F390353

General Info

Members Datasets Scaffolds Average Seq Length
291 174 582 315

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10257219|Ga0157380_102572191
Length 347
Sequence MKGQLADFLDHLRLNENASAHTVRAYESDLTQFITFVAAELKRRRPDLLVSDFNHLHIRAFLGDLHKRGNSRSSAARKLAAIRTFGRYLRREGAIDGDPAALVGTPKREQRLPAHLAEAEMSRLLEMPDTSSPLGRRDRAILELLYASGLRLSELVGVGLEDVNLSSRVVRVLGKGGKERIVPFNRSTEAAIRSWLKDRELILTGVRPSTGSGRPELVEGRGPGSGIRRTEVRRIPLRSRRGADPLFLNYQGGRLSTRSVDRLVRKYVAACSTRFGISPHALRHSFATHLLEHGADTRSVQAMLGHADLATTQIYTHVTGERLRNVYERHHPRARGAGEDLTEAEED

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
164 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
173 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
174 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 5.15
Rhizosphere 90.03
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10257219 3300014326 Bacteria 1584
2 Ga0065712_10017688 3300005290 Bacteria 1534
3 Ga0065712_10153381 3300005290 Bacteria 1352
4 Ga0065715_10007322 3300005293 Bacteria 5002
5 Ga0070676_10016240 3300005328 Bacteria 4114
6 Ga0070683_100000326 3300005329 Bacteria 32914
7 Ga0070690_100023681 3300005330 Bacteria 3768
8 Ga0070666_10072634 3300005335 Bacteria 2343
9 Ga0070660_100114708 3300005339 Bacteria 2146
10 Ga0070689_100216069 3300005340 Bacteria 1571
11 Ga0070687_100012706 3300005343 Bacteria 3725
12 Ga0070661_100067672 3300005344 Bacteria 2625
13 Ga0070668_100239768 3300005347 Bacteria 1501
14 Ga0070669_100001283 3300005353 Bacteria 18152
15 Ga0070669_100234178 3300005353 Bacteria 1456
16 Ga0070671_100037752 3300005355 Bacteria 4007
17 Ga0070674_100025071 3300005356 Bacteria 3877
18 Ga0070673_100010560 3300005364 Bacteria 6255
19 Ga0070667_100169508 3300005367 Bacteria 1927
20 Ga0070667_100396479 3300005367 Bacteria 1256
21 Ga0070701_10122991 3300005438 Bacteria 1465
22 Ga0070700_100013851 3300005441 Bacteria 4538
23 Ga0070663_100057966 3300005455 Bacteria 2780
24 Ga0070663_100177240 3300005455 Bacteria 1651
25 Ga0070678_100120645 3300005456 Bacteria 2067
26 Ga0070662_100148782 3300005457 Bacteria 1821
27 Ga0070706_100285265 3300005467 Bacteria 1541
28 Ga0070707_100337968 3300005468 Bacteria 1463
29 Ga0070699_100040347 3300005518 Bacteria 4042
30 Ga0070679_100286503 3300005530 Bacteria 1599
31 Ga0070684_100000168 3300005535 Bacteria 45138
32 Ga0070684_100368188 3300005535 Bacteria 1323
33 Ga0070697_100000839 3300005536 Bacteria 23076
34 Ga0070672_100008510 3300005543 Bacteria 7024
35 Ga0070696_100074678 3300005546 Bacteria 2391
36 Ga0070693_100018838 3300005547 Bacteria 3611
37 Ga0070664_100001925 3300005564 Bacteria 16671
38 Ga0070664_100136515 3300005564 Bacteria 2157
39 Ga0068857_100006720 3300005577 Bacteria 9889
40 Ga0068857_100187946 3300005577 Bacteria 1881
41 Ga0068854_100055408 3300005578 Bacteria 2854
42 Ga0068859_100047170 3300005617 Bacteria 4328
43 Ga0068866_10003765 3300005718 Bacteria 6217
44 Ga0068861_100154364 3300005719 Bacteria 1887
45 Ga0068860_100053870 3300005843 Bacteria 3824
46 Ga0068860_100120939 3300005843 Bacteria 2507
47 Ga0068860_100374871 3300005843 Bacteria 1404
48 Ga0081539_10000189 3300005985 Bacteria 143321
49 Ga0075365_10192884 3300006038 Bacteria 1426
50 Ga0075368_10092472 3300006042 Bacteria 1237
51 Ga0075367_10020005 3300006178 Bacteria 3722
52 Ga0075428_100007512 3300006844 Bacteria 12083
53 Ga0075428_100007849 3300006844 Bacteria 11830
54 Ga0075428_100010179 3300006844 Bacteria 10442
55 Ga0075430_100018629 3300006846 Bacteria 5908
56 Ga0075430_100025950 3300006846 Bacteria 4986
57 Ga0075430_100029331 3300006846 Bacteria 4669
58 Ga0075431_100048861 3300006847 Bacteria 4363
59 Ga0075431_100086085 3300006847 Bacteria 3243
60 Ga0075431_100207909 3300006847 Bacteria 2000
61 Ga0075433_10139520 3300006852 Bacteria 2155
62 Ga0075433_10232600 3300006852 Bacteria 1636
63 Ga0075433_10264272 3300006852 Unclassified 1525
64 Ga0075434_100052472 3300006871 Bacteria 4052
65 Ga0075434_100093451 3300006871 Bacteria 3011
66 Ga0075434_100103097 3300006871 Bacteria 2861
67 Ga0075434_100229706 3300006871 Bacteria 1875
68 Ga0075434_100500425 3300006871 Bacteria 1236
69 Ga0075429_100262191 3300006880 Bacteria 1513
70 Ga0097620_100047174 3300006931 Bacteria 4328
71 Ga0075435_100000945 3300007076 Bacteria 18336
72 Ga0075435_100199974 3300007076 Bacteria 1693
73 Ga0111539_10011724 3300009094 Bacteria 10998
74 Ga0111539_10022288 3300009094 Bacteria 7785
75 Ga0111539_10024643 3300009094 Bacteria 7379
76 Ga0114129_10004300 3300009147 Bacteria 20127
77 Ga0114129_10007226 3300009147 Bacteria 15811
78 Ga0114129_10041409 3300009147 Bacteria 6491
79 Ga0114129_10077819 3300009147 Bacteria 4613
80 Ga0114129_10122446 3300009147 Bacteria 3579
81 Ga0114129_10240471 3300009147 Bacteria 2434
82 Ga0114129_10340590 3300009147 Bacteria 1989
83 Ga0105243_10037361 3300009148 Bacteria 3774
84 Ga0105243_10315164 3300009148 Bacteria 1423
85 Ga0105248_10331020 3300009177 Bacteria 1715
86 Ga0105248_10716733 3300009177 Bacteria 1129
87 Ga0105249_10006979 3300009553 Bacteria 9852
88 Ga0157370_10086951 3300013104 Bacteria 2936
89 Ga0157378_10140482 3300013297 Bacteria 2242
90 Ga0157375_10372232 3300013308 Bacteria 1595
91 Ga0163163_10014182 3300014325 Bacteria 7319
92 Ga0163163_10173823 3300014325 Bacteria 2200
93 Ga0163163_10226616 3300014325 Bacteria 1918
94 Ga0157380_10055626 3300014326 Bacteria 3144
95 Ga0157377_10016051 3300014745 Bacteria 3845
96 Ga0157379_10061641 3300014968 Bacteria 3354
97 Ga0157379_10485278 3300014968 Bacteria 1144
98 Ga0213876_10000022 3300021384 Bacteria 259520
99 Ga0213876_10000153 3300021384 Bacteria 73076
100 Ga0207697_10000753 3300025315 Bacteria 18345
101 Ga0207697_10012259 3300025315 Bacteria 3599
102 Ga0207656_10052586 3300025321 Bacteria 1764
103 Ga0207642_10003015 3300025899 Bacteria 5277
104 Ga0207688_10003795 3300025901 Bacteria 8241
105 Ga0207688_10039691 3300025901 Bacteria 2615
106 Ga0207645_10004980 3300025907 Bacteria 9735
107 Ga0207657_10145454 3300025919 Bacteria 1934
108 Ga0207657_10350070 3300025919 Bacteria 1165
109 Ga0207649_10036573 3300025920 Bacteria 2958
110 Ga0207681_10002073 3300025923 Bacteria 12836
111 Ga0207681_10063346 3300025923 Bacteria 2549
112 Ga0207659_10038675 3300025926 Bacteria 3321
113 Ga0207644_10005886 3300025931 Bacteria 7995
114 Ga0207706_10082311 3300025933 Bacteria 2829
115 Ga0207706_10255991 3300025933 Bacteria 1528
116 Ga0207670_10150399 3300025936 Bacteria 1727
117 Ga0207704_10144129 3300025938 Bacteria 1671
118 Ga0207691_10007540 3300025940 Bacteria 10471
119 Ga0207711_10016149 3300025941 Bacteria 6198
120 Ga0207661_10012546 3300025944 Bacteria 6162
121 Ga0207679_10007177 3300025945 Bacteria 7059
122 Ga0207679_10139796 3300025945 Bacteria 1956
123 Ga0207651_10003370 3300025960 Bacteria 7842
124 Ga0207651_10319708 3300025960 Bacteria 1297
125 Ga0207712_10006401 3300025961 Bacteria 7428
126 Ga0207668_10196518 3300025972 Bacteria 1603
127 Ga0207640_10095598 3300025981 Bacteria 2069
128 Ga0207658_10166731 3300025986 Bacteria 1810
129 Ga0207703_10221676 3300026035 Bacteria 1691
130 Ga0207678_10024947 3300026067 Bacteria 5221
131 Ga0207678_10183895 3300026067 Bacteria 1785
132 Ga0207708_10001614 3300026075 Bacteria 16807
133 Ga0207641_10044161 3300026088 Bacteria 3747
134 Ga0207648_10019890 3300026089 Bacteria 6060
135 Ga0207676_10163594 3300026095 Bacteria 1931
136 Ga0207674_10011624 3300026116 Bacteria 9887
137 Ga0207675_100019397 3300026118 Bacteria 6344
138 Ga0207683_10151650 3300026121 Bacteria 2092
139 Ga0207683_10275713 3300026121 Bacteria 1537
140 Ga0207698_10094081 3300026142 Bacteria 2463
141 Ga0207698_10165753 3300026142 Bacteria 1939
142 Ga0207698_10452694 3300026142 Unclassified 1239
143 Ga0207428_10019947 3300027907 Bacteria 5709
144 Ga0207428_10080613 3300027907 Bacteria 2542
145 Ga0207428_10165686 3300027907 Bacteria 1676
146 Ga0268265_10019254 3300028380 Bacteria 4740
147 Ga0268264_10028952 3300028381 Bacteria 4535
148 Ga0268264_10078439 3300028381 Bacteria 2816
149 Ga0316576_10061561 3300031727 Bacteria 2751
150 Ga0307405_10032559 3300031731 Bacteria 3083
151 Ga0307405_10168709 3300031731 Bacteria 1559
152 Ga0307410_10101922 3300031852 Bacteria 2059
153 Ga0307406_10107388 3300031901 Bacteria 1914
154 Ga0307412_10038131 3300031911 Bacteria 3092
155 Ga0307409_100290688 3300031995 Bacteria 1516
156 Ga0307409_100293218 3300031995 Bacteria 1509
157 Ga0307416_100084863 3300032002 Bacteria 2693
158 Ga0307416_100194451 3300032002 Bacteria 1917
159 Ga0307416_100435341 3300032002 Bacteria 1360
160 Ga0307414_10061207 3300032004 Bacteria 2666
161 Ga0307411_10062179 3300032005 Bacteria 2489
162 Ga0307415_100359728 3300032126 Bacteria 1229
163 Ga0373947_0175001 3300035725 Bacteria 1394
164 Ga0373925_0003227 3300037068 Bacteria 12741
165 Ga0395905_0018837 3300037471 Bacteria 6547
166 Ga0395905_0046028 3300037471 Bacteria 4092
167 Ga0436365_0407503 3300039437 Bacteria 219857
168 Ga0436365_1136502 3300039437 Bacteria 1726
169 Ga0436365_1438887 3300039437 Bacteria 84801
170 Ga0439453_0006870 3300041408 Bacteria 1787
171 Ga0439449_0033894 3300042007 Bacteria 1902
172 Ga0439446_0002666 3300042156 Bacteria 4314
173 Ga0439435_0001106 3300042436 Bacteria 4809
174 Ga0439435_0007457 3300042436 Bacteria 2504
175 Ga0439460_0064281 3300042461 Bacteria 1125
176 Ga0451577_0063150 3300042876 Bacteria 3303
177 Ga0466969_0038804 3300044656 Bacteria 2394
178 Ga0453683_0119379 3300044673 Bacteria 1660
179 Ga0453684_0418273 3300044712 Bacteria 1498
180 Ga0496102_0059060 3300048905 Bacteria 3506
181 Ga0496102_0209750 3300048905 Bacteria 1837
182 Ga0496104_0001797 3300048907 Bacteria 18590
183 Ga0496105_0071197 3300048908 Bacteria 2874
184 Ga0496108_0003510 3300048911 Bacteria 12565
185 Ga0496108_0099999 3300048911 Bacteria 2473
186 Ga0496109_0098540 3300048912 Bacteria 2710
187 Ga0496109_0471553 3300048912 Bacteria 1185
188 Ga0496110_0001962 3300048913 Bacteria 15279
189 Ga0496111_0096963 3300048914 Bacteria 2164
190 Ga0496112_0007696 3300048915 Bacteria 9582
191 Ga0496112_0144122 3300048915 Bacteria 2351
192 Ga0496112_0158717 3300048915 Bacteria 2228
193 Ga0496113_0148499 3300048916 Bacteria 1848
194 Ga0496113_0231758 3300048916 Bacteria 1473
195 Ga0501031_0277415 3300049568 Bacteria 1088
196 Ga0501032_0185733 3300049569 Bacteria 1360
197 Ga0501034_0001525 3300049571 Bacteria 30418
198 Ga0501036_0120468 3300049572 Bacteria 2216
199 Ga0501036_0184026 3300049572 Bacteria 1758
200 Ga0501036_0288284 3300049572 Unclassified 1374
201 Ga0501038_0103785 3300049574 Bacteria 2364
202 Ga0501038_0144770 3300049574 Bacteria 1941
203 Ga0501039_0049624 3300049575 Bacteria 3245
204 Ga0501039_0115718 3300049575 Bacteria 2099
205 Ga0501040_0027354 3300049576 Bacteria 3839
206 Ga0501040_0139781 3300049576 Bacteria 1705
207 Ga0501041_0068857 3300049577 Bacteria 2170
208 Ga0501041_0076929 3300049577 Bacteria 2053
209 Ga0501043_0103933 3300049579 Bacteria 2232
210 Ga0501043_0265850 3300049579 Bacteria 1318
211 Ga0501046_0292874 3300049580 Bacteria 1190
212 Ga0501046_0309502 3300049580 Unclassified 1152
213 Ga0501047_0060843 3300049581 Bacteria 3643
214 Ga0501048_0015794 3300049582 Bacteria 5572
215 Ga0501068_0105897 3300049584 Bacteria 1746
216 Ga0501071_0006339 3300049587 Bacteria 7673
217 Ga0501071_0042184 3300049587 Bacteria 3268
218 Ga0501071_0116807 3300049587 Bacteria 1975
219 Ga0501072_0010841 3300049588 Bacteria 6947
220 Ga0501072_0020940 3300049588 Bacteria 5069
221 Ga0501072_0096633 3300049588 Bacteria 2347
222 Ga0501073_0229591 3300049589 Bacteria 1282
223 Ga0501074_0025640 3300049590 Bacteria 4279
224 Ga0501074_0249878 3300049590 Bacteria 1261
225 Ga0501075_0016934 3300049591 Bacteria 5256
226 Ga0501075_0020726 3300049591 Bacteria 4785
227 Ga0501075_0043673 3300049591 Bacteria 3362
228 Ga0501076_0032279 3300049592 Bacteria 4086
229 Ga0501076_0036781 3300049592 Bacteria 3837
230 Ga0501076_0054127 3300049592 Bacteria 3180
231 Ga0501076_0115979 3300049592 Bacteria 2167
232 Ga0501076_0449002 3300049592 Bacteria 1061
233 Ga0501077_0030141 3300049593 Bacteria 3451
234 Ga0501077_0055389 3300049593 Bacteria 2518
235 Ga0501077_0185203 3300049593 Bacteria 1323
236 Ga0501079_0073311 3300049741 Bacteria 2646
237 Ga0501079_0082752 3300049741 Bacteria 2483
238 Ga0501079_0107269 3300049741 Bacteria 2168
239 Ga0501079_0218995 3300049741 Bacteria 1487
240 Ga0501080_0233503 3300049742 Bacteria 1681
241 Ga0501080_0235197 3300049742 Bacteria 1674
242 Ga0501081_0024626 3300049743 Bacteria 4043
243 Ga0501081_0059416 3300049743 Bacteria 2647
244 Ga0501081_0083359 3300049743 Bacteria 2241
245 Ga0501035_0195809 3300049822 Bacteria 1736
246 Ga0501045_0021473 3300049824 Bacteria 4618
247 Ga0501045_0078392 3300049824 Bacteria 2435
248 Ga0501045_0131379 3300049824 Bacteria 1861
249 Ga0501045_0206720 3300049824 Bacteria 1462
250 nmdc:mga06z11_54853_c1 3300050494 Bacteria 2056
251 nmdc:mga05p37_10546_c1 3300050507 Bacteria 10958
252 nmdc:mga05p37_155539_c1 3300050507 Bacteria 2794
253 nmdc:mga05p37_15674_c1 3300050507 Bacteria 9111
254 nmdc:mga05p37_3056_c1 3300050507 Bacteria 19442
255 nmdc:mga05p37_73965_c1 3300050507 Bacteria 4194
256 nmdc:mga0qj67_12913_c1 3300050509 Bacteria 6302
257 nmdc:mga0qj67_24211_c1 3300050509 Bacteria 4678
258 nmdc:mga06r32_14351_c1 3300050510 Bacteria 7190
259 nmdc:mga06r32_156917_c1 3300050510 Bacteria 2257
260 nmdc:mga06r32_2587_c1 3300050510 Bacteria 16158
261 nmdc:mga06r32_54326_c1 3300050510 Bacteria 3841
262 nmdc:mga06r32_72742_c1 3300050510 Bacteria 3328
263 nmdc:mga08y16_130185_c1 3300050511 Bacteria 2617
264 nmdc:mga08y16_2075_c1 3300050511 Bacteria 20545
265 nmdc:mga08y16_47037_c1 3300050511 Bacteria 4516
266 nmdc:mga08y16_77332_c1 3300050511 Bacteria 3470
267 nmdc:mga0n895_20437_c1 3300050512 Bacteria 6176
268 nmdc:mga0n895_27577_c1 3300050512 Bacteria 5397
269 nmdc:mga0n895_54108_c1 3300050512 Bacteria 3946
270 nmdc:mga0rr50_1094_c1 3300050513 Bacteria 14726
271 nmdc:mga0rr50_156866_c1 3300050513 Bacteria 1844
272 nmdc:mga0rr50_27621_c1 3300050513 Bacteria 3977
273 nmdc:mga0a205_51869_c1 3300050515 Bacteria 3960
274 Ga0500562_011228 3300053108 Bacteria 2274
275 Ga0500652_050382 3300053131 Bacteria 1699
276 Ga0500645_000922 3300053730 Bacteria 16914
277 Ga0501084_0051422 3300054114 Bacteria 3448
278 Ga0501084_0058377 3300054114 Bacteria 3229
279 Ga0501084_0062099 3300054114 Bacteria 3128
280 Ga0501084_0166211 3300054114 Bacteria 1862
281 Ga0501084_0190555 3300054114 Bacteria 1730
282 Ga0590071_000102 3300059421 Bacteria 24267
283 Ga0590075_000094 3300059424 Bacteria 22962
284 Ga0590077_011140 3300059426 Bacteria 1854
285 Ga0501082_0083947 3300060353 Bacteria 2748
286 Ga0501082_0402084 3300060353 Bacteria 1195
287 Ga0530510_0223293 3300061734 Bacteria 1400
288 Ga0530510_0254899 3300061734 Bacteria 1308
289 2857720150 2857720070 Bacteria 3189373
290 2928092020 2928090899 Bacteria 3158267
291 2984581214 2984580707 Bacteria 3351387
292 Ga0157380_10257219
293 Ga0065712_10017688
294 Ga0065712_10153381
295 Ga0065715_10007322
296 Ga0070676_10016240
297 Ga0070683_100000326
298 Ga0070690_100023681
299 Ga0070666_10072634
300 Ga0070660_100114708
301 Ga0070689_100216069
302 Ga0070687_100012706
303 Ga0070661_100067672
304 Ga0070668_100239768
305 Ga0070669_100001283
306 Ga0070669_100234178
307 Ga0070671_100037752
308 Ga0070674_100025071
309 Ga0070673_100010560
310 Ga0070667_100169508
311 Ga0070667_100396479
312 Ga0070701_10122991
313 Ga0070700_100013851
314 Ga0070663_100057966
315 Ga0070663_100177240
316 Ga0070678_100120645
317 Ga0070662_100148782
318 Ga0070706_100285265
319 Ga0070707_100337968
320 Ga0070699_100040347
321 Ga0070679_100286503
322 Ga0070684_100000168
323 Ga0070684_100368188
324 Ga0070697_100000839
325 Ga0070672_100008510
326 Ga0070696_100074678
327 Ga0070693_100018838
328 Ga0070664_100001925
329 Ga0070664_100136515
330 Ga0068857_100006720
331 Ga0068857_100187946
332 Ga0068854_100055408
333 Ga0068859_100047170
334 Ga0068866_10003765
335 Ga0068861_100154364
336 Ga0068860_100053870
337 Ga0068860_100120939
338 Ga0068860_100374871
339 Ga0081539_10000189
340 Ga0075365_10192884
341 Ga0075368_10092472
342 Ga0075367_10020005
343 Ga0075428_100007512
344 Ga0075428_100007849
345 Ga0075428_100010179
346 Ga0075430_100018629
347 Ga0075430_100025950
348 Ga0075430_100029331
349 Ga0075431_100048861
350 Ga0075431_100086085
351 Ga0075431_100207909
352 Ga0075433_10139520
353 Ga0075433_10232600
354 Ga0075433_10264272
355 Ga0075434_100052472
356 Ga0075434_100093451
357 Ga0075434_100103097
358 Ga0075434_100229706
359 Ga0075434_100500425
360 Ga0075429_100262191
361 Ga0097620_100047174
362 Ga0075435_100000945
363 Ga0075435_100199974
364 Ga0111539_10011724
365 Ga0111539_10022288
366 Ga0111539_10024643
367 Ga0114129_10004300
368 Ga0114129_10007226
369 Ga0114129_10041409
370 Ga0114129_10077819
371 Ga0114129_10122446
372 Ga0114129_10240471
373 Ga0114129_10340590
374 Ga0105243_10037361
375 Ga0105243_10315164
376 Ga0105248_10331020
377 Ga0105248_10716733
378 Ga0105249_10006979
379 Ga0157370_10086951
380 Ga0157378_10140482
381 Ga0157375_10372232
382 Ga0163163_10014182
383 Ga0163163_10173823
384 Ga0163163_10226616
385 Ga0157380_10055626
386 Ga0157377_10016051
387 Ga0157379_10061641
388 Ga0157379_10485278
389 Ga0213876_10000022
390 Ga0213876_10000153
391 Ga0207697_10000753
392 Ga0207697_10012259
393 Ga0207656_10052586
394 Ga0207642_10003015
395 Ga0207688_10003795
396 Ga0207688_10039691
397 Ga0207645_10004980
398 Ga0207657_10145454
399 Ga0207657_10350070
400 Ga0207649_10036573
401 Ga0207681_10002073
402 Ga0207681_10063346
403 Ga0207659_10038675
404 Ga0207644_10005886
405 Ga0207706_10082311
406 Ga0207706_10255991
407 Ga0207670_10150399
408 Ga0207704_10144129
409 Ga0207691_10007540
410 Ga0207711_10016149
411 Ga0207661_10012546
412 Ga0207679_10007177
413 Ga0207679_10139796
414 Ga0207651_10003370
415 Ga0207651_10319708
416 Ga0207712_10006401
417 Ga0207668_10196518
418 Ga0207640_10095598
419 Ga0207658_10166731
420 Ga0207703_10221676
421 Ga0207678_10024947
422 Ga0207678_10183895
423 Ga0207708_10001614
424 Ga0207641_10044161
425 Ga0207648_10019890
426 Ga0207676_10163594
427 Ga0207674_10011624
428 Ga0207675_100019397
429 Ga0207683_10151650
430 Ga0207683_10275713
431 Ga0207698_10094081
432 Ga0207698_10165753
433 Ga0207698_10452694
434 Ga0207428_10019947
435 Ga0207428_10080613
436 Ga0207428_10165686
437 Ga0268265_10019254
438 Ga0268264_10028952
439 Ga0268264_10078439
440 Ga0316576_10061561
441 Ga0307405_10032559
442 Ga0307405_10168709
443 Ga0307410_10101922
444 Ga0307406_10107388
445 Ga0307412_10038131
446 Ga0307409_100290688
447 Ga0307409_100293218
448 Ga0307416_100084863
449 Ga0307416_100194451
450 Ga0307416_100435341
451 Ga0307414_10061207
452 Ga0307411_10062179
453 Ga0307415_100359728
454 Ga0373947_0175001
455 Ga0373925_0003227
456 Ga0395905_0018837
457 Ga0395905_0046028
458 Ga0436365_0407503
459 Ga0436365_1136502
460 Ga0436365_1438887
461 Ga0439453_0006870
462 Ga0439449_0033894
463 Ga0439446_0002666
464 Ga0439435_0001106
465 Ga0439435_0007457
466 Ga0439460_0064281
467 Ga0451577_0063150
468 Ga0466969_0038804
469 Ga0453683_0119379
470 Ga0453684_0418273
471 Ga0496102_0059060
472 Ga0496102_0209750
473 Ga0496104_0001797
474 Ga0496105_0071197
475 Ga0496108_0003510
476 Ga0496108_0099999
477 Ga0496109_0098540
478 Ga0496109_0471553
479 Ga0496110_0001962
480 Ga0496111_0096963
481 Ga0496112_0007696
482 Ga0496112_0144122
483 Ga0496112_0158717
484 Ga0496113_0148499
485 Ga0496113_0231758
486 Ga0501031_0277415
487 Ga0501032_0185733
488 Ga0501034_0001525
489 Ga0501036_0120468
490 Ga0501036_0184026
491 Ga0501036_0288284
492 Ga0501038_0103785
493 Ga0501038_0144770
494 Ga0501039_0049624
495 Ga0501039_0115718
496 Ga0501040_0027354
497 Ga0501040_0139781
498 Ga0501041_0068857
499 Ga0501041_0076929
500 Ga0501043_0103933
501 Ga0501043_0265850
502 Ga0501046_0292874
503 Ga0501046_0309502
504 Ga0501047_0060843
505 Ga0501048_0015794
506 Ga0501068_0105897
507 Ga0501071_0006339
508 Ga0501071_0042184
509 Ga0501071_0116807
510 Ga0501072_0010841
511 Ga0501072_0020940
512 Ga0501072_0096633
513 Ga0501073_0229591
514 Ga0501074_0025640
515 Ga0501074_0249878
516 Ga0501075_0016934
517 Ga0501075_0020726
518 Ga0501075_0043673
519 Ga0501076_0032279
520 Ga0501076_0036781
521 Ga0501076_0054127
522 Ga0501076_0115979
523 Ga0501076_0449002
524 Ga0501077_0030141
525 Ga0501077_0055389
526 Ga0501077_0185203
527 Ga0501079_0073311
528 Ga0501079_0082752
529 Ga0501079_0107269
530 Ga0501079_0218995
531 Ga0501080_0233503
532 Ga0501080_0235197
533 Ga0501081_0024626
534 Ga0501081_0059416
535 Ga0501081_0083359
536 Ga0501035_0195809
537 Ga0501045_0021473
538 Ga0501045_0078392
539 Ga0501045_0131379
540 Ga0501045_0206720
541 nmdc:mga06z11_54853_c1
542 nmdc:mga05p37_10546_c1
543 nmdc:mga05p37_155539_c1
544 nmdc:mga05p37_15674_c1
545 nmdc:mga05p37_3056_c1
546 nmdc:mga05p37_73965_c1
547 nmdc:mga0qj67_12913_c1
548 nmdc:mga0qj67_24211_c1
549 nmdc:mga06r32_14351_c1
550 nmdc:mga06r32_156917_c1
551 nmdc:mga06r32_2587_c1
552 nmdc:mga06r32_54326_c1
553 nmdc:mga06r32_72742_c1
554 nmdc:mga08y16_130185_c1
555 nmdc:mga08y16_2075_c1
556 nmdc:mga08y16_47037_c1
557 nmdc:mga08y16_77332_c1
558 nmdc:mga0n895_20437_c1
559 nmdc:mga0n895_27577_c1
560 nmdc:mga0n895_54108_c1
561 nmdc:mga0rr50_1094_c1
562 nmdc:mga0rr50_156866_c1
563 nmdc:mga0rr50_27621_c1
564 nmdc:mga0a205_51869_c1
565 Ga0500562_011228
566 Ga0500652_050382
567 Ga0500645_000922
568 Ga0501084_0051422
569 Ga0501084_0058377
570 Ga0501084_0062099
571 Ga0501084_0166211
572 Ga0501084_0190555
573 Ga0590071_000102
574 Ga0590075_000094
575 Ga0590077_011140
576 Ga0501082_0083947
577 Ga0501082_0402084
578 Ga0530510_0223293
579 Ga0530510_0254899
580 2857720150
581 2928092020
582 2984581214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

114

322

0.94

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

5

93

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wat-assembly14.cif.gz_NC complex structure of phf1 0.889 162 183
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.8817 162 183
8b2l-assembly1.cif.gz_o3 cryo-em structure of the plant 80s ribosome 0.8627 163 183
7qiz-assembly1.cif.gz_D specific features and methylation sites of a plant 80s ribosome 0.8461 163 184
6zj3-assembly1.cif.gz_LP cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.8428 163 184
ID Description Score Start End Superfamily
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9248 3 100 1.10.150.130
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9116 115 311 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9098 114 311 1.10.443.10
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9065 3 100 1.10.150.130
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9017 115 311 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A7S4A9F3-F1-model_v4 Tyr recombinase domain-containing protein 0.9247 114 284 GO:0003677
GO:0006310
GO:0015074
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9227 112 270 GO:0003677
GO:0006310
GO:0015074
AF-X0ZSM2-F1-model_v4 Tyr recombinase domain-containing protein 0.9141 119 296 GO:0003677
GO:0006310
GO:0015074
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9103 112 270 GO:0003677
GO:0006310
GO:0015074
AF-X1IKC8-F1-model_v4 Tyr recombinase domain-containing protein 0.8927 111 256 GO:0003677
GO:0006310
GO:0015074

Map