3300013308 Bacteria 2171
146 Ga0157375_11246330 3300013308 Bacteria 873
147 Ga0163163_10179363 3300014325 Bacteria 2165
148 Ga0163163_10551401 3300014325 Bacteria 1215
149 Ga0157380_10170834 3300014326 Bacteria 1899
150 Ga0157379_10035399 3300014968 Bacteria 4452
151 Ga0157379_10196147 3300014968 Bacteria 1825
152 Ga0157379_10341881 3300014968 Bacteria 1369
153 Ga0157376_10003845 3300014969 Bacteria 10383
154 Ga0157376_10041702 3300014969 Unclassified 3760
155 Ga0182005_1000039 3300015265 Bacteria 155210
156 Ga0163161_10108318 3300017792 Bacteria 2074
157 Ga0209436_103348 3300025208 Bacteria 4309
158 Ga0209258_100145 3300025242 Bacteria 163672
159 Ga0209646_1000002 3300025246 Bacteria 1425781
160 Ga0209026_1000178 3300025250 Bacteria 96368
161 Ga0209148_1000177 3300025254 Bacteria 127365
162 Ga0209673_1000931 3300025273 Bacteria 36809
163 Ga0209130_1003009 3300025284 Bacteria 7625
164 Ga0209564_1008711 3300025295 Bacteria 4953
165 Ga0209564_1010233 3300025295 Bacteria 4349
166 Ga0209758_1012682 3300025297 Bacteria 4684
167 Ga0209758_1020262 3300025297 Bacteria 3156
168 Ga0209758_1053654 3300025297 Bacteria 1383
169 Ga0209050_1000160 3300025298 Bacteria 157000
170 Ga0207426_1000318 3300025302 Bacteria 93692
171 Ga0207426_1000360 3300025302 Bacteria 82007
172 Ga0207426_1000681 3300025302 Bacteria 41125
173 Ga0209051_1022696 3300025303 Bacteria 2635
174 Ga0209257_1000001 3300025304 Bacteria 2274655
175 Ga0209257_1004122 3300025304 Bacteria 11588
176 Ga0207656_10087249 3300025321 Bacteria 1411
177 Ga0207680_10000108 3300025903 Bacteria 38066
178 Ga0207643_10003841 3300025908 Bacteria 8082
179 Ga0207654_10000983 3300025911 Bacteria 15637
180 Ga0207654_10001682 3300025911 Bacteria 11556
181 Ga0207654_10121261 3300025911 Bacteria 1642
182 Ga0207695_10000016 3300025913 Bacteria 771991
183 Ga0207695_10000128 3300025913 Bacteria 226098
184 Ga0207695_10001712 3300025913 Bacteria 35115
185 Ga0207695_10004313 3300025913 Bacteria 19491
186 Ga0207695_10017043 3300025913 Bacteria 8473
187 Ga0207695_10055555 3300025913 Bacteria 4125
188 Ga0207695_10076846 3300025913 Bacteria 3393
189 Ga0207695_10182942 3300025913 Bacteria 2016
190 Ga0207695_10215020 3300025913 Bacteria 1831
191 Ga0207671_10001027 3300025914 Bacteria 33973
192 Ga0207671_10001822 3300025914 Bacteria 23779
193 Ga0207671_10002901 3300025914 Bacteria 17704
194 Ga0207671_10026772 3300025914 Bacteria 4315
195 Ga0207671_10027867 3300025914 Bacteria 4222
196 Ga0207671_10073219 3300025914 Bacteria 2558
197 Ga0207671_10237673 3300025914 Bacteria 1430
198 Ga0207662_10072274 3300025918 Bacteria 2090
199 Ga0207694_10020432 3300025924 Bacteria 5011
200 Ga0207694_10032104 3300025924 Bacteria 4017
201 Ga0207694_10050241 3300025924 Bacteria 3229
202 Ga0207694_10055234 3300025924 Bacteria 3083
203 Ga0207650_10054613 3300025925 Bacteria 2964
204 Ga0207650_10145290 3300025925 Bacteria 1868
205 Ga0207659_10100754 3300025926 Bacteria 2177
206 Ga0207686_10000451 3300025934 Bacteria 27274
207 Ga0207670_10060369 3300025936 Bacteria 2583
208 Ga0207670_10164816 3300025936 Bacteria 1657
209 Ga0207704_10024438 3300025938 Bacteria 3277
210 Ga0207691_10131629 3300025940 Bacteria 2209
211 Ga0207689_10002573 3300025942 Bacteria 16805
212 Ga0207689_10040442 3300025942 Bacteria 3859
213 Ga0207689_10044918 3300025942 Bacteria 3654
214 Ga0207661_10002267 3300025944 Bacteria 13264
215 Ga0207667_10000151 3300025949 Bacteria 104054
216 Ga0207667_10012443 3300025949 Bacteria 9805
217 Ga0207667_10023382 3300025949 Bacteria 6805
218 Ga0207667_10288451 3300025949 Bacteria 1677
219 Ga0207712_10005443 3300025961 Bacteria 8035
220 Ga0207712_10027419 3300025961 Bacteria 3804
221 Ga0207712_10138824 3300025961 Bacteria 1862
222 Ga0207640_10538758 3300025981 Unclassified 979
223 Ga0207658_10292093 3300025986 Bacteria 1401
224 Ga0207677_10040293 3300026023 Bacteria 3078
225 Ga0207703_10164922 3300026035 Bacteria 1943
226 Ga0207639_10057022 3300026041 Bacteria 2997
227 Ga0207639_10069858 3300026041 Bacteria 2742
228 Ga0207708_10070464 3300026075 Bacteria 2676
229 Ga0207702_10029821 3300026078 Bacteria 4541
230 Ga0207641_10000048 3300026088 Bacteria 178206
231 Ga0207641_10010164 3300026088 Bacteria 7738
232 Ga0207641_10144343 3300026088 Bacteria 2151
233 Ga0207648_10193860 3300026089 Bacteria 1801
234 Ga0207676_10005736 3300026095 Bacteria 8785
235 Ga0207676_10047967 3300026095 Bacteria 3313
236 Ga0207676_10104102 3300026095 Bacteria 2360
237 Ga0207674_10005376 3300026116 Bacteria 15236
238 Ga0207674_10072305 3300026116 Bacteria 3464
239 Ga0207675_100274392 3300026118 Bacteria 1637
240 Ga0207683_10073585 3300026121 Bacteria 3023
241 Ga0207698_10007263 3300026142 Bacteria 6941
242 Ga0207698_10024582 3300026142 Bacteria 4231
243 Ga0207698_10100288 3300026142 Bacteria 2398
244 Ga0268264_10001559 3300028381 Bacteria 21251
245 Ga0268264_10013593 3300028381 Bacteria 6701
246 Ga0307517_10004401 3300028786 Bacteria 21639
247 Ga0307513_10061749 3300031456 Bacteria 3965
248 Ga0307509_10093184 3300031507 Bacteria 3076
249 Ga0307508_10001800 3300031616 Bacteria 23762
250 Ga0307516_10015462 3300031730 Bacteria 8029
251 Ga0307414_10653659 3300032004 Bacteria 948
252 Ga0307510_10000299 3300033180 Bacteria 45822
253 Ga0373937_0340752 3300036401 Bacteria 1420
254 Ga0439431_0000414 3300041997 Bacteria 8997
255 Ga0466972_0001873 3300044658 Bacteria 10314
256 Ga0466961_0003027 3300044693 Bacteria 10431
257 Ga0466959_0002949 3300045049 Bacteria 10980
258 Ga0495627_019679 3300046453 Bacteria 2259
259 Ga0495606_0042168 3300046507 Bacteria 3054
260 Ga0495633_0000005 3300046558 Bacteria 357644
261 Ga0495611_0002908 3300046648 Bacteria 7645
262 Ga0495649_0060964 3300046694 Bacteria 2029
263 Ga0495686_0000016 3300047472 Bacteria 443701
264 Ga0496121_0000054 3300048924 Bacteria 307236
265 Ga0496125_0359479 3300048928 Bacteria 866
266 Ga0501238_004701 3300049671 Unclassified 1713
267 nmdc:mga08y16_175761_c1 3300050511 Bacteria 2223
268 Ga0500581_116148 3300053089 Bacteria 1298
269 Ga0500646_0001750 3300053090 Bacteria 5708
270 Ga0500583_0011078 3300053092 Bacteria 3382
271 Ga0500651_0134038 3300053093 Bacteria 1497
272 Ga0500569_031468 3300053109 Bacteria 1492
273 Ga0500607_036697 3300053121 Bacteria 2675
274 Ga0500559_0007433 3300053136 Bacteria 4856
275 Ga0500568_0012586 3300053139 Bacteria 3883
276 Ga0500622_0001631 3300053156 Bacteria 17579
277 Ga0500636_0018698 3300053177 Bacteria 4097
278 2819574062 2818991442 Bacteria 8318214
279 2819680237 2818991460 Bacteria 7595395
280 2821137381 2821136567 Bacteria 8080116
281 2840677349 2840677318 Bacteria 2664183
282 2883072777 2883068021 Bacteria 6192739
283 2884791567 2884791551 Bacteria 8511252
284 2896085167 2896085136 Bacteria 6129793
285 2896115094 2896109856 Bacteria 7140722
286 2904467878 2904467357 Bacteria 8057758
287 2929182575 2929177148 Bacteria 7883697
288 2929241706 2929239360 Bacteria 7745570
289 2929923647 2929921140 Bacteria 8649150
290 2945978500 2945977869 Bacteria 7777518
291 2946015638 2946013367 Bacteria 7766675
292 8003155220 8003151029 Bacteria 8187759
293 Ga0055542_1006186
294 JGI24740J21852_10000667
295 JGI24739J22299_10000388
296 JGI25154J39366_1000014
297 JGI25157J39369_1002802
298 JGI25153J46596_10001638
299 JGI25153J46596_10009447
300 rootH2_10011084
301 rootH2_10020126
302 rootH2_10024559
303 rootH2_10110806
304 rootH2_10290256
305 rootH2_10292510
306 rootL2_10003127
307 rootL2_10003133
308 rootL2_10209918
309 rootH1_10013268
310 rootH1_10171198
311 JGI25160J50197_1007734
312 JGI25160J50197_1009501
313 JGI25160J50197_1011927
314 Ga0055526_1010664
315 Ga0055526_1029067
316 Ga0055528_1002063
317 Ga0055530_10000707
318 Ga0055531_10000093
319 Ga0055543_1013569
320 Ga0065165_1000036
321 Ga0065165_1010491
322 Ga0065704_10073424
323 Ga0065712_10023551
324 Ga0065715_10160046
325 Ga0070683_100010880
326 Ga0070683_100434843
327 Ga0070670_100018129
328 Ga0068869_100000615
329 Ga0068869_100125118
330 Ga0070666_10000043
331 Ga0068868_100098543
332 Ga0070689_100079553
333 Ga0070689_100131095
334 Ga0070668_100300614
335 Ga0070668_100328030
336 Ga0070669_100080572
337 Ga0070669_100300098
338 Ga0070675_100227692
339 Ga0070671_100061428
340 Ga0070673_100155414
341 Ga0070688_100040602
342 Ga0070688_100184488
343 Ga0070685_10003655
344 Ga0070706_100197305
345 Ga0070698_100000911
346 Ga0070698_100047958
347 Ga0070684_100007749
348 Ga0068853_100000730
349 Ga0068853_100031399
350 Ga0068853_100034863
351 Ga0070672_100094700
352 Ga0068855_100001370
353 Ga0068855_100010312
354 Ga0068855_100044562
355 Ga0068857_100002029
356 Ga0068857_100045481
357 Ga0068854_100038081
358 Ga0068854_100510524
359 Ga0068856_100076537
360 Ga0068852_100001241
361 Ga0068852_100031112
362 Ga0068852_100105231
363 Ga0068859_100000012
364 Ga0068864_100033143
365 Ga0068864_100113094
366 Ga0068851_10061569
367 Ga0068870_10056716
368 Ga0068863_100002451
369 Ga0068863_100015829
370 Ga0068863_100030038
371 Ga0068863_100318231
372 Ga0068858_100021233
373 Ga0068860_100000764
374 Ga0068860_100001749
375 Ga0068862_100199715
376 Ga0081540_1004389
377 Ga0097621_100007662
378 Ga0097621_100010692
379 Ga0097621_100042060
380 Ga0097621_100076544
381 Ga0068871_100006491
382 Ga0075428_100073643
383 Ga0097620_100000012
384 Ga0097620_100131626
385 Ga0105240_10000023
386 Ga0105240_10000893
387 Ga0105240_10001874
388 Ga0105240_10002999
389 Ga0105240_10015729
390 Ga0105240_10112506
391 Ga0111539_10157907
392 Ga0105245_10548668
393 Ga0105247_10027661
394 Ga0105241_10000518
395 Ga0105241_10000621
396 Ga0105241_10220503
397 Ga0105242_10260707
398 Ga0105237_10003522
399 Ga0105237_10004113
400 Ga0105237_10004328
401 Ga0105237_10010027
402 Ga0105237_10015546
403 Ga0105237_10226867
404 Ga0105238_10001036
405 Ga0105238_10216652
406 Ga0105249_10001020
407 Ga0105249_10004236
408 Ga0105249_10089620
409 Ga0105239_10001010
410 Ga0105239_10001887
411 Ga0105239_10003043
412 Ga0105239_10004031
413 Ga0105239_10006561
414 Ga0105239_10102298
415 Ga0105239_10141341
416 Ga0105239_10144152
417 Ga0105239_10321964
418 Ga0105246_10472500
419 Ga0105246_10662874
420 Ga0157373_10259914
421 Ga0157371_10341482
422 Ga0157370_10142239
423 Ga0157370_10430724
424 Ga0157369_10010909
425 Ga0157374_10000002
426 Ga0157374_10414292
427 Ga0157378_10106716
428 Ga0163162_10003131
429 Ga0163162_10076343
430 Ga0163162_10407469
431 Ga0163162_10785613
432 Ga0157372_10000573
433 Ga0157372_10001734
434 Ga0157372_10004245
435 Ga0157372_10061803
436 Ga0157375_10047784
437 Ga0157375_10196673
438 Ga0157375_11246330
439 Ga0163163_10179363
440 Ga0163163_10551401
441 Ga0157380_10170834
442 Ga0157379_10035399
443 Ga0157379_10196147
444 Ga0157379_10341881
445 Ga0157376_10003845
446 Ga0157376_10041702
447 Ga0182005_1000039
448 Ga0163161_10108318
449 Ga0209436_103348
450 Ga0209258_100145
451 Ga0209646_1000002
452 Ga0209026_1000178
453 Ga0209148_1000177
454 Ga0209673_1000931
455 Ga0209130_1003009
456 Ga0209564_1008711
457 Ga0209564_1010233
458 Ga0209758_1012682
459 Ga0209758_1020262
460 Ga0209758_1053654
461 Ga0209050_1000160
462 Ga0207426_1000318
463 Ga0207426_1000360
464 Ga0207426_1000681
465 Ga0209051_1022696
466 Ga0209257_1000001
467 Ga0209257_1004122
468 Ga0207656_10087249
469 Ga0207680_10000108
470 Ga0207643_10003841
471 Ga0207654_10000983
472 Ga0207654_10001682
473 Ga0207654_10121261
474 Ga0207695_10000016
475 Ga0207695_10000128
476 Ga0207695_10001712
477 Ga0207695_10004313
478 Ga0207695_10017043
479 Ga0207695_10055555
480 Ga0207695_10076846
481 Ga0207695_10182942
482 Ga0207695_10215020
483 Ga0207671_10001027
484 Ga0207671_10001822
485 Ga0207671_10002901
486 Ga0207671_10026772
487 Ga0207671_10027867
488 Ga0207671_10073219
489 Ga0207671_10237673
490 Ga0207662_10072274
491 Ga0207694_10020432
492 Ga0207694_10032104
493 Ga0207694_10050241
494 Ga0207694_10055234
495 Ga0207650_10054613
496 Ga0207650_10145290
497 Ga0207659_10100754
498 Ga0207686_10000451
499 Ga0207670_10060369
500 Ga0207670_10164816
501 Ga0207704_10024438
502 Ga0207691_10131629
503 Ga0207689_10002573
504 Ga0207689_10040442
505 Ga0207689_10044918
506 Ga0207661_10002267
507 Ga0207667_10000151
508 Ga0207667_10012443
509 Ga0207667_10023382
510 Ga0207667_10288451
511 Ga0207712_10005443
512 Ga0207712_10027419
513 Ga0207712_10138824
514 Ga0207640_10538758
515 Ga0207658_10292093
516 Ga0207677_10040293
517 Ga0207703_10164922
518 Ga0207639_10057022
519 Ga0207639_10069858
520 Ga0207708_10070464
521 Ga0207702_10029821
522 Ga0207641_10000048
523 Ga0207641_10010164
524 Ga0207641_10144343
525 Ga0207648_10193860
526 Ga0207676_10005736
527 Ga0207676_10047967
528 Ga0207676_10104102
529 Ga0207674_10005376
530 Ga0207674_10072305
531 Ga0207675_100274392
532 Ga0207683_10073585
533 Ga0207698_10007263
534 Ga0207698_10024582
535 Ga0207698_10100288
536 Ga0268264_10001559
537 Ga0268264_10013593
538 Ga0307517_10004401
539 Ga0307513_10061749
540 Ga0307509_10093184
541 Ga0307508_10001800
542 Ga0307516_10015462
543 Ga0307414_10653659
544 Ga0307510_10000299
545 Ga0373937_0340752
546 Ga0439431_0000414
547 Ga0466972_0001873
548 Ga0466961_0003027
549 Ga0466959_0002949
550 Ga0495627_019679
551 Ga0495606_0042168
552 Ga0495633_0000005
553 Ga0495611_0002908
554 Ga0495649_0060964
555 Ga0495686_0000016
556 Ga0496121_0000054
557 Ga0496125_0359479
558 Ga0501238_004701
559 nmdc:mga08y16_175761_c1
560 Ga0500581_116148
561 Ga0500646_0001750
562 Ga0500583_0011078
563 Ga0500651_0134038
564 Ga0500569_031468
565 Ga0500607_036697
566 Ga0500559_0007433
567 Ga0500568_0012586
568 Ga0500622_0001631
569 Ga0500636_0018698
570 2819574062
571 2819680237
572 2821137381
573 2840677349
574 2883072777
575 2884791567
576 2896085167
577 2896115094
578 2904467878
579 2929182575
580 2929241706
581 2929923647
582 2945978500
583 2946015638
584 8003155220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7134 17 277
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6788 17 277
4tq6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6629 7 270
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.6541 10 271
4tq5-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus 0.6507 7 278
ID Description Score Start End Superfamily
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7575 19 253 1.10.357.140
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7285 163 276 1.20.120.550
4od5A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.7273 160 273 1.20.120.1780
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.725 19 253 1.10.357.140
af_A0A0R0HE87_7_161_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7192 110 252 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2Z3MQL2-F1-model_v4 deleted 0.9825 1 274
AF-A0A1Y2RB79-F1-model_v4 Prenyltransferase 0.9751 24 278 GO:0016020
GO:0016765
AF-A0A4V3GLT9-F1-model_v4 UbiA prenyltransferase family protein 0.9736 2 275 GO:0016020
GO:0016765
AF-A0A317HHL1-F1-model_v4 Prenyltransferase 0.9724 24 276 GO:0016020
AF-A0A172TSQ3-F1-model_v4 UbiA prenyltransferase family protein 0.9714 1 275 GO:0016020

Map