F390363

General Info

Members Datasets Scaffolds Average Seq Length
291 172 291 133

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10006684|Ga0213876_100066844
Length 159
Sequence MGSKVSLFQSLNVSMFMATLKRFEDILSWQKARVLNDKIGSLIDNGNFKSNYRLINQIEGSAGSIMDNIAEGFERSGNKEFVQFLYISKGSCGELRSQLYRAIDRKYLNQKQFDDFYNSVLEISVLIQKLINYLCESELKGTKYKTKQVAYKTSETLKH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
164 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 0.69
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10028485 3300001979 Bacteria 1845
2 rootH1_10097423 3300003316 Bacteria 1972
3 rootL2_10043714 3300003322 Unclassified 2265
4 rootL2_10296321 3300003322 Unclassified 1238
5 rootH1_10139114 3300003323 Bacteria 1467
6 JGI25160J50197_1000239 3300003354 Bacteria 42596
7 Ga0065715_10438140 3300005293 Bacteria 788
8 Ga0070676_10125273 3300005328 Bacteria 1618
9 Ga0070683_100005232 3300005329 Bacteria 10799
10 Ga0070683_100027889 3300005329 Bacteria 5097
11 Ga0070683_101835307 3300005329 Bacteria 583
12 Ga0070690_100093200 3300005330 Bacteria 1987
13 Ga0070690_100809092 3300005330 Bacteria 727
14 Ga0070670_100250268 3300005331 Bacteria 1544
15 Ga0070670_101034480 3300005331 Bacteria 747
16 Ga0070677_10078625 3300005333 Bacteria 1406
17 Ga0070666_10061668 3300005335 Bacteria 2539
18 Ga0070682_100687357 3300005337 Bacteria 819
19 Ga0070682_101014624 3300005337 Unclassified 689
20 Ga0068868_100113427 3300005338 Bacteria 2204
21 Ga0070660_100388196 3300005339 Unclassified 1153
22 Ga0070689_100466159 3300005340 Bacteria 1077
23 Ga0070687_100083801 3300005343 Bacteria 1746
24 Ga0070661_100162458 3300005344 Bacteria 1692
25 Ga0070668_100850426 3300005347 Bacteria 813
26 Ga0070669_100179318 3300005353 Bacteria 1656
27 Ga0070669_100201042 3300005353 Bacteria 1568
28 Ga0070669_100239876 3300005353 Bacteria 1440
29 Ga0070669_100585555 3300005353 Bacteria 933
30 Ga0070675_100275633 3300005354 Bacteria 1477
31 Ga0070671_100041140 3300005355 Bacteria 3840
32 Ga0070671_100116806 3300005355 Unclassified 2243
33 Ga0070674_100964724 3300005356 Unclassified 746
34 Ga0070673_100276342 3300005364 Bacteria 1472
35 Ga0070673_102269698 3300005364 Bacteria 516
36 Ga0070688_100966790 3300005365 Bacteria 675
37 Ga0070659_100125476 3300005366 Bacteria 2082
38 Ga0070659_101534688 3300005366 Bacteria 594
39 Ga0070667_101816725 3300005367 Bacteria 574
40 Ga0070663_100340308 3300005455 Bacteria 1212
41 Ga0070678_100028260 3300005456 Bacteria 3822
42 Ga0070662_100006730 3300005457 Bacteria 7429
43 Ga0068867_100012319 3300005459 Bacteria 6049
44 Ga0068867_100287916 3300005459 Bacteria 1350
45 Ga0068867_100399453 3300005459 Bacteria 1159
46 Ga0068867_101431423 3300005459 Unclassified 642
47 Ga0068867_101957476 3300005459 Bacteria 553
48 Ga0068867_101963346 3300005459 Bacteria 553
49 Ga0070706_100611831 3300005467 Bacteria 1012
50 Ga0070698_100143072 3300005471 Bacteria 2342
51 Ga0070679_101388300 3300005530 Bacteria 648
52 Ga0070679_101656109 3300005530 Unclassified 587
53 Ga0070684_100052547 3300005535 Bacteria 3544
54 Ga0068853_100168200 3300005539 Bacteria 1982
55 Ga0068853_100492957 3300005539 Bacteria 1156
56 Ga0068853_100549689 3300005539 Bacteria 1094
57 Ga0068853_100701221 3300005539 Bacteria 966
58 Ga0070686_100170829 3300005544 Bacteria 1537
59 Ga0070686_100254412 3300005544 Unclassified 1284
60 Ga0070693_100080096 3300005547 Bacteria 1945
61 Ga0070664_100046128 3300005564 Bacteria 3681
62 Ga0070664_100415753 3300005564 Bacteria 1231
63 Ga0070664_100779269 3300005564 Bacteria 893
64 Ga0070664_101039430 3300005564 Bacteria 770
65 Ga0068854_100006375 3300005578 Bacteria 7505
66 Ga0068856_100583358 3300005614 Bacteria 1139
67 Ga0068852_100091004 3300005616 Bacteria 2729
68 Ga0068852_100126385 3300005616 Bacteria 2349
69 Ga0068852_100219873 3300005616 Bacteria 1806
70 Ga0068852_101023012 3300005616 Unclassified 845
71 Ga0068859_100179711 3300005617 Bacteria 2198
72 Ga0068859_101128501 3300005617 Bacteria 863
73 Ga0068864_100270880 3300005618 Bacteria 1582
74 Ga0068861_100070159 3300005719 Bacteria 2713
75 Ga0068861_100603176 3300005719 Bacteria 1008
76 Ga0068851_10528341 3300005834 Bacteria 710
77 Ga0068870_10055306 3300005840 Bacteria 2114
78 Ga0068870_10768536 3300005840 Bacteria 670
79 Ga0068863_100043462 3300005841 Bacteria 4265
80 Ga0068863_102013280 3300005841 Unclassified 587
81 Ga0068863_102175012 3300005841 Bacteria 565
82 Ga0068858_100122338 3300005842 Bacteria 2435
83 Ga0068860_101425165 3300005843 Bacteria 714
84 Ga0068860_101512984 3300005843 Bacteria 693
85 Ga0068860_101606181 3300005843 Bacteria 672
86 Ga0075366_10073056 3300006195 Bacteria 2044
87 Ga0097621_100177027 3300006237 Bacteria 1841
88 Ga0097621_100264569 3300006237 Bacteria 1509
89 Ga0097621_100935513 3300006237 Bacteria 808
90 Ga0097621_101123236 3300006237 Bacteria 738
91 Ga0097621_101544483 3300006237 Bacteria 630
92 Ga0068871_100075882 3300006358 Bacteria 2776
93 Ga0068871_100272250 3300006358 Bacteria 1479
94 Ga0068871_100871137 3300006358 Bacteria 833
95 Ga0075434_100601176 3300006871 Bacteria 1119
96 Ga0068865_100372290 3300006881 Bacteria 1163
97 Ga0075436_101388176 3300006914 Bacteria 532
98 Ga0097620_100179712 3300006931 Bacteria 2198
99 Ga0097620_100319915 3300006931 Bacteria 1645
100 Ga0097620_101128578 3300006931 Bacteria 863
101 Ga0111539_11074717 3300009094 Bacteria 935
102 Ga0105241_10285555 3300009174 Bacteria 1411
103 Ga0105241_10309991 3300009174 Bacteria 1357
104 Ga0105242_10606152 3300009176 Bacteria 1058
105 Ga0105242_10797086 3300009176 Bacteria 935
106 Ga0105242_10817908 3300009176 Bacteria 924
107 Ga0105237_10006944 3300009545 Bacteria 12482
108 Ga0105237_10008622 3300009545 Bacteria 11022
109 Ga0105237_10115373 3300009545 Bacteria 2679
110 Ga0105249_10043521 3300009553 Bacteria 4083
111 Ga0105249_10106408 3300009553 Unclassified 2646
112 Ga0105249_10966056 3300009553 Bacteria 920
113 Ga0105239_10005705 3300010375 Bacteria 14536
114 Ga0105239_10042192 3300010375 Bacteria 4999
115 Ga0105239_10152302 3300010375 Bacteria 2581
116 Ga0105246_10327842 3300011119 Bacteria 1247
117 Ga0105246_11321613 3300011119 Unclassified 669
118 Ga0157373_10431755 3300013100 Bacteria 946
119 Ga0157373_10566381 3300013100 Unclassified 825
120 Ga0157371_10043864 3300013102 Bacteria 3185
121 Ga0157371_11080606 3300013102 Bacteria 615
122 Ga0157369_10463631 3300013105 Bacteria 1312
123 Ga0157374_10001929 3300013296 Bacteria 17404
124 Ga0157374_10010613 3300013296 Bacteria 7931
125 Ga0157374_11204876 3300013296 Unclassified 778
126 Ga0157374_11819392 3300013296 Unclassified 634
127 Ga0157378_10756125 3300013297 Unclassified 995
128 Ga0157378_10761780 3300013297 Bacteria 991
129 Ga0157378_11004813 3300013297 Bacteria 869
130 Ga0157378_11121761 3300013297 Bacteria 824
131 Ga0157378_11164950 3300013297 Bacteria 809
132 Ga0157378_11300607 3300013297 Bacteria 768
133 Ga0157378_12545140 3300013297 Bacteria 564
134 Ga0157378_13130460 3300013297 Unclassified 514
135 Ga0163162_10024921 3300013306 Bacteria 5909
136 Ga0163162_10317345 3300013306 Bacteria 1691
137 Ga0163162_10925491 3300013306 Bacteria 984
138 Ga0163162_11324500 3300013306 Bacteria 818
139 Ga0163162_11397111 3300013306 Unclassified 796
140 Ga0157372_10129607 3300013307 Bacteria 2901
141 Ga0157372_10528104 3300013307 Bacteria 1376
142 Ga0157372_10760615 3300013307 Bacteria 1126
143 Ga0157372_10782093 3300013307 Bacteria 1109
144 Ga0157372_10876109 3300013307 Unclassified 1042
145 Ga0157372_10927475 3300013307 Bacteria 1010
146 Ga0157372_11054805 3300013307 Bacteria 941
147 Ga0157375_10026676 3300013308 Bacteria 5389
148 Ga0157375_10529827 3300013308 Bacteria 1341
149 Ga0157375_10690463 3300013308 Bacteria 1175
150 Ga0157375_12341891 3300013308 Bacteria 637
151 Ga0163163_10387012 3300014325 Bacteria 1456
152 Ga0163163_10555121 3300014325 Bacteria 1211
153 Ga0163163_10819591 3300014325 Bacteria 994
154 Ga0163163_11789624 3300014325 Bacteria 675
155 Ga0157380_10006309 3300014326 Bacteria 8331
156 Ga0157380_10111495 3300014326 Bacteria 2300
157 Ga0157380_11071702 3300014326 Bacteria 843
158 Ga0157377_10862742 3300014745 Bacteria 673
159 Ga0157379_10095285 3300014968 Bacteria 2670
160 Ga0157376_10013253 3300014969 Bacteria 6147
161 Ga0157376_10050189 3300014969 Bacteria 3460
162 Ga0157376_10191278 3300014969 Bacteria 1877
163 Ga0157376_10605723 3300014969 Bacteria 1091
164 Ga0157376_10870156 3300014969 Bacteria 918
165 Ga0157376_10943805 3300014969 Unclassified 883
166 Ga0157376_12352300 3300014969 Unclassified 572
167 Ga0163161_10006560 3300017792 Bacteria 8054
168 Ga0163161_10100731 3300017792 Unclassified 2150
169 Ga0163161_10248738 3300017792 Bacteria 1385
170 Ga0213876_10006684 3300021384 Bacteria 6294
171 Ga0207426_1000052 3300025302 Bacteria 389825
172 Ga0207656_10266495 3300025321 Bacteria 842
173 Ga0207682_10020674 3300025893 Bacteria 2584
174 Ga0207642_10237547 3300025899 Bacteria 1027
175 Ga0207680_10060307 3300025903 Bacteria 2309
176 Ga0207647_10333038 3300025904 Bacteria 861
177 Ga0207685_10309391 3300025905 Bacteria 784
178 Ga0207645_10373205 3300025907 Bacteria 957
179 Ga0207645_11083505 3300025907 Unclassified 541
180 Ga0207643_10271770 3300025908 Bacteria 1049
181 Ga0207705_10615294 3300025909 Bacteria 845
182 Ga0207671_10041696 3300025914 Unclassified 3397
183 Ga0207671_10071602 3300025914 Bacteria 2586
184 Ga0207671_10129464 3300025914 Bacteria 1936
185 Ga0207671_10196777 3300025914 Bacteria 1573
186 Ga0207657_10196967 3300025919 Bacteria 1623
187 Ga0207681_10508457 3300025923 Bacteria 987
188 Ga0207650_11001921 3300025925 Bacteria 711
189 Ga0207659_11324799 3300025926 Bacteria 618
190 Ga0207644_10180739 3300025931 Unclassified 1653
191 Ga0207644_10931585 3300025931 Bacteria 728
192 Ga0207690_10050001 3300025932 Bacteria 2789
193 Ga0207706_10006263 3300025933 Bacteria 11062
194 Ga0207706_10035158 3300025933 Bacteria 4456
195 Ga0207686_10001196 3300025934 Bacteria 15048
196 Ga0207686_10769708 3300025934 Bacteria 770
197 Ga0207686_10805820 3300025934 Bacteria 753
198 Ga0207670_10003108 3300025936 Bacteria 8786
199 Ga0207670_11296619 3300025936 Bacteria 617
200 Ga0207669_11169180 3300025937 Bacteria 651
201 Ga0207704_11065814 3300025938 Unclassified 686
202 Ga0207691_10097980 3300025940 Bacteria 2620
203 Ga0207691_11229829 3300025940 Bacteria 620
204 Ga0207689_10020637 3300025942 Bacteria 5540
205 Ga0207661_10094916 3300025944 Bacteria 2492
206 Ga0207661_11430372 3300025944 Bacteria 634
207 Ga0207679_10092815 3300025945 Bacteria 2339
208 Ga0207679_11197415 3300025945 Bacteria 697
209 Ga0207679_11406154 3300025945 Bacteria 640
210 Ga0207651_11431087 3300025960 Unclassified 622
211 Ga0207651_11699495 3300025960 Bacteria 568
212 Ga0207712_10788553 3300025961 Bacteria 835
213 Ga0207640_10422318 3300025981 Bacteria 1091
214 Ga0207640_11226805 3300025981 Bacteria 667
215 Ga0207658_11967204 3300025986 Bacteria 532
216 Ga0207677_11286725 3300026023 Unclassified 671
217 Ga0207703_10135859 3300026035 Bacteria 2129
218 Ga0207639_10467256 3300026041 Bacteria 1148
219 Ga0207639_10792763 3300026041 Bacteria 883
220 Ga0207678_10439413 3300026067 Bacteria 1133
221 Ga0207702_10926156 3300026078 Bacteria 864
222 Ga0207702_12349866 3300026078 Bacteria 521
223 Ga0207641_12238920 3300026088 Unclassified 546
224 Ga0207648_10031485 3300026089 Bacteria 4690
225 Ga0207648_10190654 3300026089 Bacteria 1816
226 Ga0207648_10247401 3300026089 Unclassified 1589
227 Ga0207676_11058552 3300026095 Bacteria 801
228 Ga0207674_10034295 3300026116 Bacteria 5308
229 Ga0207674_11542241 3300026116 Bacteria 633
230 Ga0207675_100069581 3300026118 Bacteria 3290
231 Ga0207675_101271360 3300026118 Bacteria 756
232 Ga0207683_10025383 3300026121 Bacteria 5112
233 Ga0207683_10504342 3300026121 Bacteria 1118
234 Ga0207698_10070769 3300026142 Bacteria 2765
235 Ga0268265_10074461 3300028380 Bacteria 2656
236 Ga0268265_10402756 3300028380 Bacteria 1265
237 Ga0268264_12438809 3300028381 Bacteria 529
238 Ga0265324_10027097 3300029957 Bacteria 2026
239 Ga0265316_10210762 3300031344 Unclassified 1437
240 Ga0307408_101331596 3300031548 Bacteria 674
241 Ga0307412_11187609 3300031911 Bacteria 683
242 Ga0307414_10239948 3300032004 Bacteria 1500
243 Ga0307414_10249397 3300032004 Bacteria 1475
244 Ga0373934_0125903 3300035086 Bacteria 1043
245 Ga0373956_0298418 3300035119 Bacteria 767
246 Ga0395899_0000006 3300037312 Bacteria 666341
247 Ga0395900_0182863 3300037418 Bacteria 2129
248 Ga0436365_0464622 3300039437 Bacteria 16852
249 Ga0436365_0855025 3300039437 Bacteria 727
250 Ga0451798_0516910 3300041458 Unclassified 540
251 Ga0451798_0822385 3300041458 Bacteria 931
252 Ga0451855_0414921 3300041511 Bacteria 521
253 Ga0439462_0215091 3300042015 Unclassified 549
254 Ga0439444_0083866 3300042437 Bacteria 701
255 Ga0466972_0000001 3300044658 Bacteria 412457
256 Ga0453684_0335754 3300044712 Archaea 1708
257 Ga0466968_0038572 3300044735 Bacteria 2008
258 Ga0466970_0000266 3300044765 Bacteria 25589
259 Ga0466957_0000080 3300044842 Bacteria 38661
260 Ga0466957_0001277 3300044842 Bacteria 13121
261 Ga0466967_1336585 3300045976 Bacteria 714
262 Ga0495608_0035877 3300046511 Bacteria 3341
263 Ga0495630_0062747 3300046517 Bacteria 2791
264 Ga0495632_0421734 3300046519 Bacteria 581
265 Ga0495652_0483138 3300046529 Bacteria 862
266 Ga0495587_0095593 3300046536 Bacteria 1715
267 Ga0495667_0140281 3300046559 Bacteria 1558
268 Ga0495634_0526727 3300046642 Bacteria 691
269 Ga0495599_0090021 3300046678 Bacteria 1915
270 Ga0495658_0669600 3300046683 Unclassified 665
271 Ga0495604_0149068 3300047317 Bacteria 1664
272 Ga0495674_0272365 3300047319 Bacteria 1389
273 Ga0495672_0004686 3300047320 Bacteria 11072
274 Ga0495680_0110301 3300047322 Bacteria 2040
275 Ga0495686_0009999 3300047472 Bacteria 6778
276 Ga0501032_0204692 3300049569 Bacteria 1288
277 Ga0501034_0027240 3300049571 Bacteria 5814
278 Ga0501043_0167099 3300049579 Bacteria 1718
279 Ga0501235_048332 3300049669 Bacteria 982
280 Ga0501243_078024 3300049675 Bacteria 640
281 Ga0501250_011893 3300049680 Bacteria 1021
282 Ga0501253_180830 3300049683 Bacteria 548
283 Ga0501225_0275865 3300049705 Bacteria 561
284 Ga0501245_135557 3300049708 Bacteria 531
285 Ga0501245_156018 3300049708 Bacteria 508
286 Ga0501268_020320 3300049765 Bacteria 1130
287 Ga0501274_012809 3300049771 Bacteria 799
288 nmdc:mga0k408_44816_c1 3300050493 Bacteria 2551
289 Ga0500583_0029857 3300053092 Bacteria 2381
290 Ga0500642_0445124 3300053130 Bacteria 557
291 Ga0500622_0028649 3300053156 Bacteria 2931

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100005232 Ga0070683_1000052322 110
2 3300005330 Ga0070690_100809092 Ga0070690_1008090922 110
3 3300005337 Ga0070682_101014624 Ga0070682_1010146241 110
4 3300005366 Ga0070659_100125476 Ga0070659_1001254763 110
5 3300005530 Ga0070679_101656109 Ga0070679_1016561091 110
6 3300005539 Ga0068853_100701221 Ga0068853_1007012212 110
7 3300006237 Ga0097621_100177027 Ga0097621_1001770274 110
8 3300013297 Ga0157378_13130460 Ga0157378_131304601 110
9 3300013307 Ga0157372_10760615 Ga0157372_107606152 110
10 3300025932 Ga0207690_10050001 Ga0207690_100500012 110
11 3300025933 Ga0207706_10035158 Ga0207706_100351583 110
12 3300025960 Ga0207651_11431087 Ga0207651_114310871 110
13 3300005355 Ga0070671_100041140 Ga0070671_1000411403 124
14 3300005333 Ga0070677_10078625 Ga0070677_100786252 125
15 3300042015 Ga0439462_0215091 Ga0439462_0215091_45_422 125
16 3300005293 Ga0065715_10438140 Ga0065715_104381402 128
17 3300005329 Ga0070683_101835307 Ga0070683_1018353071 128
18 3300005347 Ga0070668_100850426 Ga0070668_1008504262 128
19 3300005353 Ga0070669_100239876 Ga0070669_1002398762 128
20 3300005356 Ga0070674_100964724 Ga0070674_1009647241 128
21 3300005455 Ga0070663_100340308 Ga0070663_1003403082 128
22 3300005459 Ga0068867_101957476 Ga0068867_1019574761 128
23 3300005459 Ga0068867_101963346 Ga0068867_1019633461 128
24 3300005467 Ga0070706_100611831 Ga0070706_1006118311 128
25 3300005539 Ga0068853_100549689 Ga0068853_1005496892 128
26 3300005544 Ga0070686_100254412 Ga0070686_1002544123 128
27 3300005617 Ga0068859_100179711 Ga0068859_1001797112 128
28 3300005617 Ga0068859_101128501 Ga0068859_1011285012 128
29 3300005840 Ga0068870_10768536 Ga0068870_107685362 128
30 3300005841 Ga0068863_102013280 Ga0068863_1020132801 128
31 3300005843 Ga0068860_101606181 Ga0068860_1016061811 128
32 3300006237 Ga0097621_100264569 Ga0097621_1002645692 128
33 3300006358 Ga0068871_100075882 Ga0068871_1000758825 128
34 3300006881 Ga0068865_100372290 Ga0068865_1003722902 128
35 3300006931 Ga0097620_100179712 Ga0097620_1001797122 128
36 3300006931 Ga0097620_101128578 Ga0097620_1011285782 128
37 3300009176 Ga0105242_10797086 Ga0105242_107970862 128
38 3300009553 Ga0105249_10043521 Ga0105249_100435213 128
39 3300011119 Ga0105246_11321613 Ga0105246_113216132 128
40 3300013297 Ga0157378_11004813 Ga0157378_110048131 128
41 3300013306 Ga0163162_10317345 Ga0163162_103173453 128
42 3300013306 Ga0163162_10925491 Ga0163162_109254911 128
43 3300013308 Ga0157375_12341891 Ga0157375_123418911 128
44 3300014325 Ga0163163_11789624 Ga0163163_117896242 128
45 3300014326 Ga0157380_11071702 Ga0157380_110717022 128
46 3300014969 Ga0157376_10050189 Ga0157376_100501893 128
47 3300017792 Ga0163161_10248738 Ga0163161_102487382 128
48 3300025893 Ga0207682_10020674 Ga0207682_100206743 128
49 3300025923 Ga0207681_10508457 Ga0207681_105084572 128
50 3300025934 Ga0207686_10001196 Ga0207686_1000119619 128
51 3300025936 Ga0207670_10003108 Ga0207670_100031083 128
52 3300025940 Ga0207691_11229829 Ga0207691_112298292 128
53 3300025961 Ga0207712_10788553 Ga0207712_107885532 128
54 3300026078 Ga0207702_12349866 Ga0207702_123498661 128
55 3300026088 Ga0207641_12238920 Ga0207641_122389202 128
56 3300026089 Ga0207648_10031485 Ga0207648_100314854 128
57 3300026118 Ga0207675_100069581 Ga0207675_1000695813 128
58 3300026121 Ga0207683_10504342 Ga0207683_105043422 128
59 3300028380 Ga0268265_10074461 Ga0268265_100744613 128
60 3300039437 Ga0436365_0855025 Ga0436365_0855025_19_411 128
61 3300041458 Ga0451798_0822385 Ga0451798_0822385_327_719 128
62 3300041511 Ga0451855_0414921 Ga0451855_0414921_91_480 128
63 3300047472 Ga0495686_0009999 Ga0495686_0009999_5460_5849 128
64 3300005343 Ga0070687_100083801 Ga0070687_1000838012 129
65 3300005353 Ga0070669_100201042 Ga0070669_1002010423 129
66 3300005366 Ga0070659_101534688 Ga0070659_1015346881 129
67 3300005367 Ga0070667_101816725 Ga0070667_1018167251 129
68 3300005719 Ga0068861_100070159 Ga0068861_1000701592 129
69 3300006237 Ga0097621_101123236 Ga0097621_1011232361 129
70 3300009174 Ga0105241_10309991 Ga0105241_103099911 129
71 3300009545 Ga0105237_10008622 Ga0105237_100086222 129
72 3300009545 Ga0105237_10115373 Ga0105237_101153731 129
73 3300009553 Ga0105249_10966056 Ga0105249_109660562 129
74 3300010375 Ga0105239_10005705 Ga0105239_1000570513 129
75 3300013102 Ga0157371_11080606 Ga0157371_110806062 129
76 3300025904 Ga0207647_10333038 Ga0207647_103330382 129
77 3300025914 Ga0207671_10071602 Ga0207671_100716024 129
78 3300025914 Ga0207671_10196777 Ga0207671_101967773 129
79 3300028380 Ga0268265_10402756 Ga0268265_104027563 129
80 3300028381 Ga0268264_12438809 Ga0268264_124388091 129
81 3300031911 Ga0307412_11187609 Ga0307412_111876092 129
82 3300003316 rootH1_10097423 rootH1_100974233 130
83 3300005459 Ga0068867_100012319 Ga0068867_1000123191 130
84 3300005544 Ga0070686_100170829 Ga0070686_1001708291 130
85 3300005578 Ga0068854_100006375 Ga0068854_1000063756 130
86 3300005616 Ga0068852_100219873 Ga0068852_1002198732 130
87 3300006237 Ga0097621_100935513 Ga0097621_1009355132 130
88 3300006358 Ga0068871_100871137 Ga0068871_1008711372 130
89 3300009176 Ga0105242_10817908 Ga0105242_108179081 130
90 3300013296 Ga0157374_11204876 Ga0157374_112048762 130
91 3300013297 Ga0157378_10761780 Ga0157378_107617802 130
92 3300013297 Ga0157378_11300607 Ga0157378_113006072 130
93 3300013306 Ga0163162_11324500 Ga0163162_113245002 130
94 3300013306 Ga0163162_11397111 Ga0163162_113971112 130
95 3300013307 Ga0157372_10528104 Ga0157372_105281041 130
96 3300013307 Ga0157372_10782093 Ga0157372_107820932 130
97 3300014969 Ga0157376_10605723 Ga0157376_106057232 130
98 3300014969 Ga0157376_10943805 Ga0157376_109438052 130
99 3300025907 Ga0207645_11083505 Ga0207645_110835051 130
100 3300025914 Ga0207671_10129464 Ga0207671_101294643 130
101 3300025931 Ga0207644_10931585 Ga0207644_109315851 130
102 3300025934 Ga0207686_10769708 Ga0207686_107697082 130
103 3300025938 Ga0207704_11065814 Ga0207704_110658142 130
104 3300025981 Ga0207640_10422318 Ga0207640_104223182 130
105 3300026023 Ga0207677_11286725 Ga0207677_112867251 130
106 3300026116 Ga0207674_10034295 Ga0207674_100342952 130
107 3300029957 Ga0265324_10027097 Ga0265324_100270972 130
108 3300031344 Ga0265316_10210762 Ga0265316_102107622 130
109 3300032004 Ga0307414_10239948 Ga0307414_102399482 130
110 3300032004 Ga0307414_10249397 Ga0307414_102493972 130
111 3300035086 Ga0373934_0125903 Ga0373934_0125903_352_750 130
112 3300035119 Ga0373956_0298418 Ga0373956_0298418_198_596 130
113 3300044658 Ga0466972_0000001 Ga0466972_0000001_196385_196783 130
114 3300044765 Ga0466970_0000266 Ga0466970_0000266_10492_10890 130
115 3300046511 Ga0495608_0035877 Ga0495608_0035877_2374_2772 130
116 3300046517 Ga0495630_0062747 Ga0495630_0062747_10_408 130
117 3300046529 Ga0495652_0483138 Ga0495652_0483138_338_736 130
118 3300046536 Ga0495587_0095593 Ga0495587_0095593_1048_1446 130
119 3300046559 Ga0495667_0140281 Ga0495667_0140281_740_1138 130
120 3300046642 Ga0495634_0526727 Ga0495634_0526727_128_526 130
121 3300046678 Ga0495599_0090021 Ga0495599_0090021_740_1138 130
122 3300047317 Ga0495604_0149068 Ga0495604_0149068_657_1055 130
123 3300047319 Ga0495674_0272365 Ga0495674_0272365_740_1138 130
124 3300047320 Ga0495672_0004686 Ga0495672_0004686_7346_7750 130
125 3300047322 Ga0495680_0110301 Ga0495680_0110301_1325_1723 130
126 3300049669 Ga0501235_048332 Ga0501235_048332_101_499 130
127 3300049675 Ga0501243_078024 Ga0501243_078024_126_524 130
128 3300049680 Ga0501250_011893 Ga0501250_011893_410_808 130
129 3300049683 Ga0501253_180830 Ga0501253_180830_16_414 130
130 3300049705 Ga0501225_0275865 Ga0501225_0275865_76_474 130
131 3300049708 Ga0501245_135557 Ga0501245_135557_49_447 130
132 3300049708 Ga0501245_156018 Ga0501245_156018_88_486 130
133 3300049765 Ga0501268_020320 Ga0501268_020320_677_1075 130
134 3300049771 Ga0501274_012809 Ga0501274_012809_95_493 130
135 3300005355 Ga0070671_100116806 Ga0070671_1001168063 131
136 3300013297 Ga0157378_10756125 Ga0157378_107561251 131
137 3300013307 Ga0157372_10876109 Ga0157372_108761092 131
138 3300013307 Ga0157372_11054805 Ga0157372_110548052 131
139 3300025931 Ga0207644_10180739 Ga0207644_101807392 131
140 3300037312 Ga0395899_0000006 Ga0395899_0000006_30973_31374 131
141 3300037418 Ga0395900_0182863 Ga0395900_0182863_958_1359 131
142 3300044842 Ga0466957_0000080 Ga0466957_0000080_23573_23974 131
143 3300044842 Ga0466957_0001277 Ga0466957_0001277_5719_6138 131
144 3300046519 Ga0495632_0421734 Ga0495632_0421734_135_536 131
145 3300049571 Ga0501034_0027240 Ga0501034_0027240_1695_2096 131
146 3300005328 Ga0070676_10125273 Ga0070676_101252732 132
147 3300005330 Ga0070690_100093200 Ga0070690_1000932002 132
148 3300005335 Ga0070666_10061668 Ga0070666_100616683 132
149 3300005340 Ga0070689_100466159 Ga0070689_1004661592 132
150 3300005344 Ga0070661_100162458 Ga0070661_1001624581 132
151 3300005353 Ga0070669_100179318 Ga0070669_1001793182 132
152 3300005353 Ga0070669_100585555 Ga0070669_1005855552 132
153 3300005354 Ga0070675_100275633 Ga0070675_1002756333 132
154 3300005364 Ga0070673_102269698 Ga0070673_1022696981 132
155 3300005365 Ga0070688_100966790 Ga0070688_1009667901 132
156 3300005456 Ga0070678_100028260 Ga0070678_1000282603 132
157 3300005457 Ga0070662_100006730 Ga0070662_1000067308 132
158 3300005459 Ga0068867_100287916 Ga0068867_1002879162 132
159 3300005459 Ga0068867_100399453 Ga0068867_1003994531 132
160 3300005471 Ga0070698_100143072 Ga0070698_1001430722 132
161 3300005547 Ga0070693_100080096 Ga0070693_1000800962 132
162 3300005564 Ga0070664_100046128 Ga0070664_1000461283 132
163 3300005564 Ga0070664_100779269 Ga0070664_1007792692 132
164 3300005614 Ga0068856_100583358 Ga0068856_1005833582 132
165 3300005616 Ga0068852_100126385 Ga0068852_1001263853 132
166 3300005618 Ga0068864_100270880 Ga0068864_1002708802 132
167 3300005719 Ga0068861_100603176 Ga0068861_1006031762 132
168 3300005840 Ga0068870_10055306 Ga0068870_100553062 132
169 3300005841 Ga0068863_100043462 Ga0068863_1000434626 132
170 3300005841 Ga0068863_102175012 Ga0068863_1021750122 132
171 3300005842 Ga0068858_100122338 Ga0068858_1001223382 132
172 3300005843 Ga0068860_101425165 Ga0068860_1014251651 132
173 3300005843 Ga0068860_101512984 Ga0068860_1015129841 132
174 3300006195 Ga0075366_10073056 Ga0075366_100730562 132
175 3300006237 Ga0097621_101544483 Ga0097621_1015444831 132
176 3300006358 Ga0068871_100272250 Ga0068871_1002722502 132
177 3300006871 Ga0075434_100601176 Ga0075434_1006011762 132
178 3300006914 Ga0075436_101388176 Ga0075436_1013881762 132
179 3300006931 Ga0097620_100319915 Ga0097620_1003199152 132
180 3300009094 Ga0111539_11074717 Ga0111539_110747172 132
181 3300009174 Ga0105241_10285555 Ga0105241_102855552 132
182 3300009176 Ga0105242_10606152 Ga0105242_106061522 132
183 3300009553 Ga0105249_10106408 Ga0105249_101064083 132
184 3300010375 Ga0105239_10152302 Ga0105239_101523022 132
185 3300011119 Ga0105246_10327842 Ga0105246_103278422 132
186 3300013100 Ga0157373_10431755 Ga0157373_104317551 132
187 3300013102 Ga0157371_10043864 Ga0157371_100438643 132
188 3300013105 Ga0157369_10463631 Ga0157369_104636311 132
189 3300013296 Ga0157374_10001929 Ga0157374_100019298 132
190 3300013296 Ga0157374_11819392 Ga0157374_118193922 132
191 3300013297 Ga0157378_11121761 Ga0157378_111217611 132
192 3300013297 Ga0157378_11164950 Ga0157378_111649502 132
193 3300013297 Ga0157378_12545140 Ga0157378_125451402 132
194 3300013306 Ga0163162_10024921 Ga0163162_100249212 132
195 3300013307 Ga0157372_10927475 Ga0157372_109274752 132
196 3300013308 Ga0157375_10026676 Ga0157375_100266762 132
197 3300013308 Ga0157375_10529827 Ga0157375_105298272 132
198 3300014325 Ga0163163_10387012 Ga0163163_103870123 132
199 3300014325 Ga0163163_10819591 Ga0163163_108195912 132
200 3300014326 Ga0157380_10111495 Ga0157380_101114952 132
201 3300014745 Ga0157377_10862742 Ga0157377_108627422 132
202 3300014968 Ga0157379_10095285 Ga0157379_100952853 132
203 3300014969 Ga0157376_10191278 Ga0157376_101912783 132
204 3300017792 Ga0163161_10006560 Ga0163161_100065602 132
205 3300025899 Ga0207642_10237547 Ga0207642_102375472 132
206 3300025903 Ga0207680_10060307 Ga0207680_100603073 132
207 3300025905 Ga0207685_10309391 Ga0207685_103093912 132
208 3300025907 Ga0207645_10373205 Ga0207645_103732052 132
209 3300025908 Ga0207643_10271770 Ga0207643_102717702 132
210 3300025933 Ga0207706_10006263 Ga0207706_100062637 132
211 3300025934 Ga0207686_10805820 Ga0207686_108058202 132
212 3300025936 Ga0207670_11296619 Ga0207670_112966191 132
213 3300025942 Ga0207689_10020637 Ga0207689_100206374 132
214 3300025944 Ga0207661_11430372 Ga0207661_114303722 132
215 3300025945 Ga0207679_10092815 Ga0207679_100928153 132
216 3300025960 Ga0207651_11699495 Ga0207651_116994951 132
217 3300025981 Ga0207640_11226805 Ga0207640_112268051 132
218 3300026035 Ga0207703_10135859 Ga0207703_101358593 132
219 3300026067 Ga0207678_10439413 Ga0207678_104394132 132
220 3300026078 Ga0207702_10926156 Ga0207702_109261562 132
221 3300026089 Ga0207648_10190654 Ga0207648_101906543 132
222 3300026089 Ga0207648_10247401 Ga0207648_102474012 132
223 3300026116 Ga0207674_11542241 Ga0207674_115422412 132
224 3300026118 Ga0207675_101271360 Ga0207675_1012713602 132
225 3300026121 Ga0207683_10025383 Ga0207683_100253833 132
226 3300044712 Ga0453684_0335754 Ga0453684_0335754_315_719 132
227 3300044735 Ga0466968_0038572 Ga0466968_0038572_482_937 132
228 3300045976 Ga0466967_1336585 Ga0466967_1336585_78_482 132
229 3300046683 Ga0495658_0669600 Ga0495658_0669600_188_592 132
230 3300049569 Ga0501032_0204692 Ga0501032_0204692_838_1251 132
231 3300049579 Ga0501043_0167099 Ga0501043_0167099_81_494 132
232 3300050493 nmdc:mga0k408_44816_c1 nmdc:mga0k408_44816_c1_674_1078 132
233 3300053092 Ga0500583_0029857 Ga0500583_0029857_265_669 132
234 3300053130 Ga0500642_0445124 Ga0500642_0445124_73_477 132
235 3300053156 Ga0500622_0028649 Ga0500622_0028649_1043_1447 132
236 3300001979 JGI24740J21852_10028485 JGI24740J21852_100284852 133
237 3300003322 rootL2_10043714 rootL2_100437142 133
238 3300003322 rootL2_10296321 rootL2_102963211 133
239 3300003323 rootH1_10139114 rootH1_101391142 133
240 3300003354 JGI25160J50197_1000239 JGI25160J50197_10002397 133
241 3300005329 Ga0070683_100027889 Ga0070683_1000278895 133
242 3300005331 Ga0070670_100250268 Ga0070670_1002502682 133
243 3300005331 Ga0070670_101034480 Ga0070670_1010344802 133
244 3300005337 Ga0070682_100687357 Ga0070682_1006873571 133
245 3300005338 Ga0068868_100113427 Ga0068868_1001134272 133
246 3300005339 Ga0070660_100388196 Ga0070660_1003881962 133
247 3300005364 Ga0070673_100276342 Ga0070673_1002763422 133
248 3300005459 Ga0068867_101431423 Ga0068867_1014314232 133
249 3300005530 Ga0070679_101388300 Ga0070679_1013883002 133
250 3300005535 Ga0070684_100052547 Ga0070684_1000525474 133
251 3300005539 Ga0068853_100168200 Ga0068853_1001682002 133
252 3300005539 Ga0068853_100492957 Ga0068853_1004929572 133
253 3300005564 Ga0070664_100415753 Ga0070664_1004157532 133
254 3300005564 Ga0070664_101039430 Ga0070664_1010394302 133
255 3300005616 Ga0068852_100091004 Ga0068852_1000910042 133
256 3300005616 Ga0068852_101023012 Ga0068852_1010230122 133
257 3300005834 Ga0068851_10528341 Ga0068851_105283412 133
258 3300009545 Ga0105237_10006944 Ga0105237_100069447 133
259 3300010375 Ga0105239_10042192 Ga0105239_100421922 133
260 3300013100 Ga0157373_10566381 Ga0157373_105663812 133
261 3300013296 Ga0157374_10010613 Ga0157374_100106133 133
262 3300013307 Ga0157372_10129607 Ga0157372_101296073 133
263 3300013308 Ga0157375_10690463 Ga0157375_106904632 133
264 3300014325 Ga0163163_10555121 Ga0163163_105551211 133
265 3300014326 Ga0157380_10006309 Ga0157380_100063093 133
266 3300014969 Ga0157376_10013253 Ga0157376_100132536 133
267 3300014969 Ga0157376_10870156 Ga0157376_108701562 133
268 3300014969 Ga0157376_12352300 Ga0157376_123523001 133
269 3300017792 Ga0163161_10100731 Ga0163161_101007313 133
270 3300021384 Ga0213876_10006684 Ga0213876_100066844 133
271 3300025302 Ga0207426_1000052 Ga0207426_1000052307 133
272 3300025321 Ga0207656_10266495 Ga0207656_102664952 133
273 3300025909 Ga0207705_10615294 Ga0207705_106152942 133
274 3300025914 Ga0207671_10041696 Ga0207671_100416962 133
275 3300025919 Ga0207657_10196967 Ga0207657_101969672 133
276 3300025925 Ga0207650_11001921 Ga0207650_110019212 133
277 3300025926 Ga0207659_11324799 Ga0207659_113247991 133
278 3300025937 Ga0207669_11169180 Ga0207669_111691801 133
279 3300025940 Ga0207691_10097980 Ga0207691_100979802 133
280 3300025944 Ga0207661_10094916 Ga0207661_100949162 133
281 3300025945 Ga0207679_11197415 Ga0207679_111974151 133
282 3300025945 Ga0207679_11406154 Ga0207679_114061542 133
283 3300025986 Ga0207658_11967204 Ga0207658_119672041 133
284 3300026041 Ga0207639_10467256 Ga0207639_104672561 133
285 3300026041 Ga0207639_10792763 Ga0207639_107927632 133
286 3300026095 Ga0207676_11058552 Ga0207676_110585522 133
287 3300026142 Ga0207698_10070769 Ga0207698_100707692 133
288 3300031548 Ga0307408_101331596 Ga0307408_1013315962 133
289 3300039437 Ga0436365_0464622 Ga0436365_0464622_5669_6148 133
290 3300041458 Ga0451798_0516910 Ga0451798_0516910_85_495 133
291 3300042437 Ga0439444_0083866 Ga0439444_0083866_102_509 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

24

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vme-assembly2.cif.gz_F human escrt-i heterotetramer headpiece 0.931 62 119
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9271 7 117
6vme-assembly4.cif.gz_H human escrt-i heterotetramer headpiece 0.9263 62 119
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9188 11 115
2f66-assembly3.cif.gz_D structure of the escrt-i endosomal trafficking complex 0.9188 66 123
ID Description Score Start End Superfamily
af_K7LHR2_116_185_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.964 64 115 1.10.287.660
2f66A00 Special;Helix non-globular;Helix Hairpins; 0.9532 66 120 6.10.140.820
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9397 5 121 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9318 5 121 1.20.1440.60
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9271 7 117 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A1G3C7C5-F1-model_v4 Four helix bundle protein 0.9829 3 119
AF-A0A6J4XZ65-F1-model_v4 Four helix bundle protein 0.9825 3 121
AF-A0A0G0J5T1-F1-model_v4 S23 ribosomal protein 0.9815 1 119 GO:0005840
AF-A0A3N5JT07-F1-model_v4 Four helix bundle protein 0.9807 3 119
AF-A0A2M8GCJ0-F1-model_v4 Four helix bundle protein 0.9801 3 119

Feature Viewer

pLDDT pTM Quality
92.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map