F390512

General Info

Members Datasets Scaffolds Average Seq Length
291 173 582 190

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0000099|Ga0495651_0000099_16600_17223
Length 192
Sequence MHTSSTLLLQTPASQGIGSSLLAFFSRLGDSSWSVGLHESRYAYDLIESVHVWTLALFFGLAVMFDLRLLGWTMRSVPVSEVSRSGTLLFTAIPVRSYQNIFFRTKMIMLLLAGLNVWIFHSGVYRRVATWDVASAPPRAAKVAGGLSLVLWVCIVLSGRMIAYNWFDCDRQPQRPIVNFLTSCVPGQSEEH

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.81
Rhizosphere 92.78
Stem 0
Stem Tuber 0
Unclassified 22.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0000099 3300046462 Bacteria 63083
2 Ga0068868_100187782 3300005338 Bacteria 1718
3 Ga0070689_100143951 3300005340 Bacteria 1919
4 Ga0070669_100312073 3300005353 Bacteria 1268
5 Ga0070669_100544458 3300005353 Bacteria 967
6 Ga0070673_100016843 3300005364 Bacteria 5182
7 Ga0070688_100064667 3300005365 Unclassified 2322
8 Ga0070667_100059982 3300005367 Plasmid 3219
9 Ga0070714_100274896 3300005435 Bacteria 1563
10 Ga0070711_100990264 3300005439 Unclassified 721
11 Ga0070662_100509989 3300005457 Bacteria 1004
12 Ga0070681_10387308 3300005458 Unclassified 1309
13 Ga0070685_10172709 3300005466 Unclassified 1386
14 Ga0070706_100812865 3300005467 Bacteria 865
15 Ga0070698_100077468 3300005471 Bacteria 3325
16 Ga0070698_100274148 3300005471 Bacteria 1618
17 Ga0070698_101127645 3300005471 Bacteria 733
18 Ga0070679_100450385 3300005530 Bacteria 1232
19 Ga0070672_100002228 3300005543 Bacteria 12211
20 Ga0070695_100133538 3300005545 Bacteria 1713
21 Ga0070696_100613026 3300005546 Bacteria 879
22 Ga0070665_100231351 3300005548 Bacteria 1848
23 Ga0070704_100423757 3300005549 Unclassified 1140
24 Ga0070704_100542920 3300005549 Bacteria 1015
25 Ga0070704_101087596 3300005549 Unclassified 726
26 Ga0070702_100220021 3300005615 Unclassified 1269
27 Ga0070702_100559318 3300005615 Bacteria 851
28 Ga0068859_100053361 3300005617 Bacteria 4066
29 Ga0068859_100081439 3300005617 Bacteria 3280
30 Ga0068861_100159158 3300005719 Bacteria 1861
31 Ga0068863_100587938 3300005841 Bacteria 1101
32 Ga0068863_101333653 3300005841 Bacteria 725
33 Ga0068858_100083695 3300005842 Bacteria 2967
34 Ga0068858_100115928 3300005842 Bacteria 2504
35 Ga0068858_100841772 3300005842 Bacteria 896
36 Ga0068860_100078256 3300005843 Unclassified 3145
37 Ga0068860_100114408 3300005843 Unclassified 2580
38 Ga0068860_100200829 3300005843 Bacteria 1932
39 Ga0068862_100267977 3300005844 Bacteria 1561
40 Ga0081455_10002890 3300005937 Bacteria 20177
41 Ga0081455_10072254 3300005937 Bacteria 2857
42 Ga0081539_10000108 3300005985 Bacteria 195322
43 Ga0070717_10020565 3300006028 Bacteria 5193
44 Ga0070717_10183958 3300006028 Bacteria 1823
45 Ga0070716_100596510 3300006173 Bacteria 830
46 Ga0097621_100006560 3300006237 Bacteria 8265
47 Ga0097621_100047289 3300006237 Bacteria 3486
48 Ga0097621_100151941 3300006237 Bacteria 1986
49 Ga0097621_100152244 3300006237 Bacteria 1984
50 Ga0068871_100001669 3300006358 Bacteria 14925
51 Ga0068871_100125500 3300006358 Bacteria 2172
52 Ga0068871_100416743 3300006358 Unclassified 1199
53 Ga0075428_100122170 3300006844 Bacteria 2835
54 Ga0075430_100871109 3300006846 Viruses 742
55 Ga0075433_10096567 3300006852 Bacteria 2615
56 Ga0075433_10133448 3300006852 Unclassified 2207
57 Ga0075434_100007860 3300006871 Bacteria 9879
58 Ga0075434_100022183 3300006871 Bacteria 6184
59 Ga0075434_100143310 3300006871 Unclassified 2410
60 Ga0075429_100202086 3300006880 Bacteria 1741
61 Ga0075436_100392289 3300006914 Unclassified 1005
62 Ga0097620_100053359 3300006931 Bacteria 4066
63 Ga0097620_100081434 3300006931 Bacteria 3280
64 Ga0075435_100018875 3300007076 Bacteria 5254
65 Ga0075435_100021888 3300007076 Bacteria 4926
66 Ga0075435_100086905 3300007076 Bacteria 2576
67 Ga0075435_100117465 3300007076 Bacteria 2217
68 Ga0075435_100209673 3300007076 Bacteria 1652
69 Ga0099795_10000393 3300007788 Bacteria 7907
70 Ga0099795_10047180 3300007788 Bacteria 1555
71 Ga0099795_10146499 3300007788 Bacteria 964
72 Ga0105240_10417949 3300009093 Bacteria 1507
73 Ga0111539_10144179 3300009094 Plasmid 2788
74 Ga0105245_10296658 3300009098 Bacteria 1584
75 Ga0105247_10117445 3300009101 Bacteria 1719
76 Ga0114129_10003761 3300009147 Bacteria 21393
77 Ga0114129_10008359 3300009147 Bacteria 14751
78 Ga0114129_10088162 3300009147 Bacteria 4303
79 Ga0105243_10197418 3300009148 Unclassified 1762
80 Ga0105241_10243471 3300009174 Bacteria 1521
81 Ga0105242_10155057 3300009176 Bacteria 2000
82 Ga0105242_10918416 3300009176 Unclassified 877
83 Ga0105248_10005253 3300009177 Bacteria 14259
84 Ga0105248_10497044 3300009177 Unclassified 1375
85 Ga0099796_10002012 3300010159 Bacteria 4330
86 Ga0099796_10016922 3300010159 Bacteria 2162
87 Ga0099796_10063950 3300010159 Bacteria 1312
88 Ga0099796_10280308 3300010159 Bacteria 701
89 Ga0157374_10031070 3300013296 Bacteria 4850
90 Ga0157378_10033890 3300013297 Bacteria 4517
91 Ga0157378_10061071 3300013297 Unclassified 3362
92 Ga0157378_10428429 3300013297 Bacteria 1309
93 Ga0157378_10973660 3300013297 Bacteria 882
94 Ga0157375_10051341 3300013308 Bacteria 4049
95 Ga0157375_10443651 3300013308 Bacteria 1463
96 Ga0157375_10780318 3300013308 Bacteria 1105
97 Ga0157375_11345166 3300013308 Unclassified 840
98 Ga0163163_10239907 3300014325 Bacteria 1862
99 Ga0157377_10477442 3300014745 Bacteria 866
100 Ga0157379_10042060 3300014968 Bacteria 4078
101 Ga0157379_10120967 3300014968 Bacteria 2355
102 Ga0157376_10142336 3300014969 Bacteria 2153
103 Ga0157376_10876790 3300014969 Bacteria 914
104 Ga0163161_10232587 3300017792 Unclassified 1431
105 Ga0213876_10093244 3300021384 Bacteria 1595
106 Ga0207680_10044858 3300025903 Bacteria 2603
107 Ga0207680_10158049 3300025903 Bacteria 1517
108 Ga0207684_10669244 3300025910 Bacteria 884
109 Ga0207654_10187393 3300025911 Bacteria 1354
110 Ga0207707_10483025 3300025912 Bacteria 1058
111 Ga0207695_10277774 3300025913 Bacteria 1569
112 Ga0207646_10650403 3300025922 Bacteria 944
113 Ga0207681_10332262 3300025923 Bacteria 1212
114 Ga0207687_10139137 3300025927 Bacteria 1839
115 Ga0207687_10755972 3300025927 Bacteria 827
116 Ga0207664_10289169 3300025929 Bacteria 1440
117 Ga0207644_10053579 3300025931 Unclassified 2903
118 Ga0207644_10508731 3300025931 Unclassified 994
119 Ga0207686_10026686 3300025934 Bacteria 3373
120 Ga0207670_10104663 3300025936 Bacteria 2027
121 Ga0207669_10635610 3300025937 Unclassified 871
122 Ga0207704_10277813 3300025938 Unclassified 1272
123 Ga0207665_10860294 3300025939 Bacteria 718
124 Ga0207691_10030491 3300025940 Bacteria 5038
125 Ga0207711_10069381 3300025941 Bacteria 3055
126 Ga0207711_10124954 3300025941 Bacteria 2300
127 Ga0207661_10288332 3300025944 Bacteria 1469
128 Ga0207651_10440181 3300025960 Unclassified 1116
129 Ga0207658_10026218 3300025986 Bacteria 4085
130 Ga0207658_10491626 3300025986 Unclassified 1092
131 Ga0207677_10240221 3300026023 Bacteria 1465
132 Ga0207703_10065926 3300026035 Bacteria 2977
133 Ga0207703_11245007 3300026035 Bacteria 715
134 Ga0207708_10175832 3300026075 Bacteria 1698
135 Ga0207641_10004162 3300026088 Bacteria 12606
136 Ga0207641_11297948 3300026088 Bacteria 728
137 Ga0209179_1004745 3300027512 Unclassified 2075
138 Ga0268266_10003260 3300028379 Bacteria 16360
139 Ga0268266_10055579 3300028379 Bacteria 3403
140 Ga0268265_10248101 3300028380 Bacteria 1575
141 Ga0268264_10124010 3300028381 Unclassified 2280
142 Ga0268264_10156443 3300028381 Unclassified 2049
143 Ga0265318_10073184 3300028577 Bacteria 1269
144 Ga0265328_10038782 3300031239 Unclassified 1758
145 Ga0265314_10121183 3300031711 Bacteria 1646
146 Ga0373928_0083409 3300035084 Bacteria 809
147 Ga0373944_0060061 3300035089 Bacteria 1218
148 Ga0373923_0226064 3300035111 Bacteria 871
149 Ga0373932_0019477 3300035112 Bacteria 1769
150 Ga0373932_0041865 3300035112 Bacteria 1326
151 Ga0373939_0031194 3300035114 Bacteria 1539
152 Ga0373954_0195706 3300035118 Bacteria 993
153 Ga0373956_0205599 3300035119 Bacteria 934
154 Ga0373956_0274719 3300035119 Bacteria 802
155 Ga0373960_0011805 3300035121 Unclassified 2160
156 Ga0373943_0002591 3300035170 Bacteria 8219
157 Ga0373946_0029112 3300035171 Bacteria 2196
158 Ga0373955_0009514 3300035172 Bacteria 4556
159 Ga0373955_0061247 3300035172 Bacteria 2078
160 Ga0373955_0074490 3300035172 Bacteria 1905
161 Ga0373924_0012805 3300035410 Bacteria 3140
162 Ga0373924_0083220 3300035410 Unclassified 1363
163 Ga0373931_0121850 3300035691 Bacteria 1491
164 Ga0373931_0278372 3300035691 Unclassified 1026
165 Ga0373935_0142215 3300035692 Unclassified 1622
166 Ga0373935_0182284 3300035692 Bacteria 1442
167 Ga0373935_0360997 3300035692 Bacteria 1037
168 Ga0373927_0068610 3300035695 Bacteria 2294
169 Ga0373927_0160132 3300035695 Bacteria 1474
170 Ga0373927_0764249 3300035695 Bacteria 638
171 Ga0373933_0122722 3300035724 Bacteria 1628
172 Ga0373947_0022894 3300035725 Bacteria 3628
173 Ga0373947_0038600 3300035725 Bacteria 2838
174 Ga0373947_0866388 3300035725 Bacteria 617
175 Ga0373937_0012790 3300036401 Bacteria 7389
176 Ga0373937_0015179 3300036401 Bacteria 6806
177 Ga0373937_0038251 3300036401 Bacteria 4373
178 Ga0373937_0059879 3300036401 Bacteria 3500
179 Ga0373937_0119143 3300036401 Bacteria 2459
180 Ga0373925_0031736 3300037068 Unclassified 3885
181 Ga0373925_0240829 3300037068 Bacteria 1449
182 Ga0436364_0222228 3300037853 Unclassified 3227
183 Ga0436364_0294884 3300037853 Bacteria 1155
184 Ga0436365_1047079 3300039437 Bacteria 899
185 Ga0436365_1191915 3300039437 Bacteria 3506
186 Ga0436363_1130987 3300039450 Bacteria 2660
187 Ga0451853_3037081 3300041512 Bacteria 794
188 Ga0495592_0090160 3300046454 Bacteria 2200
189 Ga0495603_0026694 3300046455 Bacteria 3488
190 Ga0495629_0305128 3300046459 Unclassified 1090
191 Ga0495651_0142708 3300046462 Bacteria 1735
192 Ga0495653_0438155 3300046463 Unclassified 824
193 Ga0495580_0103398 3300046472 Bacteria 1980
194 Ga0495580_0263568 3300046472 Bacteria 1178
195 Ga0495580_0620239 3300046472 Bacteria 713
196 Ga0495582_0031567 3300046473 Unclassified 2912
197 Ga0495582_0580326 3300046473 Unclassified 649
198 Ga0495639_0023159 3300046475 Bacteria 2728
199 Ga0495639_0064483 3300046475 Bacteria 1684
200 Ga0495584_0169699 3300046491 Unclassified 1109
201 Ga0495608_0002111 3300046511 Bacteria 14317
202 Ga0495608_0560766 3300046511 Bacteria 688
203 Ga0495630_0020184 3300046517 Bacteria 4910
204 Ga0495630_0688533 3300046517 Unclassified 782
205 Ga0495644_0079077 3300046523 Unclassified 1239
206 Ga0495642_0326092 3300046528 Bacteria 674
207 Ga0495642_0353878 3300046528 Bacteria 646
208 Ga0495652_0050974 3300046529 Bacteria 3537
209 Ga0495652_0464355 3300046529 Unclassified 884
210 Ga0495665_0166406 3300046531 Bacteria 1148
211 Ga0495640_0249243 3300046533 Bacteria 1113
212 Ga0495586_0179081 3300046535 Bacteria 1199
213 Ga0495586_0389450 3300046535 Bacteria 802
214 Ga0495587_0114016 3300046536 Unclassified 1551
215 Ga0495587_0181779 3300046536 Bacteria 1192
216 Ga0495645_0012604 3300046543 Bacteria 5960
217 Ga0495645_0023593 3300046543 Bacteria 4456
218 Ga0495645_0085265 3300046543 Unclassified 2261
219 Ga0495667_0002941 3300046559 Bacteria 11430
220 Ga0495667_0103241 3300046559 Bacteria 1844
221 Ga0495656_0219656 3300046615 Unclassified 950
222 Ga0495634_0029929 3300046642 Bacteria 3765
223 Ga0495634_0125095 3300046642 Unclassified 1644
224 Ga0495635_0206524 3300046663 Unclassified 1331
225 Ga0495657_0406350 3300046675 Bacteria 801
226 Ga0495647_0042950 3300046681 Bacteria 1728
227 Ga0495647_0259046 3300046681 Bacteria 776
228 Ga0495658_0038538 3300046683 Bacteria 2648
229 Ga0495658_0044819 3300046683 Unclassified 2479
230 Ga0495658_0175144 3300046683 Bacteria 1329
231 Ga0495669_0045952 3300046684 Unclassified 1948
232 Ga0495613_0002407 3300046689 Bacteria 14153
233 Ga0495613_0125880 3300046689 Bacteria 1838
234 Ga0495613_0156009 3300046689 Bacteria 1626
235 Ga0495613_0329585 3300046689 Bacteria 1052
236 Ga0495600_0013928 3300046809 Bacteria 5067
237 Ga0495581_0071125 3300047315 Bacteria 2013
238 Ga0495581_0108749 3300047315 Bacteria 1612
239 Ga0495604_0040578 3300047317 Bacteria 3654
240 Ga0495674_0017078 3300047319 Bacteria 6760
241 Ga0495680_0000368 3300047322 Bacteria 50535
242 Ga0495680_0231021 3300047322 Bacteria 1317
243 Ga0495680_0464169 3300047322 Unclassified 865
244 Ga0495675_0083438 3300047444 Unclassified 2011
245 Ga0495677_0274321 3300047445 Bacteria 661
246 Ga0495684_0001723 3300047471 Bacteria 17602
247 Ga0495684_0198159 3300047471 Unclassified 1481
248 Ga0496101_0027005 3300048904 Bacteria 3994
249 Ga0496102_1084499 3300048905 Bacteria 721
250 Ga0496104_0010259 3300048907 Bacteria 8367
251 Ga0496104_0104141 3300048907 Unclassified 2719
252 Ga0496104_0260250 3300048907 Bacteria 1648
253 Ga0496104_0939714 3300048907 Bacteria 769
254 Ga0496106_0086544 3300048909 Unclassified 2414
255 Ga0496107_0530654 3300048910 Bacteria 872
256 Ga0496108_1168997 3300048911 Unclassified 652
257 Ga0496109_0178490 3300048912 Unclassified 1994
258 Ga0496110_0128183 3300048913 Bacteria 2290
259 Ga0496114_0094550 3300048917 Bacteria 2542
260 Ga0496114_0795186 3300048917 Unclassified 824
261 Ga0496115_0236923 3300048918 Bacteria 1504
262 Ga0501081_0173162 3300049743 Unclassified 1559
263 nmdc:mga05p37_12246_c1 3300050507 Bacteria 10241
264 nmdc:mga05p37_139383_c1 3300050507 Bacteria 2972
265 nmdc:mga05p37_196043_c1 3300050507 Bacteria 2449
266 nmdc:mga05p37_719581_c1 3300050507 Unclassified 1106
267 nmdc:mga09592_238839_c1 3300050508 Bacteria 1574
268 nmdc:mga08y16_89853_c1 3300050511 Plasmid 3201
269 nmdc:mga0n895_21373_c1 3300050512 Bacteria 6050
270 nmdc:mga0n895_47004_c1 3300050512 Bacteria 4219
271 nmdc:mga0n895_90430_c1 3300050512 Unclassified 3063
272 nmdc:mga0rr50_120417_c1 3300050513 Bacteria 2088
273 nmdc:mga0rr50_39172_c1 3300050513 Bacteria 3436
274 nmdc:mga0rr50_8184_c1 3300050513 Bacteria 6494
275 nmdc:mga0rr50_86541_c1 3300050513 Bacteria 2431
276 nmdc:mga08x19_319713_c1 3300050514 Bacteria 1080
277 nmdc:mga08x19_56038_c1 3300050514 Bacteria 2543
278 nmdc:mga0a205_11476_c1 3300050515 Bacteria 8157
279 nmdc:mga0a205_139831_c1 3300050515 Bacteria 2321
280 nmdc:mga0a205_147845_c1 3300050515 Bacteria 2250
281 nmdc:mga0a205_26244_c1 3300050515 Bacteria 5552
282 nmdc:mga0a205_3628_c1 3300050515 Bacteria 13819
283 nmdc:mga0a205_65431_c1 3300050515 Bacteria 3512
284 nmdc:mga0a205_968715_c1 3300050515 Unclassified 697
285 Ga0495601_0023300 3300053077 Bacteria 3804
286 Ga0495595_0022486 3300053084 Bacteria 2768
287 Ga0495595_0022737 3300053084 Unclassified 2755
288 Ga0495619_0025294 3300053085 Bacteria 3811
289 Ga0495619_0265243 3300053085 Bacteria 1190
290 Ga0501084_0395348 3300054114 Unclassified 1168
291 Ga0501082_0258551 3300060353 Unclassified 1515
292 Ga0495651_0000099
293 Ga0068868_100187782
294 Ga0070689_100143951
295 Ga0070669_100312073
296 Ga0070669_100544458
297 Ga0070673_100016843
298 Ga0070688_100064667
299 Ga0070667_100059982
300 Ga0070714_100274896
301 Ga0070711_100990264
302 Ga0070662_100509989
303 Ga0070681_10387308
304 Ga0070685_10172709
305 Ga0070706_100812865
306 Ga0070698_100077468
307 Ga0070698_100274148
308 Ga0070698_101127645
309 Ga0070679_100450385
310 Ga0070672_100002228
311 Ga0070695_100133538
312 Ga0070696_100613026
313 Ga0070665_100231351
314 Ga0070704_100423757
315 Ga0070704_100542920
316 Ga0070704_101087596
317 Ga0070702_100220021
318 Ga0070702_100559318
319 Ga0068859_100053361
320 Ga0068859_100081439
321 Ga0068861_100159158
322 Ga0068863_100587938
323 Ga0068863_101333653
324 Ga0068858_100083695
325 Ga0068858_100115928
326 Ga0068858_100841772
327 Ga0068860_100078256
328 Ga0068860_100114408
329 Ga0068860_100200829
330 Ga0068862_100267977
331 Ga0081455_10002890
332 Ga0081455_10072254
333 Ga0081539_10000108
334 Ga0070717_10020565
335 Ga0070717_10183958
336 Ga0070716_100596510
337 Ga0097621_100006560
338 Ga0097621_100047289
339 Ga0097621_100151941
340 Ga0097621_100152244
341 Ga0068871_100001669
342 Ga0068871_100125500
343 Ga0068871_100416743
344 Ga0075428_100122170
345 Ga0075430_100871109
346 Ga0075433_10096567
347 Ga0075433_10133448
348 Ga0075434_100007860
349 Ga0075434_100022183
350 Ga0075434_100143310
351 Ga0075429_100202086
352 Ga0075436_100392289
353 Ga0097620_100053359
354 Ga0097620_100081434
355 Ga0075435_100018875
356 Ga0075435_100021888
357 Ga0075435_100086905
358 Ga0075435_100117465
359 Ga0075435_100209673
360 Ga0099795_10000393
361 Ga0099795_10047180
362 Ga0099795_10146499
363 Ga0105240_10417949
364 Ga0111539_10144179
365 Ga0105245_10296658
366 Ga0105247_10117445
367 Ga0114129_10003761
368 Ga0114129_10008359
369 Ga0114129_10088162
370 Ga0105243_10197418
371 Ga0105241_10243471
372 Ga0105242_10155057
373 Ga0105242_10918416
374 Ga0105248_10005253
375 Ga0105248_10497044
376 Ga0099796_10002012
377 Ga0099796_10016922
378 Ga0099796_10063950
379 Ga0099796_10280308
380 Ga0157374_10031070
381 Ga0157378_10033890
382 Ga0157378_10061071
383 Ga0157378_10428429
384 Ga0157378_10973660
385 Ga0157375_10051341
386 Ga0157375_10443651
387 Ga0157375_10780318
388 Ga0157375_11345166
389 Ga0163163_10239907
390 Ga0157377_10477442
391 Ga0157379_10042060
392 Ga0157379_10120967
393 Ga0157376_10142336
394 Ga0157376_10876790
395 Ga0163161_10232587
396 Ga0213876_10093244
397 Ga0207680_10044858
398 Ga0207680_10158049
399 Ga0207684_10669244
400 Ga0207654_10187393
401 Ga0207707_10483025
402 Ga0207695_10277774
403 Ga0207646_10650403
404 Ga0207681_10332262
405 Ga0207687_10139137
406 Ga0207687_10755972
407 Ga0207664_10289169
408 Ga0207644_10053579
409 Ga0207644_10508731
410 Ga0207686_10026686
411 Ga0207670_10104663
412 Ga0207669_10635610
413 Ga0207704_10277813
414 Ga0207665_10860294
415 Ga0207691_10030491
416 Ga0207711_10069381
417 Ga0207711_10124954
418 Ga0207661_10288332
419 Ga0207651_10440181
420 Ga0207658_10026218
421 Ga0207658_10491626
422 Ga0207677_10240221
423 Ga0207703_10065926
424 Ga0207703_11245007
425 Ga0207708_10175832
426 Ga0207641_10004162
427 Ga0207641_11297948
428 Ga0209179_1004745
429 Ga0268266_10003260
430 Ga0268266_10055579
431 Ga0268265_10248101
432 Ga0268264_10124010
433 Ga0268264_10156443
434 Ga0265318_10073184
435 Ga0265328_10038782
436 Ga0265314_10121183
437 Ga0373928_0083409
438 Ga0373944_0060061
439 Ga0373923_0226064
440 Ga0373932_0019477
441 Ga0373932_0041865
442 Ga0373939_0031194
443 Ga0373954_0195706
444 Ga0373956_0205599
445 Ga0373956_0274719
446 Ga0373960_0011805
447 Ga0373943_0002591
448 Ga0373946_0029112
449 Ga0373955_0009514
450 Ga0373955_0061247
451 Ga0373955_0074490
452 Ga0373924_0012805
453 Ga0373924_0083220
454 Ga0373931_0121850
455 Ga0373931_0278372
456 Ga0373935_0142215
457 Ga0373935_0182284
458 Ga0373935_0360997
459 Ga0373927_0068610
460 Ga0373927_0160132
461 Ga0373927_0764249
462 Ga0373933_0122722
463 Ga0373947_0022894
464 Ga0373947_0038600
465 Ga0373947_0866388
466 Ga0373937_0012790
467 Ga0373937_0015179
468 Ga0373937_0038251
469 Ga0373937_0059879
470 Ga0373937_0119143
471 Ga0373925_0031736
472 Ga0373925_0240829
473 Ga0436364_0222228
474 Ga0436364_0294884
475 Ga0436365_1047079
476 Ga0436365_1191915
477 Ga0436363_1130987
478 Ga0451853_3037081
479 Ga0495592_0090160
480 Ga0495603_0026694
481 Ga0495629_0305128
482 Ga0495651_0142708
483 Ga0495653_0438155
484 Ga0495580_0103398
485 Ga0495580_0263568
486 Ga0495580_0620239
487 Ga0495582_0031567
488 Ga0495582_0580326
489 Ga0495639_0023159
490 Ga0495639_0064483
491 Ga0495584_0169699
492 Ga0495608_0002111
493 Ga0495608_0560766
494 Ga0495630_0020184
495 Ga0495630_0688533
496 Ga0495644_0079077
497 Ga0495642_0326092
498 Ga0495642_0353878
499 Ga0495652_0050974
500 Ga0495652_0464355
501 Ga0495665_0166406
502 Ga0495640_0249243
503 Ga0495586_0179081
504 Ga0495586_0389450
505 Ga0495587_0114016
506 Ga0495587_0181779
507 Ga0495645_0012604
508 Ga0495645_0023593
509 Ga0495645_0085265
510 Ga0495667_0002941
511 Ga0495667_0103241
512 Ga0495656_0219656
513 Ga0495634_0029929
514 Ga0495634_0125095
515 Ga0495635_0206524
516 Ga0495657_0406350
517 Ga0495647_0042950
518 Ga0495647_0259046
519 Ga0495658_0038538
520 Ga0495658_0044819
521 Ga0495658_0175144
522 Ga0495669_0045952
523 Ga0495613_0002407
524 Ga0495613_0125880
525 Ga0495613_0156009
526 Ga0495613_0329585
527 Ga0495600_0013928
528 Ga0495581_0071125
529 Ga0495581_0108749
530 Ga0495604_0040578
531 Ga0495674_0017078
532 Ga0495680_0000368
533 Ga0495680_0231021
534 Ga0495680_0464169
535 Ga0495675_0083438
536 Ga0495677_0274321
537 Ga0495684_0001723
538 Ga0495684_0198159
539 Ga0496101_0027005
540 Ga0496102_1084499
541 Ga0496104_0010259
542 Ga0496104_0104141
543 Ga0496104_0260250
544 Ga0496104_0939714
545 Ga0496106_0086544
546 Ga0496107_0530654
547 Ga0496108_1168997
548 Ga0496109_0178490
549 Ga0496110_0128183
550 Ga0496114_0094550
551 Ga0496114_0795186
552 Ga0496115_0236923
553 Ga0501081_0173162
554 nmdc:mga05p37_12246_c1
555 nmdc:mga05p37_139383_c1
556 nmdc:mga05p37_196043_c1
557 nmdc:mga05p37_719581_c1
558 nmdc:mga09592_238839_c1
559 nmdc:mga08y16_89853_c1
560 nmdc:mga0n895_21373_c1
561 nmdc:mga0n895_47004_c1
562 nmdc:mga0n895_90430_c1
563 nmdc:mga0rr50_120417_c1
564 nmdc:mga0rr50_39172_c1
565 nmdc:mga0rr50_8184_c1
566 nmdc:mga0rr50_86541_c1
567 nmdc:mga08x19_319713_c1
568 nmdc:mga08x19_56038_c1
569 nmdc:mga0a205_11476_c1
570 nmdc:mga0a205_139831_c1
571 nmdc:mga0a205_147845_c1
572 nmdc:mga0a205_26244_c1
573 nmdc:mga0a205_3628_c1
574 nmdc:mga0a205_65431_c1
575 nmdc:mga0a205_968715_c1
576 Ga0495601_0023300
577 Ga0495595_0022486
578 Ga0495595_0022737
579 Ga0495619_0025294
580 Ga0495619_0265243
581 Ga0501084_0395348
582 Ga0501082_0258551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8glv-assembly1.cif.gz_JT 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.7488 93 173
4xwj-assembly1.cif.gz_A histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.4899 1 160
4xwj-assembly1.cif.gz_A histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.4749 1 160
7eeb-assembly1.cif.gz_B structure of the catspermasome 0.3925 2 162
6s18-assembly1.cif.gz_A ligand binding domain of the p. putida receptor pcay_pp in complex with glycerol 0.3731 4 170
ID Description Score Start End Superfamily
af_Q23355_256_368_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6134 103 178 1.20.58.390
af_Q55C03_152_358_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5529 27 180 1.20.120.1770
af_Q6P1H1_6_228_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5094 3 180 1.20.120.1770
af_I1JRZ9_200_386_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4955 18 181 1.20.120.1770
af_P34330_65_305_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4874 3 155 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A317J3Y8-F1-model_v4 DUF6644 domain-containing protein 0.9556 1 161 GO:0016020
AF-A0A2R5F657-F1-model_v4 DUF6644 domain-containing protein 0.9522 1 161 GO:0016020
AF-A0A2V8HNZ2-F1-model_v4 DUF6644 domain-containing protein 0.9477 1 161 GO:0016020
AF-A0A849T5G4-F1-model_v4 DUF6644 domain-containing protein 0.9415 1 164 GO:0016020
AF-A0A2V9CRF0-F1-model_v4 DUF6644 domain-containing protein 0.9415 5 161 GO:0016020

Map