F390363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 172 | 291 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10006684|Ga0213876_100066844 |
| Length | 159 |
| Sequence | MGSKVSLFQSLNVSMFMATLKRFEDILSWQKARVLNDKIGSLIDNGNFKSNYRLINQIEGSAGSIMDNIAEGFERSGNKEFVQFLYISKGSCGELRSQLYRAIDRKYLNQKQFDDFYNSVLEISVLIQKLINYLCESELKGTKYKTKQVAYKTSETLKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 134 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 136 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 137 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 163 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 164 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 165 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 167 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 168 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 169 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 170 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 171 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 172 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.41 |
| Nodule | 0 |
| Rhizoplane | 0.69 |
| Rhizosphere | 94.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10028485 | 3300001979 | Bacteria | 1845 |
| 2 | rootH1_10097423 | 3300003316 | Bacteria | 1972 |
| 3 | rootL2_10043714 | 3300003322 | Unclassified | 2265 |
| 4 | rootL2_10296321 | 3300003322 | Unclassified | 1238 |
| 5 | rootH1_10139114 | 3300003323 | Bacteria | 1467 |
| 6 | JGI25160J50197_1000239 | 3300003354 | Bacteria | 42596 |
| 7 | Ga0065715_10438140 | 3300005293 | Bacteria | 788 |
| 8 | Ga0070676_10125273 | 3300005328 | Bacteria | 1618 |
| 9 | Ga0070683_100005232 | 3300005329 | Bacteria | 10799 |
| 10 | Ga0070683_100027889 | 3300005329 | Bacteria | 5097 |
| 11 | Ga0070683_101835307 | 3300005329 | Bacteria | 583 |
| 12 | Ga0070690_100093200 | 3300005330 | Bacteria | 1987 |
| 13 | Ga0070690_100809092 | 3300005330 | Bacteria | 727 |
| 14 | Ga0070670_100250268 | 3300005331 | Bacteria | 1544 |
| 15 | Ga0070670_101034480 | 3300005331 | Bacteria | 747 |
| 16 | Ga0070677_10078625 | 3300005333 | Bacteria | 1406 |
| 17 | Ga0070666_10061668 | 3300005335 | Bacteria | 2539 |
| 18 | Ga0070682_100687357 | 3300005337 | Bacteria | 819 |
| 19 | Ga0070682_101014624 | 3300005337 | Unclassified | 689 |
| 20 | Ga0068868_100113427 | 3300005338 | Bacteria | 2204 |
| 21 | Ga0070660_100388196 | 3300005339 | Unclassified | 1153 |
| 22 | Ga0070689_100466159 | 3300005340 | Bacteria | 1077 |
| 23 | Ga0070687_100083801 | 3300005343 | Bacteria | 1746 |
| 24 | Ga0070661_100162458 | 3300005344 | Bacteria | 1692 |
| 25 | Ga0070668_100850426 | 3300005347 | Bacteria | 813 |
| 26 | Ga0070669_100179318 | 3300005353 | Bacteria | 1656 |
| 27 | Ga0070669_100201042 | 3300005353 | Bacteria | 1568 |
| 28 | Ga0070669_100239876 | 3300005353 | Bacteria | 1440 |
| 29 | Ga0070669_100585555 | 3300005353 | Bacteria | 933 |
| 30 | Ga0070675_100275633 | 3300005354 | Bacteria | 1477 |
| 31 | Ga0070671_100041140 | 3300005355 | Bacteria | 3840 |
| 32 | Ga0070671_100116806 | 3300005355 | Unclassified | 2243 |
| 33 | Ga0070674_100964724 | 3300005356 | Unclassified | 746 |
| 34 | Ga0070673_100276342 | 3300005364 | Bacteria | 1472 |
| 35 | Ga0070673_102269698 | 3300005364 | Bacteria | 516 |
| 36 | Ga0070688_100966790 | 3300005365 | Bacteria | 675 |
| 37 | Ga0070659_100125476 | 3300005366 | Bacteria | 2082 |
| 38 | Ga0070659_101534688 | 3300005366 | Bacteria | 594 |
| 39 | Ga0070667_101816725 | 3300005367 | Bacteria | 574 |
| 40 | Ga0070663_100340308 | 3300005455 | Bacteria | 1212 |
| 41 | Ga0070678_100028260 | 3300005456 | Bacteria | 3822 |
| 42 | Ga0070662_100006730 | 3300005457 | Bacteria | 7429 |
| 43 | Ga0068867_100012319 | 3300005459 | Bacteria | 6049 |
| 44 | Ga0068867_100287916 | 3300005459 | Bacteria | 1350 |
| 45 | Ga0068867_100399453 | 3300005459 | Bacteria | 1159 |
| 46 | Ga0068867_101431423 | 3300005459 | Unclassified | 642 |
| 47 | Ga0068867_101957476 | 3300005459 | Bacteria | 553 |
| 48 | Ga0068867_101963346 | 3300005459 | Bacteria | 553 |
| 49 | Ga0070706_100611831 | 3300005467 | Bacteria | 1012 |
| 50 | Ga0070698_100143072 | 3300005471 | Bacteria | 2342 |
| 51 | Ga0070679_101388300 | 3300005530 | Bacteria | 648 |
| 52 | Ga0070679_101656109 | 3300005530 | Unclassified | 587 |
| 53 | Ga0070684_100052547 | 3300005535 | Bacteria | 3544 |
| 54 | Ga0068853_100168200 | 3300005539 | Bacteria | 1982 |
| 55 | Ga0068853_100492957 | 3300005539 | Bacteria | 1156 |
| 56 | Ga0068853_100549689 | 3300005539 | Bacteria | 1094 |
| 57 | Ga0068853_100701221 | 3300005539 | Bacteria | 966 |
| 58 | Ga0070686_100170829 | 3300005544 | Bacteria | 1537 |
| 59 | Ga0070686_100254412 | 3300005544 | Unclassified | 1284 |
| 60 | Ga0070693_100080096 | 3300005547 | Bacteria | 1945 |
| 61 | Ga0070664_100046128 | 3300005564 | Bacteria | 3681 |
| 62 | Ga0070664_100415753 | 3300005564 | Bacteria | 1231 |
| 63 | Ga0070664_100779269 | 3300005564 | Bacteria | 893 |
| 64 | Ga0070664_101039430 | 3300005564 | Bacteria | 770 |
| 65 | Ga0068854_100006375 | 3300005578 | Bacteria | 7505 |
| 66 | Ga0068856_100583358 | 3300005614 | Bacteria | 1139 |
| 67 | Ga0068852_100091004 | 3300005616 | Bacteria | 2729 |
| 68 | Ga0068852_100126385 | 3300005616 | Bacteria | 2349 |
| 69 | Ga0068852_100219873 | 3300005616 | Bacteria | 1806 |
| 70 | Ga0068852_101023012 | 3300005616 | Unclassified | 845 |
| 71 | Ga0068859_100179711 | 3300005617 | Bacteria | 2198 |
| 72 | Ga0068859_101128501 | 3300005617 | Bacteria | 863 |
| 73 | Ga0068864_100270880 | 3300005618 | Bacteria | 1582 |
| 74 | Ga0068861_100070159 | 3300005719 | Bacteria | 2713 |
| 75 | Ga0068861_100603176 | 3300005719 | Bacteria | 1008 |
| 76 | Ga0068851_10528341 | 3300005834 | Bacteria | 710 |
| 77 | Ga0068870_10055306 | 3300005840 | Bacteria | 2114 |
| 78 | Ga0068870_10768536 | 3300005840 | Bacteria | 670 |
| 79 | Ga0068863_100043462 | 3300005841 | Bacteria | 4265 |
| 80 | Ga0068863_102013280 | 3300005841 | Unclassified | 587 |
| 81 | Ga0068863_102175012 | 3300005841 | Bacteria | 565 |
| 82 | Ga0068858_100122338 | 3300005842 | Bacteria | 2435 |
| 83 | Ga0068860_101425165 | 3300005843 | Bacteria | 714 |
| 84 | Ga0068860_101512984 | 3300005843 | Bacteria | 693 |
| 85 | Ga0068860_101606181 | 3300005843 | Bacteria | 672 |
| 86 | Ga0075366_10073056 | 3300006195 | Bacteria | 2044 |
| 87 | Ga0097621_100177027 | 3300006237 | Bacteria | 1841 |
| 88 | Ga0097621_100264569 | 3300006237 | Bacteria | 1509 |
| 89 | Ga0097621_100935513 | 3300006237 | Bacteria | 808 |
| 90 | Ga0097621_101123236 | 3300006237 | Bacteria | 738 |
| 91 | Ga0097621_101544483 | 3300006237 | Bacteria | 630 |
| 92 | Ga0068871_100075882 | 3300006358 | Bacteria | 2776 |
| 93 | Ga0068871_100272250 | 3300006358 | Bacteria | 1479 |
| 94 | Ga0068871_100871137 | 3300006358 | Bacteria | 833 |
| 95 | Ga0075434_100601176 | 3300006871 | Bacteria | 1119 |
| 96 | Ga0068865_100372290 | 3300006881 | Bacteria | 1163 |
| 97 | Ga0075436_101388176 | 3300006914 | Bacteria | 532 |
| 98 | Ga0097620_100179712 | 3300006931 | Bacteria | 2198 |
| 99 | Ga0097620_100319915 | 3300006931 | Bacteria | 1645 |
| 100 | Ga0097620_101128578 | 3300006931 | Bacteria | 863 |
| 101 | Ga0111539_11074717 | 3300009094 | Bacteria | 935 |
| 102 | Ga0105241_10285555 | 3300009174 | Bacteria | 1411 |
| 103 | Ga0105241_10309991 | 3300009174 | Bacteria | 1357 |
| 104 | Ga0105242_10606152 | 3300009176 | Bacteria | 1058 |
| 105 | Ga0105242_10797086 | 3300009176 | Bacteria | 935 |
| 106 | Ga0105242_10817908 | 3300009176 | Bacteria | 924 |
| 107 | Ga0105237_10006944 | 3300009545 | Bacteria | 12482 |
| 108 | Ga0105237_10008622 | 3300009545 | Bacteria | 11022 |
| 109 | Ga0105237_10115373 | 3300009545 | Bacteria | 2679 |
| 110 | Ga0105249_10043521 | 3300009553 | Bacteria | 4083 |
| 111 | Ga0105249_10106408 | 3300009553 | Unclassified | 2646 |
| 112 | Ga0105249_10966056 | 3300009553 | Bacteria | 920 |
| 113 | Ga0105239_10005705 | 3300010375 | Bacteria | 14536 |
| 114 | Ga0105239_10042192 | 3300010375 | Bacteria | 4999 |
| 115 | Ga0105239_10152302 | 3300010375 | Bacteria | 2581 |
| 116 | Ga0105246_10327842 | 3300011119 | Bacteria | 1247 |
| 117 | Ga0105246_11321613 | 3300011119 | Unclassified | 669 |
| 118 | Ga0157373_10431755 | 3300013100 | Bacteria | 946 |
| 119 | Ga0157373_10566381 | 3300013100 | Unclassified | 825 |
| 120 | Ga0157371_10043864 | 3300013102 | Bacteria | 3185 |
| 121 | Ga0157371_11080606 | 3300013102 | Bacteria | 615 |
| 122 | Ga0157369_10463631 | 3300013105 | Bacteria | 1312 |
| 123 | Ga0157374_10001929 | 3300013296 | Bacteria | 17404 |
| 124 | Ga0157374_10010613 | 3300013296 | Bacteria | 7931 |
| 125 | Ga0157374_11204876 | 3300013296 | Unclassified | 778 |
| 126 | Ga0157374_11819392 | 3300013296 | Unclassified | 634 |
| 127 | Ga0157378_10756125 | 3300013297 | Unclassified | 995 |
| 128 | Ga0157378_10761780 | 3300013297 | Bacteria | 991 |
| 129 | Ga0157378_11004813 | 3300013297 | Bacteria | 869 |
| 130 | Ga0157378_11121761 | 3300013297 | Bacteria | 824 |
| 131 | Ga0157378_11164950 | 3300013297 | Bacteria | 809 |
| 132 | Ga0157378_11300607 | 3300013297 | Bacteria | 768 |
| 133 | Ga0157378_12545140 | 3300013297 | Bacteria | 564 |
| 134 | Ga0157378_13130460 | 3300013297 | Unclassified | 514 |
| 135 | Ga0163162_10024921 | 3300013306 | Bacteria | 5909 |
| 136 | Ga0163162_10317345 | 3300013306 | Bacteria | 1691 |
| 137 | Ga0163162_10925491 | 3300013306 | Bacteria | 984 |
| 138 | Ga0163162_11324500 | 3300013306 | Bacteria | 818 |
| 139 | Ga0163162_11397111 | 3300013306 | Unclassified | 796 |
| 140 | Ga0157372_10129607 | 3300013307 | Bacteria | 2901 |
| 141 | Ga0157372_10528104 | 3300013307 | Bacteria | 1376 |
| 142 | Ga0157372_10760615 | 3300013307 | Bacteria | 1126 |
| 143 | Ga0157372_10782093 | 3300013307 | Bacteria | 1109 |
| 144 | Ga0157372_10876109 | 3300013307 | Unclassified | 1042 |
| 145 | Ga0157372_10927475 | 3300013307 | Bacteria | 1010 |
| 146 | Ga0157372_11054805 | 3300013307 | Bacteria | 941 |
| 147 | Ga0157375_10026676 | 3300013308 | Bacteria | 5389 |
| 148 | Ga0157375_10529827 | 3300013308 | Bacteria | 1341 |
| 149 | Ga0157375_10690463 | 3300013308 | Bacteria | 1175 |
| 150 | Ga0157375_12341891 | 3300013308 | Bacteria | 637 |
| 151 | Ga0163163_10387012 | 3300014325 | Bacteria | 1456 |
| 152 | Ga0163163_10555121 | 3300014325 | Bacteria | 1211 |
| 153 | Ga0163163_10819591 | 3300014325 | Bacteria | 994 |
| 154 | Ga0163163_11789624 | 3300014325 | Bacteria | 675 |
| 155 | Ga0157380_10006309 | 3300014326 | Bacteria | 8331 |
| 156 | Ga0157380_10111495 | 3300014326 | Bacteria | 2300 |
| 157 | Ga0157380_11071702 | 3300014326 | Bacteria | 843 |
| 158 | Ga0157377_10862742 | 3300014745 | Bacteria | 673 |
| 159 | Ga0157379_10095285 | 3300014968 | Bacteria | 2670 |
| 160 | Ga0157376_10013253 | 3300014969 | Bacteria | 6147 |
| 161 | Ga0157376_10050189 | 3300014969 | Bacteria | 3460 |
| 162 | Ga0157376_10191278 | 3300014969 | Bacteria | 1877 |
| 163 | Ga0157376_10605723 | 3300014969 | Bacteria | 1091 |
| 164 | Ga0157376_10870156 | 3300014969 | Bacteria | 918 |
| 165 | Ga0157376_10943805 | 3300014969 | Unclassified | 883 |
| 166 | Ga0157376_12352300 | 3300014969 | Unclassified | 572 |
| 167 | Ga0163161_10006560 | 3300017792 | Bacteria | 8054 |
| 168 | Ga0163161_10100731 | 3300017792 | Unclassified | 2150 |
| 169 | Ga0163161_10248738 | 3300017792 | Bacteria | 1385 |
| 170 | Ga0213876_10006684 | 3300021384 | Bacteria | 6294 |
| 171 | Ga0207426_1000052 | 3300025302 | Bacteria | 389825 |
| 172 | Ga0207656_10266495 | 3300025321 | Bacteria | 842 |
| 173 | Ga0207682_10020674 | 3300025893 | Bacteria | 2584 |
| 174 | Ga0207642_10237547 | 3300025899 | Bacteria | 1027 |
| 175 | Ga0207680_10060307 | 3300025903 | Bacteria | 2309 |
| 176 | Ga0207647_10333038 | 3300025904 | Bacteria | 861 |
| 177 | Ga0207685_10309391 | 3300025905 | Bacteria | 784 |
| 178 | Ga0207645_10373205 | 3300025907 | Bacteria | 957 |
| 179 | Ga0207645_11083505 | 3300025907 | Unclassified | 541 |
| 180 | Ga0207643_10271770 | 3300025908 | Bacteria | 1049 |
| 181 | Ga0207705_10615294 | 3300025909 | Bacteria | 845 |
| 182 | Ga0207671_10041696 | 3300025914 | Unclassified | 3397 |
| 183 | Ga0207671_10071602 | 3300025914 | Bacteria | 2586 |
| 184 | Ga0207671_10129464 | 3300025914 | Bacteria | 1936 |
| 185 | Ga0207671_10196777 | 3300025914 | Bacteria | 1573 |
| 186 | Ga0207657_10196967 | 3300025919 | Bacteria | 1623 |
| 187 | Ga0207681_10508457 | 3300025923 | Bacteria | 987 |
| 188 | Ga0207650_11001921 | 3300025925 | Bacteria | 711 |
| 189 | Ga0207659_11324799 | 3300025926 | Bacteria | 618 |
| 190 | Ga0207644_10180739 | 3300025931 | Unclassified | 1653 |
| 191 | Ga0207644_10931585 | 3300025931 | Bacteria | 728 |
| 192 | Ga0207690_10050001 | 3300025932 | Bacteria | 2789 |
| 193 | Ga0207706_10006263 | 3300025933 | Bacteria | 11062 |
| 194 | Ga0207706_10035158 | 3300025933 | Bacteria | 4456 |
| 195 | Ga0207686_10001196 | 3300025934 | Bacteria | 15048 |
| 196 | Ga0207686_10769708 | 3300025934 | Bacteria | 770 |
| 197 | Ga0207686_10805820 | 3300025934 | Bacteria | 753 |
| 198 | Ga0207670_10003108 | 3300025936 | Bacteria | 8786 |
| 199 | Ga0207670_11296619 | 3300025936 | Bacteria | 617 |
| 200 | Ga0207669_11169180 | 3300025937 | Bacteria | 651 |
| 201 | Ga0207704_11065814 | 3300025938 | Unclassified | 686 |
| 202 | Ga0207691_10097980 | 3300025940 | Bacteria | 2620 |
| 203 | Ga0207691_11229829 | 3300025940 | Bacteria | 620 |
| 204 | Ga0207689_10020637 | 3300025942 | Bacteria | 5540 |
| 205 | Ga0207661_10094916 | 3300025944 | Bacteria | 2492 |
| 206 | Ga0207661_11430372 | 3300025944 | Bacteria | 634 |
| 207 | Ga0207679_10092815 | 3300025945 | Bacteria | 2339 |
| 208 | Ga0207679_11197415 | 3300025945 | Bacteria | 697 |
| 209 | Ga0207679_11406154 | 3300025945 | Bacteria | 640 |
| 210 | Ga0207651_11431087 | 3300025960 | Unclassified | 622 |
| 211 | Ga0207651_11699495 | 3300025960 | Bacteria | 568 |
| 212 | Ga0207712_10788553 | 3300025961 | Bacteria | 835 |
| 213 | Ga0207640_10422318 | 3300025981 | Bacteria | 1091 |
| 214 | Ga0207640_11226805 | 3300025981 | Bacteria | 667 |
| 215 | Ga0207658_11967204 | 3300025986 | Bacteria | 532 |
| 216 | Ga0207677_11286725 | 3300026023 | Unclassified | 671 |
| 217 | Ga0207703_10135859 | 3300026035 | Bacteria | 2129 |
| 218 | Ga0207639_10467256 | 3300026041 | Bacteria | 1148 |
| 219 | Ga0207639_10792763 | 3300026041 | Bacteria | 883 |
| 220 | Ga0207678_10439413 | 3300026067 | Bacteria | 1133 |
| 221 | Ga0207702_10926156 | 3300026078 | Bacteria | 864 |
| 222 | Ga0207702_12349866 | 3300026078 | Bacteria | 521 |
| 223 | Ga0207641_12238920 | 3300026088 | Unclassified | 546 |
| 224 | Ga0207648_10031485 | 3300026089 | Bacteria | 4690 |
| 225 | Ga0207648_10190654 | 3300026089 | Bacteria | 1816 |
| 226 | Ga0207648_10247401 | 3300026089 | Unclassified | 1589 |
| 227 | Ga0207676_11058552 | 3300026095 | Bacteria | 801 |
| 228 | Ga0207674_10034295 | 3300026116 | Bacteria | 5308 |
| 229 | Ga0207674_11542241 | 3300026116 | Bacteria | 633 |
| 230 | Ga0207675_100069581 | 3300026118 | Bacteria | 3290 |
| 231 | Ga0207675_101271360 | 3300026118 | Bacteria | 756 |
| 232 | Ga0207683_10025383 | 3300026121 | Bacteria | 5112 |
| 233 | Ga0207683_10504342 | 3300026121 | Bacteria | 1118 |
| 234 | Ga0207698_10070769 | 3300026142 | Bacteria | 2765 |
| 235 | Ga0268265_10074461 | 3300028380 | Bacteria | 2656 |
| 236 | Ga0268265_10402756 | 3300028380 | Bacteria | 1265 |
| 237 | Ga0268264_12438809 | 3300028381 | Bacteria | 529 |
| 238 | Ga0265324_10027097 | 3300029957 | Bacteria | 2026 |
| 239 | Ga0265316_10210762 | 3300031344 | Unclassified | 1437 |
| 240 | Ga0307408_101331596 | 3300031548 | Bacteria | 674 |
| 241 | Ga0307412_11187609 | 3300031911 | Bacteria | 683 |
| 242 | Ga0307414_10239948 | 3300032004 | Bacteria | 1500 |
| 243 | Ga0307414_10249397 | 3300032004 | Bacteria | 1475 |
| 244 | Ga0373934_0125903 | 3300035086 | Bacteria | 1043 |
| 245 | Ga0373956_0298418 | 3300035119 | Bacteria | 767 |
| 246 | Ga0395899_0000006 | 3300037312 | Bacteria | 666341 |
| 247 | Ga0395900_0182863 | 3300037418 | Bacteria | 2129 |
| 248 | Ga0436365_0464622 | 3300039437 | Bacteria | 16852 |
| 249 | Ga0436365_0855025 | 3300039437 | Bacteria | 727 |
| 250 | Ga0451798_0516910 | 3300041458 | Unclassified | 540 |
| 251 | Ga0451798_0822385 | 3300041458 | Bacteria | 931 |
| 252 | Ga0451855_0414921 | 3300041511 | Bacteria | 521 |
| 253 | Ga0439462_0215091 | 3300042015 | Unclassified | 549 |
| 254 | Ga0439444_0083866 | 3300042437 | Bacteria | 701 |
| 255 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 256 | Ga0453684_0335754 | 3300044712 | Archaea | 1708 |
| 257 | Ga0466968_0038572 | 3300044735 | Bacteria | 2008 |
| 258 | Ga0466970_0000266 | 3300044765 | Bacteria | 25589 |
| 259 | Ga0466957_0000080 | 3300044842 | Bacteria | 38661 |
| 260 | Ga0466957_0001277 | 3300044842 | Bacteria | 13121 |
| 261 | Ga0466967_1336585 | 3300045976 | Bacteria | 714 |
| 262 | Ga0495608_0035877 | 3300046511 | Bacteria | 3341 |
| 263 | Ga0495630_0062747 | 3300046517 | Bacteria | 2791 |
| 264 | Ga0495632_0421734 | 3300046519 | Bacteria | 581 |
| 265 | Ga0495652_0483138 | 3300046529 | Bacteria | 862 |
| 266 | Ga0495587_0095593 | 3300046536 | Bacteria | 1715 |
| 267 | Ga0495667_0140281 | 3300046559 | Bacteria | 1558 |
| 268 | Ga0495634_0526727 | 3300046642 | Bacteria | 691 |
| 269 | Ga0495599_0090021 | 3300046678 | Bacteria | 1915 |
| 270 | Ga0495658_0669600 | 3300046683 | Unclassified | 665 |
| 271 | Ga0495604_0149068 | 3300047317 | Bacteria | 1664 |
| 272 | Ga0495674_0272365 | 3300047319 | Bacteria | 1389 |
| 273 | Ga0495672_0004686 | 3300047320 | Bacteria | 11072 |
| 274 | Ga0495680_0110301 | 3300047322 | Bacteria | 2040 |
| 275 | Ga0495686_0009999 | 3300047472 | Bacteria | 6778 |
| 276 | Ga0501032_0204692 | 3300049569 | Bacteria | 1288 |
| 277 | Ga0501034_0027240 | 3300049571 | Bacteria | 5814 |
| 278 | Ga0501043_0167099 | 3300049579 | Bacteria | 1718 |
| 279 | Ga0501235_048332 | 3300049669 | Bacteria | 982 |
| 280 | Ga0501243_078024 | 3300049675 | Bacteria | 640 |
| 281 | Ga0501250_011893 | 3300049680 | Bacteria | 1021 |
| 282 | Ga0501253_180830 | 3300049683 | Bacteria | 548 |
| 283 | Ga0501225_0275865 | 3300049705 | Bacteria | 561 |
| 284 | Ga0501245_135557 | 3300049708 | Bacteria | 531 |
| 285 | Ga0501245_156018 | 3300049708 | Bacteria | 508 |
| 286 | Ga0501268_020320 | 3300049765 | Bacteria | 1130 |
| 287 | Ga0501274_012809 | 3300049771 | Bacteria | 799 |
| 288 | nmdc:mga0k408_44816_c1 | 3300050493 | Bacteria | 2551 |
| 289 | Ga0500583_0029857 | 3300053092 | Bacteria | 2381 |
| 290 | Ga0500642_0445124 | 3300053130 | Bacteria | 557 |
| 291 | Ga0500622_0028649 | 3300053156 | Bacteria | 2931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100005232 | Ga0070683_1000052322 | 110 |
| 2 | 3300005330 | Ga0070690_100809092 | Ga0070690_1008090922 | 110 |
| 3 | 3300005337 | Ga0070682_101014624 | Ga0070682_1010146241 | 110 |
| 4 | 3300005366 | Ga0070659_100125476 | Ga0070659_1001254763 | 110 |
| 5 | 3300005530 | Ga0070679_101656109 | Ga0070679_1016561091 | 110 |
| 6 | 3300005539 | Ga0068853_100701221 | Ga0068853_1007012212 | 110 |
| 7 | 3300006237 | Ga0097621_100177027 | Ga0097621_1001770274 | 110 |
| 8 | 3300013297 | Ga0157378_13130460 | Ga0157378_131304601 | 110 |
| 9 | 3300013307 | Ga0157372_10760615 | Ga0157372_107606152 | 110 |
| 10 | 3300025932 | Ga0207690_10050001 | Ga0207690_100500012 | 110 |
| 11 | 3300025933 | Ga0207706_10035158 | Ga0207706_100351583 | 110 |
| 12 | 3300025960 | Ga0207651_11431087 | Ga0207651_114310871 | 110 |
| 13 | 3300005355 | Ga0070671_100041140 | Ga0070671_1000411403 | 124 |
| 14 | 3300005333 | Ga0070677_10078625 | Ga0070677_100786252 | 125 |
| 15 | 3300042015 | Ga0439462_0215091 | Ga0439462_0215091_45_422 | 125 |
| 16 | 3300005293 | Ga0065715_10438140 | Ga0065715_104381402 | 128 |
| 17 | 3300005329 | Ga0070683_101835307 | Ga0070683_1018353071 | 128 |
| 18 | 3300005347 | Ga0070668_100850426 | Ga0070668_1008504262 | 128 |
| 19 | 3300005353 | Ga0070669_100239876 | Ga0070669_1002398762 | 128 |
| 20 | 3300005356 | Ga0070674_100964724 | Ga0070674_1009647241 | 128 |
| 21 | 3300005455 | Ga0070663_100340308 | Ga0070663_1003403082 | 128 |
| 22 | 3300005459 | Ga0068867_101957476 | Ga0068867_1019574761 | 128 |
| 23 | 3300005459 | Ga0068867_101963346 | Ga0068867_1019633461 | 128 |
| 24 | 3300005467 | Ga0070706_100611831 | Ga0070706_1006118311 | 128 |
| 25 | 3300005539 | Ga0068853_100549689 | Ga0068853_1005496892 | 128 |
| 26 | 3300005544 | Ga0070686_100254412 | Ga0070686_1002544123 | 128 |
| 27 | 3300005617 | Ga0068859_100179711 | Ga0068859_1001797112 | 128 |
| 28 | 3300005617 | Ga0068859_101128501 | Ga0068859_1011285012 | 128 |
| 29 | 3300005840 | Ga0068870_10768536 | Ga0068870_107685362 | 128 |
| 30 | 3300005841 | Ga0068863_102013280 | Ga0068863_1020132801 | 128 |
| 31 | 3300005843 | Ga0068860_101606181 | Ga0068860_1016061811 | 128 |
| 32 | 3300006237 | Ga0097621_100264569 | Ga0097621_1002645692 | 128 |
| 33 | 3300006358 | Ga0068871_100075882 | Ga0068871_1000758825 | 128 |
| 34 | 3300006881 | Ga0068865_100372290 | Ga0068865_1003722902 | 128 |
| 35 | 3300006931 | Ga0097620_100179712 | Ga0097620_1001797122 | 128 |
| 36 | 3300006931 | Ga0097620_101128578 | Ga0097620_1011285782 | 128 |
| 37 | 3300009176 | Ga0105242_10797086 | Ga0105242_107970862 | 128 |
| 38 | 3300009553 | Ga0105249_10043521 | Ga0105249_100435213 | 128 |
| 39 | 3300011119 | Ga0105246_11321613 | Ga0105246_113216132 | 128 |
| 40 | 3300013297 | Ga0157378_11004813 | Ga0157378_110048131 | 128 |
| 41 | 3300013306 | Ga0163162_10317345 | Ga0163162_103173453 | 128 |
| 42 | 3300013306 | Ga0163162_10925491 | Ga0163162_109254911 | 128 |
| 43 | 3300013308 | Ga0157375_12341891 | Ga0157375_123418911 | 128 |
| 44 | 3300014325 | Ga0163163_11789624 | Ga0163163_117896242 | 128 |
| 45 | 3300014326 | Ga0157380_11071702 | Ga0157380_110717022 | 128 |
| 46 | 3300014969 | Ga0157376_10050189 | Ga0157376_100501893 | 128 |
| 47 | 3300017792 | Ga0163161_10248738 | Ga0163161_102487382 | 128 |
| 48 | 3300025893 | Ga0207682_10020674 | Ga0207682_100206743 | 128 |
| 49 | 3300025923 | Ga0207681_10508457 | Ga0207681_105084572 | 128 |
| 50 | 3300025934 | Ga0207686_10001196 | Ga0207686_1000119619 | 128 |
| 51 | 3300025936 | Ga0207670_10003108 | Ga0207670_100031083 | 128 |
| 52 | 3300025940 | Ga0207691_11229829 | Ga0207691_112298292 | 128 |
| 53 | 3300025961 | Ga0207712_10788553 | Ga0207712_107885532 | 128 |
| 54 | 3300026078 | Ga0207702_12349866 | Ga0207702_123498661 | 128 |
| 55 | 3300026088 | Ga0207641_12238920 | Ga0207641_122389202 | 128 |
| 56 | 3300026089 | Ga0207648_10031485 | Ga0207648_100314854 | 128 |
| 57 | 3300026118 | Ga0207675_100069581 | Ga0207675_1000695813 | 128 |
| 58 | 3300026121 | Ga0207683_10504342 | Ga0207683_105043422 | 128 |
| 59 | 3300028380 | Ga0268265_10074461 | Ga0268265_100744613 | 128 |
| 60 | 3300039437 | Ga0436365_0855025 | Ga0436365_0855025_19_411 | 128 |
| 61 | 3300041458 | Ga0451798_0822385 | Ga0451798_0822385_327_719 | 128 |
| 62 | 3300041511 | Ga0451855_0414921 | Ga0451855_0414921_91_480 | 128 |
| 63 | 3300047472 | Ga0495686_0009999 | Ga0495686_0009999_5460_5849 | 128 |
| 64 | 3300005343 | Ga0070687_100083801 | Ga0070687_1000838012 | 129 |
| 65 | 3300005353 | Ga0070669_100201042 | Ga0070669_1002010423 | 129 |
| 66 | 3300005366 | Ga0070659_101534688 | Ga0070659_1015346881 | 129 |
| 67 | 3300005367 | Ga0070667_101816725 | Ga0070667_1018167251 | 129 |
| 68 | 3300005719 | Ga0068861_100070159 | Ga0068861_1000701592 | 129 |
| 69 | 3300006237 | Ga0097621_101123236 | Ga0097621_1011232361 | 129 |
| 70 | 3300009174 | Ga0105241_10309991 | Ga0105241_103099911 | 129 |
| 71 | 3300009545 | Ga0105237_10008622 | Ga0105237_100086222 | 129 |
| 72 | 3300009545 | Ga0105237_10115373 | Ga0105237_101153731 | 129 |
| 73 | 3300009553 | Ga0105249_10966056 | Ga0105249_109660562 | 129 |
| 74 | 3300010375 | Ga0105239_10005705 | Ga0105239_1000570513 | 129 |
| 75 | 3300013102 | Ga0157371_11080606 | Ga0157371_110806062 | 129 |
| 76 | 3300025904 | Ga0207647_10333038 | Ga0207647_103330382 | 129 |
| 77 | 3300025914 | Ga0207671_10071602 | Ga0207671_100716024 | 129 |
| 78 | 3300025914 | Ga0207671_10196777 | Ga0207671_101967773 | 129 |
| 79 | 3300028380 | Ga0268265_10402756 | Ga0268265_104027563 | 129 |
| 80 | 3300028381 | Ga0268264_12438809 | Ga0268264_124388091 | 129 |
| 81 | 3300031911 | Ga0307412_11187609 | Ga0307412_111876092 | 129 |
| 82 | 3300003316 | rootH1_10097423 | rootH1_100974233 | 130 |
| 83 | 3300005459 | Ga0068867_100012319 | Ga0068867_1000123191 | 130 |
| 84 | 3300005544 | Ga0070686_100170829 | Ga0070686_1001708291 | 130 |
| 85 | 3300005578 | Ga0068854_100006375 | Ga0068854_1000063756 | 130 |
| 86 | 3300005616 | Ga0068852_100219873 | Ga0068852_1002198732 | 130 |
| 87 | 3300006237 | Ga0097621_100935513 | Ga0097621_1009355132 | 130 |
| 88 | 3300006358 | Ga0068871_100871137 | Ga0068871_1008711372 | 130 |
| 89 | 3300009176 | Ga0105242_10817908 | Ga0105242_108179081 | 130 |
| 90 | 3300013296 | Ga0157374_11204876 | Ga0157374_112048762 | 130 |
| 91 | 3300013297 | Ga0157378_10761780 | Ga0157378_107617802 | 130 |
| 92 | 3300013297 | Ga0157378_11300607 | Ga0157378_113006072 | 130 |
| 93 | 3300013306 | Ga0163162_11324500 | Ga0163162_113245002 | 130 |
| 94 | 3300013306 | Ga0163162_11397111 | Ga0163162_113971112 | 130 |
| 95 | 3300013307 | Ga0157372_10528104 | Ga0157372_105281041 | 130 |
| 96 | 3300013307 | Ga0157372_10782093 | Ga0157372_107820932 | 130 |
| 97 | 3300014969 | Ga0157376_10605723 | Ga0157376_106057232 | 130 |
| 98 | 3300014969 | Ga0157376_10943805 | Ga0157376_109438052 | 130 |
| 99 | 3300025907 | Ga0207645_11083505 | Ga0207645_110835051 | 130 |
| 100 | 3300025914 | Ga0207671_10129464 | Ga0207671_101294643 | 130 |
| 101 | 3300025931 | Ga0207644_10931585 | Ga0207644_109315851 | 130 |
| 102 | 3300025934 | Ga0207686_10769708 | Ga0207686_107697082 | 130 |
| 103 | 3300025938 | Ga0207704_11065814 | Ga0207704_110658142 | 130 |
| 104 | 3300025981 | Ga0207640_10422318 | Ga0207640_104223182 | 130 |
| 105 | 3300026023 | Ga0207677_11286725 | Ga0207677_112867251 | 130 |
| 106 | 3300026116 | Ga0207674_10034295 | Ga0207674_100342952 | 130 |
| 107 | 3300029957 | Ga0265324_10027097 | Ga0265324_100270972 | 130 |
| 108 | 3300031344 | Ga0265316_10210762 | Ga0265316_102107622 | 130 |
| 109 | 3300032004 | Ga0307414_10239948 | Ga0307414_102399482 | 130 |
| 110 | 3300032004 | Ga0307414_10249397 | Ga0307414_102493972 | 130 |
| 111 | 3300035086 | Ga0373934_0125903 | Ga0373934_0125903_352_750 | 130 |
| 112 | 3300035119 | Ga0373956_0298418 | Ga0373956_0298418_198_596 | 130 |
| 113 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_196385_196783 | 130 |
| 114 | 3300044765 | Ga0466970_0000266 | Ga0466970_0000266_10492_10890 | 130 |
| 115 | 3300046511 | Ga0495608_0035877 | Ga0495608_0035877_2374_2772 | 130 |
| 116 | 3300046517 | Ga0495630_0062747 | Ga0495630_0062747_10_408 | 130 |
| 117 | 3300046529 | Ga0495652_0483138 | Ga0495652_0483138_338_736 | 130 |
| 118 | 3300046536 | Ga0495587_0095593 | Ga0495587_0095593_1048_1446 | 130 |
| 119 | 3300046559 | Ga0495667_0140281 | Ga0495667_0140281_740_1138 | 130 |
| 120 | 3300046642 | Ga0495634_0526727 | Ga0495634_0526727_128_526 | 130 |
| 121 | 3300046678 | Ga0495599_0090021 | Ga0495599_0090021_740_1138 | 130 |
| 122 | 3300047317 | Ga0495604_0149068 | Ga0495604_0149068_657_1055 | 130 |
| 123 | 3300047319 | Ga0495674_0272365 | Ga0495674_0272365_740_1138 | 130 |
| 124 | 3300047320 | Ga0495672_0004686 | Ga0495672_0004686_7346_7750 | 130 |
| 125 | 3300047322 | Ga0495680_0110301 | Ga0495680_0110301_1325_1723 | 130 |
| 126 | 3300049669 | Ga0501235_048332 | Ga0501235_048332_101_499 | 130 |
| 127 | 3300049675 | Ga0501243_078024 | Ga0501243_078024_126_524 | 130 |
| 128 | 3300049680 | Ga0501250_011893 | Ga0501250_011893_410_808 | 130 |
| 129 | 3300049683 | Ga0501253_180830 | Ga0501253_180830_16_414 | 130 |
| 130 | 3300049705 | Ga0501225_0275865 | Ga0501225_0275865_76_474 | 130 |
| 131 | 3300049708 | Ga0501245_135557 | Ga0501245_135557_49_447 | 130 |
| 132 | 3300049708 | Ga0501245_156018 | Ga0501245_156018_88_486 | 130 |
| 133 | 3300049765 | Ga0501268_020320 | Ga0501268_020320_677_1075 | 130 |
| 134 | 3300049771 | Ga0501274_012809 | Ga0501274_012809_95_493 | 130 |
| 135 | 3300005355 | Ga0070671_100116806 | Ga0070671_1001168063 | 131 |
| 136 | 3300013297 | Ga0157378_10756125 | Ga0157378_107561251 | 131 |
| 137 | 3300013307 | Ga0157372_10876109 | Ga0157372_108761092 | 131 |
| 138 | 3300013307 | Ga0157372_11054805 | Ga0157372_110548052 | 131 |
| 139 | 3300025931 | Ga0207644_10180739 | Ga0207644_101807392 | 131 |
| 140 | 3300037312 | Ga0395899_0000006 | Ga0395899_0000006_30973_31374 | 131 |
| 141 | 3300037418 | Ga0395900_0182863 | Ga0395900_0182863_958_1359 | 131 |
| 142 | 3300044842 | Ga0466957_0000080 | Ga0466957_0000080_23573_23974 | 131 |
| 143 | 3300044842 | Ga0466957_0001277 | Ga0466957_0001277_5719_6138 | 131 |
| 144 | 3300046519 | Ga0495632_0421734 | Ga0495632_0421734_135_536 | 131 |
| 145 | 3300049571 | Ga0501034_0027240 | Ga0501034_0027240_1695_2096 | 131 |
| 146 | 3300005328 | Ga0070676_10125273 | Ga0070676_101252732 | 132 |
| 147 | 3300005330 | Ga0070690_100093200 | Ga0070690_1000932002 | 132 |
| 148 | 3300005335 | Ga0070666_10061668 | Ga0070666_100616683 | 132 |
| 149 | 3300005340 | Ga0070689_100466159 | Ga0070689_1004661592 | 132 |
| 150 | 3300005344 | Ga0070661_100162458 | Ga0070661_1001624581 | 132 |
| 151 | 3300005353 | Ga0070669_100179318 | Ga0070669_1001793182 | 132 |
| 152 | 3300005353 | Ga0070669_100585555 | Ga0070669_1005855552 | 132 |
| 153 | 3300005354 | Ga0070675_100275633 | Ga0070675_1002756333 | 132 |
| 154 | 3300005364 | Ga0070673_102269698 | Ga0070673_1022696981 | 132 |
| 155 | 3300005365 | Ga0070688_100966790 | Ga0070688_1009667901 | 132 |
| 156 | 3300005456 | Ga0070678_100028260 | Ga0070678_1000282603 | 132 |
| 157 | 3300005457 | Ga0070662_100006730 | Ga0070662_1000067308 | 132 |
| 158 | 3300005459 | Ga0068867_100287916 | Ga0068867_1002879162 | 132 |
| 159 | 3300005459 | Ga0068867_100399453 | Ga0068867_1003994531 | 132 |
| 160 | 3300005471 | Ga0070698_100143072 | Ga0070698_1001430722 | 132 |
| 161 | 3300005547 | Ga0070693_100080096 | Ga0070693_1000800962 | 132 |
| 162 | 3300005564 | Ga0070664_100046128 | Ga0070664_1000461283 | 132 |
| 163 | 3300005564 | Ga0070664_100779269 | Ga0070664_1007792692 | 132 |
| 164 | 3300005614 | Ga0068856_100583358 | Ga0068856_1005833582 | 132 |
| 165 | 3300005616 | Ga0068852_100126385 | Ga0068852_1001263853 | 132 |
| 166 | 3300005618 | Ga0068864_100270880 | Ga0068864_1002708802 | 132 |
| 167 | 3300005719 | Ga0068861_100603176 | Ga0068861_1006031762 | 132 |
| 168 | 3300005840 | Ga0068870_10055306 | Ga0068870_100553062 | 132 |
| 169 | 3300005841 | Ga0068863_100043462 | Ga0068863_1000434626 | 132 |
| 170 | 3300005841 | Ga0068863_102175012 | Ga0068863_1021750122 | 132 |
| 171 | 3300005842 | Ga0068858_100122338 | Ga0068858_1001223382 | 132 |
| 172 | 3300005843 | Ga0068860_101425165 | Ga0068860_1014251651 | 132 |
| 173 | 3300005843 | Ga0068860_101512984 | Ga0068860_1015129841 | 132 |
| 174 | 3300006195 | Ga0075366_10073056 | Ga0075366_100730562 | 132 |
| 175 | 3300006237 | Ga0097621_101544483 | Ga0097621_1015444831 | 132 |
| 176 | 3300006358 | Ga0068871_100272250 | Ga0068871_1002722502 | 132 |
| 177 | 3300006871 | Ga0075434_100601176 | Ga0075434_1006011762 | 132 |
| 178 | 3300006914 | Ga0075436_101388176 | Ga0075436_1013881762 | 132 |
| 179 | 3300006931 | Ga0097620_100319915 | Ga0097620_1003199152 | 132 |
| 180 | 3300009094 | Ga0111539_11074717 | Ga0111539_110747172 | 132 |
| 181 | 3300009174 | Ga0105241_10285555 | Ga0105241_102855552 | 132 |
| 182 | 3300009176 | Ga0105242_10606152 | Ga0105242_106061522 | 132 |
| 183 | 3300009553 | Ga0105249_10106408 | Ga0105249_101064083 | 132 |
| 184 | 3300010375 | Ga0105239_10152302 | Ga0105239_101523022 | 132 |
| 185 | 3300011119 | Ga0105246_10327842 | Ga0105246_103278422 | 132 |
| 186 | 3300013100 | Ga0157373_10431755 | Ga0157373_104317551 | 132 |
| 187 | 3300013102 | Ga0157371_10043864 | Ga0157371_100438643 | 132 |
| 188 | 3300013105 | Ga0157369_10463631 | Ga0157369_104636311 | 132 |
| 189 | 3300013296 | Ga0157374_10001929 | Ga0157374_100019298 | 132 |
| 190 | 3300013296 | Ga0157374_11819392 | Ga0157374_118193922 | 132 |
| 191 | 3300013297 | Ga0157378_11121761 | Ga0157378_111217611 | 132 |
| 192 | 3300013297 | Ga0157378_11164950 | Ga0157378_111649502 | 132 |
| 193 | 3300013297 | Ga0157378_12545140 | Ga0157378_125451402 | 132 |
| 194 | 3300013306 | Ga0163162_10024921 | Ga0163162_100249212 | 132 |
| 195 | 3300013307 | Ga0157372_10927475 | Ga0157372_109274752 | 132 |
| 196 | 3300013308 | Ga0157375_10026676 | Ga0157375_100266762 | 132 |
| 197 | 3300013308 | Ga0157375_10529827 | Ga0157375_105298272 | 132 |
| 198 | 3300014325 | Ga0163163_10387012 | Ga0163163_103870123 | 132 |
| 199 | 3300014325 | Ga0163163_10819591 | Ga0163163_108195912 | 132 |
| 200 | 3300014326 | Ga0157380_10111495 | Ga0157380_101114952 | 132 |
| 201 | 3300014745 | Ga0157377_10862742 | Ga0157377_108627422 | 132 |
| 202 | 3300014968 | Ga0157379_10095285 | Ga0157379_100952853 | 132 |
| 203 | 3300014969 | Ga0157376_10191278 | Ga0157376_101912783 | 132 |
| 204 | 3300017792 | Ga0163161_10006560 | Ga0163161_100065602 | 132 |
| 205 | 3300025899 | Ga0207642_10237547 | Ga0207642_102375472 | 132 |
| 206 | 3300025903 | Ga0207680_10060307 | Ga0207680_100603073 | 132 |
| 207 | 3300025905 | Ga0207685_10309391 | Ga0207685_103093912 | 132 |
| 208 | 3300025907 | Ga0207645_10373205 | Ga0207645_103732052 | 132 |
| 209 | 3300025908 | Ga0207643_10271770 | Ga0207643_102717702 | 132 |
| 210 | 3300025933 | Ga0207706_10006263 | Ga0207706_100062637 | 132 |
| 211 | 3300025934 | Ga0207686_10805820 | Ga0207686_108058202 | 132 |
| 212 | 3300025936 | Ga0207670_11296619 | Ga0207670_112966191 | 132 |
| 213 | 3300025942 | Ga0207689_10020637 | Ga0207689_100206374 | 132 |
| 214 | 3300025944 | Ga0207661_11430372 | Ga0207661_114303722 | 132 |
| 215 | 3300025945 | Ga0207679_10092815 | Ga0207679_100928153 | 132 |
| 216 | 3300025960 | Ga0207651_11699495 | Ga0207651_116994951 | 132 |
| 217 | 3300025981 | Ga0207640_11226805 | Ga0207640_112268051 | 132 |
| 218 | 3300026035 | Ga0207703_10135859 | Ga0207703_101358593 | 132 |
| 219 | 3300026067 | Ga0207678_10439413 | Ga0207678_104394132 | 132 |
| 220 | 3300026078 | Ga0207702_10926156 | Ga0207702_109261562 | 132 |
| 221 | 3300026089 | Ga0207648_10190654 | Ga0207648_101906543 | 132 |
| 222 | 3300026089 | Ga0207648_10247401 | Ga0207648_102474012 | 132 |
| 223 | 3300026116 | Ga0207674_11542241 | Ga0207674_115422412 | 132 |
| 224 | 3300026118 | Ga0207675_101271360 | Ga0207675_1012713602 | 132 |
| 225 | 3300026121 | Ga0207683_10025383 | Ga0207683_100253833 | 132 |
| 226 | 3300044712 | Ga0453684_0335754 | Ga0453684_0335754_315_719 | 132 |
| 227 | 3300044735 | Ga0466968_0038572 | Ga0466968_0038572_482_937 | 132 |
| 228 | 3300045976 | Ga0466967_1336585 | Ga0466967_1336585_78_482 | 132 |
| 229 | 3300046683 | Ga0495658_0669600 | Ga0495658_0669600_188_592 | 132 |
| 230 | 3300049569 | Ga0501032_0204692 | Ga0501032_0204692_838_1251 | 132 |
| 231 | 3300049579 | Ga0501043_0167099 | Ga0501043_0167099_81_494 | 132 |
| 232 | 3300050493 | nmdc:mga0k408_44816_c1 | nmdc:mga0k408_44816_c1_674_1078 | 132 |
| 233 | 3300053092 | Ga0500583_0029857 | Ga0500583_0029857_265_669 | 132 |
| 234 | 3300053130 | Ga0500642_0445124 | Ga0500642_0445124_73_477 | 132 |
| 235 | 3300053156 | Ga0500622_0028649 | Ga0500622_0028649_1043_1447 | 132 |
| 236 | 3300001979 | JGI24740J21852_10028485 | JGI24740J21852_100284852 | 133 |
| 237 | 3300003322 | rootL2_10043714 | rootL2_100437142 | 133 |
| 238 | 3300003322 | rootL2_10296321 | rootL2_102963211 | 133 |
| 239 | 3300003323 | rootH1_10139114 | rootH1_101391142 | 133 |
| 240 | 3300003354 | JGI25160J50197_1000239 | JGI25160J50197_10002397 | 133 |
| 241 | 3300005329 | Ga0070683_100027889 | Ga0070683_1000278895 | 133 |
| 242 | 3300005331 | Ga0070670_100250268 | Ga0070670_1002502682 | 133 |
| 243 | 3300005331 | Ga0070670_101034480 | Ga0070670_1010344802 | 133 |
| 244 | 3300005337 | Ga0070682_100687357 | Ga0070682_1006873571 | 133 |
| 245 | 3300005338 | Ga0068868_100113427 | Ga0068868_1001134272 | 133 |
| 246 | 3300005339 | Ga0070660_100388196 | Ga0070660_1003881962 | 133 |
| 247 | 3300005364 | Ga0070673_100276342 | Ga0070673_1002763422 | 133 |
| 248 | 3300005459 | Ga0068867_101431423 | Ga0068867_1014314232 | 133 |
| 249 | 3300005530 | Ga0070679_101388300 | Ga0070679_1013883002 | 133 |
| 250 | 3300005535 | Ga0070684_100052547 | Ga0070684_1000525474 | 133 |
| 251 | 3300005539 | Ga0068853_100168200 | Ga0068853_1001682002 | 133 |
| 252 | 3300005539 | Ga0068853_100492957 | Ga0068853_1004929572 | 133 |
| 253 | 3300005564 | Ga0070664_100415753 | Ga0070664_1004157532 | 133 |
| 254 | 3300005564 | Ga0070664_101039430 | Ga0070664_1010394302 | 133 |
| 255 | 3300005616 | Ga0068852_100091004 | Ga0068852_1000910042 | 133 |
| 256 | 3300005616 | Ga0068852_101023012 | Ga0068852_1010230122 | 133 |
| 257 | 3300005834 | Ga0068851_10528341 | Ga0068851_105283412 | 133 |
| 258 | 3300009545 | Ga0105237_10006944 | Ga0105237_100069447 | 133 |
| 259 | 3300010375 | Ga0105239_10042192 | Ga0105239_100421922 | 133 |
| 260 | 3300013100 | Ga0157373_10566381 | Ga0157373_105663812 | 133 |
| 261 | 3300013296 | Ga0157374_10010613 | Ga0157374_100106133 | 133 |
| 262 | 3300013307 | Ga0157372_10129607 | Ga0157372_101296073 | 133 |
| 263 | 3300013308 | Ga0157375_10690463 | Ga0157375_106904632 | 133 |
| 264 | 3300014325 | Ga0163163_10555121 | Ga0163163_105551211 | 133 |
| 265 | 3300014326 | Ga0157380_10006309 | Ga0157380_100063093 | 133 |
| 266 | 3300014969 | Ga0157376_10013253 | Ga0157376_100132536 | 133 |
| 267 | 3300014969 | Ga0157376_10870156 | Ga0157376_108701562 | 133 |
| 268 | 3300014969 | Ga0157376_12352300 | Ga0157376_123523001 | 133 |
| 269 | 3300017792 | Ga0163161_10100731 | Ga0163161_101007313 | 133 |
| 270 | 3300021384 | Ga0213876_10006684 | Ga0213876_100066844 | 133 |
| 271 | 3300025302 | Ga0207426_1000052 | Ga0207426_1000052307 | 133 |
| 272 | 3300025321 | Ga0207656_10266495 | Ga0207656_102664952 | 133 |
| 273 | 3300025909 | Ga0207705_10615294 | Ga0207705_106152942 | 133 |
| 274 | 3300025914 | Ga0207671_10041696 | Ga0207671_100416962 | 133 |
| 275 | 3300025919 | Ga0207657_10196967 | Ga0207657_101969672 | 133 |
| 276 | 3300025925 | Ga0207650_11001921 | Ga0207650_110019212 | 133 |
| 277 | 3300025926 | Ga0207659_11324799 | Ga0207659_113247991 | 133 |
| 278 | 3300025937 | Ga0207669_11169180 | Ga0207669_111691801 | 133 |
| 279 | 3300025940 | Ga0207691_10097980 | Ga0207691_100979802 | 133 |
| 280 | 3300025944 | Ga0207661_10094916 | Ga0207661_100949162 | 133 |
| 281 | 3300025945 | Ga0207679_11197415 | Ga0207679_111974151 | 133 |
| 282 | 3300025945 | Ga0207679_11406154 | Ga0207679_114061542 | 133 |
| 283 | 3300025986 | Ga0207658_11967204 | Ga0207658_119672041 | 133 |
| 284 | 3300026041 | Ga0207639_10467256 | Ga0207639_104672561 | 133 |
| 285 | 3300026041 | Ga0207639_10792763 | Ga0207639_107927632 | 133 |
| 286 | 3300026095 | Ga0207676_11058552 | Ga0207676_110585522 | 133 |
| 287 | 3300026142 | Ga0207698_10070769 | Ga0207698_100707692 | 133 |
| 288 | 3300031548 | Ga0307408_101331596 | Ga0307408_1013315962 | 133 |
| 289 | 3300039437 | Ga0436365_0464622 | Ga0436365_0464622_5669_6148 | 133 |
| 290 | 3300041458 | Ga0451798_0516910 | Ga0451798_0516910_85_495 | 133 |
| 291 | 3300042437 | Ga0439444_0083866 | Ga0439444_0083866_102_509 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vme-assembly2.cif.gz_F | human escrt-i heterotetramer headpiece | 0.931 | 62 | 119 |
| 2gsc-assembly1.cif.gz_C | crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris | 0.9271 | 7 | 117 |
| 6vme-assembly4.cif.gz_H | human escrt-i heterotetramer headpiece | 0.9263 | 62 | 119 |
| 2rld-assembly1.cif.gz_E | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.9188 | 11 | 115 |
| 2f66-assembly3.cif.gz_D | structure of the escrt-i endosomal trafficking complex | 0.9188 | 66 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LHR2_116_185_1.10.287.660 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.964 | 64 | 115 | 1.10.287.660 |
| 2f66A00 | Special;Helix non-globular;Helix Hairpins; | 0.9532 | 66 | 120 | 6.10.140.820 |
| 2gscA00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9397 | 5 | 121 | 1.20.1440.60 |
| 2gscA00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9318 | 5 | 121 | 1.20.1440.60 |
| 2gscC00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9271 | 7 | 117 | 1.20.1440.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3C7C5-F1-model_v4 | Four helix bundle protein | 0.9829 | 3 | 119 |
|
| AF-A0A6J4XZ65-F1-model_v4 | Four helix bundle protein | 0.9825 | 3 | 121 |
|
| AF-A0A0G0J5T1-F1-model_v4 | S23 ribosomal protein | 0.9815 | 1 | 119 |
GO:0005840
|
| AF-A0A3N5JT07-F1-model_v4 | Four helix bundle protein | 0.9807 | 3 | 119 |
|
| AF-A0A2M8GCJ0-F1-model_v4 | Four helix bundle protein | 0.9801 | 3 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar