F390251

General Info

Members Datasets Scaffolds Average Seq Length
291 210 582 74

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100970008|Ga0068860_1009700082
Length 85
Sequence MDRLDLFGLFSVTAGVIFYALEPRGRWTILAFAGACALGSVYGFLQGAWPFGLVEIIWTVVAVRRWWSAPRVLRRSDAQSRDGSA

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
188 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
202 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
207 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
208 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
209 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
210 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.34
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.12
Nodule 0
Rhizoplane 3.78
Rhizosphere 69.07
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100970008 3300005843 Unclassified 867
2 JGI24744J21845_10056703 3300002077 Bacteria 719
3 Ga0070658_10868981 3300005327 Bacteria 784
4 Ga0070658_11552109 3300005327 Bacteria 574
5 Ga0070680_100138794 3300005336 Bacteria 2038
6 Ga0070682_100029855 3300005337 Bacteria 3286
7 Ga0070691_10179009 3300005341 Bacteria 1103
8 Ga0070709_10011866 3300005434 Bacteria 4865
9 Ga0070709_11420919 3300005434 Bacteria 562
10 Ga0070714_100629216 3300005435 Bacteria 1032
11 Ga0070714_101818128 3300005435 Bacteria 595
12 Ga0070713_100928093 3300005436 Bacteria 838
13 Ga0070708_102013686 3300005445 Unclassified 535
14 Ga0070663_101058447 3300005455 Bacteria 708
15 Ga0070681_10043569 3300005458 Bacteria 4494
16 Ga0070679_100057603 3300005530 Bacteria 3873
17 Ga0070696_100727208 3300005546 Bacteria 811
18 Ga0070693_100511372 3300005547 Bacteria 853
19 Ga0070665_100093615 3300005548 Bacteria 3010
20 Ga0068855_101226992 3300005563 Bacteria 779
21 Ga0081455_10049749 3300005937 Bacteria 3611
22 Ga0070717_10057734 3300006028 Bacteria 3208
23 Ga0075364_10563032 3300006051 Bacteria 779
24 Ga0070716_100141476 3300006173 Bacteria 1535
25 Ga0070712_100044979 3300006175 Bacteria 3047
26 Ga0070712_101857413 3300006175 Bacteria 527
27 Ga0075367_10239831 3300006178 Bacteria 1136
28 Ga0075369_10247516 3300006186 Bacteria 827
29 Ga0075369_10495315 3300006186 Bacteria 580
30 Ga0097621_100961460 3300006237 Bacteria 798
31 Ga0068871_100435090 3300006358 Bacteria 1173
32 Ga0075433_10768060 3300006852 Bacteria 843
33 Ga0099794_10314075 3300007265 Unclassified 812
34 Ga0105240_10084577 3300009093 Bacteria 3889
35 Ga0105240_11985075 3300009093 Bacteria 605
36 Ga0114129_11256599 3300009147 Bacteria 920
37 Ga0105248_10036060 3300009177 Bacteria 5532
38 Ga0105248_11024116 3300009177 Bacteria 933
39 Ga0105237_10009308 3300009545 Bacteria 10522
40 Ga0105237_10559049 3300009545 Bacteria 1151
41 Ga0105238_10464167 3300009551 Bacteria 1264
42 Ga0105238_10840169 3300009551 Bacteria 935
43 Ga0105238_11877925 3300009551 Bacteria 632
44 Ga0105239_11620705 3300010375 Bacteria 748
45 Ga0157370_11923165 3300013104 Bacteria 531
46 Ga0157374_11564173 3300013296 Bacteria 683
47 Ga0157374_11934597 3300013296 Unclassified 616
48 Ga0157372_12789954 3300013307 Bacteria 560
49 Ga0157375_10006361 3300013308 Bacteria 10295
50 Ga0163163_10185274 3300014325 Bacteria 2129
51 Ga0163163_11108078 3300014325 Bacteria 855
52 Ga0157376_11838009 3300014969 Bacteria 642
53 Ga0209233_1062815 3300025261 Bacteria 711
54 Ga0209564_1041209 3300025295 Bacteria 1242
55 Ga0209758_1020012 3300025297 Bacteria 3191
56 Ga0207426_1086939 3300025302 Bacteria 835
57 Ga0207692_10106994 3300025898 Unclassified 1545
58 Ga0207680_10699546 3300025903 Unclassified 726
59 Ga0207699_10010714 3300025906 Bacteria 4611
60 Ga0207707_10715876 3300025912 Bacteria 839
61 Ga0207695_10029587 3300025913 Bacteria 6046
62 Ga0207671_10018965 3300025914 Bacteria 5269
63 Ga0207671_10181483 3300025914 Bacteria 1638
64 Ga0207693_10040706 3300025915 Bacteria 3659
65 Ga0207660_10106486 3300025917 Bacteria 2103
66 Ga0207652_10056192 3300025921 Bacteria 3388
67 Ga0207681_11540662 3300025923 Bacteria 557
68 Ga0207700_11073621 3300025928 Bacteria 720
69 Ga0207664_10858771 3300025929 Bacteria 816
70 Ga0207664_11728629 3300025929 Bacteria 548
71 Ga0207664_11755239 3300025929 Unclassified 543
72 Ga0207690_11397864 3300025932 Bacteria 585
73 Ga0207665_10284204 3300025939 Bacteria 1232
74 Ga0207665_10288780 3300025939 Bacteria 1223
75 Ga0207640_10114402 3300025981 Bacteria 1920
76 Ga0207640_11238295 3300025981 Bacteria 665
77 Ga0207678_10031061 3300026067 Bacteria 4661
78 Ga0265356_1009379 3300028017 Bacteria 1103
79 Ga0268266_10000769 3300028379 Bacteria 42897
80 Ga0268266_10026239 3300028379 Bacteria 4958
81 Ga0268264_11244766 3300028381 Bacteria 754
82 Ga0265337_1030845 3300028556 Bacteria 1594
83 Ga0265323_10008256 3300028653 Bacteria 4300
84 Ga0265322_10002469 3300028654 Bacteria 5700
85 Ga0265338_10100189 3300028800 Bacteria 2363
86 Ga0265338_10451071 3300028800 Bacteria 911
87 Ga0265338_10940216 3300028800 Bacteria 587
88 Ga0265324_10141298 3300029957 Bacteria 818
89 Ga0265324_10216773 3300029957 Unclassified 650
90 Ga0265762_1002881 3300030760 Bacteria 3074
91 Ga0265330_10038897 3300031235 Bacteria 2114
92 Ga0265325_10002097 3300031241 Bacteria 13623
93 Ga0265329_10125682 3300031242 Bacteria 824
94 Ga0265340_10305103 3300031247 Bacteria 706
95 Ga0265339_10002570 3300031249 Bacteria 12943
96 Ga0265339_10486753 3300031249 Bacteria 570
97 Ga0265327_10000127 3300031251 Bacteria 166247
98 Ga0265316_10004626 3300031344 Bacteria 13648
99 Ga0265316_10109640 3300031344 Bacteria 2091
100 Ga0265316_10208459 3300031344 Bacteria 1446
101 Ga0265313_10000510 3300031595 Bacteria 40838
102 Ga0265313_10007946 3300031595 Bacteria 7126
103 Ga0265314_10119688 3300031711 Bacteria 1660
104 Ga0265342_10027137 3300031712 Bacteria 3583
105 Ga0265342_10502260 3300031712 Bacteria 618
106 Ga0265342_10564165 3300031712 Unclassified 577
107 Ga0307409_101960847 3300031995 Bacteria 615
108 Ga0373926_0424261 3300035083 Unclassified 526
109 Ga0373929_0239615 3300035085 Bacteria 522
110 Ga0373944_0220919 3300035089 Unclassified 692
111 Ga0373952_0220635 3300035092 Bacteria 563
112 Ga0373945_0300820 3300035116 Unclassified 687
113 Ga0373953_0532511 3300035117 Bacteria 522
114 Ga0373960_0382848 3300035121 Bacteria 539
115 Ga0373943_0077651 3300035170 Bacteria 1696
116 Ga0373955_0273927 3300035172 Unclassified 1015
117 Ga0373962_0016338 3300035242 Bacteria 1913
118 Ga0373931_0541286 3300035691 Bacteria 755
119 Ga0373927_0017113 3300035695 Bacteria 4776
120 Ga0373927_0087016 3300035695 Bacteria 2028
121 Ga0373933_1018773 3300035724 Bacteria 545
122 Ga0373947_0020816 3300035725 Bacteria 3791
123 Ga0373947_0061900 3300035725 Bacteria 2275
124 Ga0373947_0080596 3300035725 Bacteria 2014
125 Ga0373937_0354224 3300036401 Bacteria 1391
126 Ga0373937_0891467 3300036401 Bacteria 838
127 Ga0373937_1386275 3300036401 Unclassified 651
128 Ga0373925_0290685 3300037068 Bacteria 1318
129 Ga0373925_0530430 3300037068 Unclassified 967
130 Ga0373925_0571649 3300037068 Bacteria 930
131 Ga0436361_0549747 3300039447 Bacteria 4817
132 Ga0451793_0138418 3300041452 Bacteria 673
133 Ga0453683_0973675 3300044673 Unclassified 563
134 Ga0495638_0029482 3300046460 Bacteria 3538
135 Ga0495638_0266689 3300046460 Bacteria 936
136 Ga0495651_0075738 3300046462 Bacteria 2550
137 Ga0495651_0780363 3300046462 Bacteria 591
138 Ga0495653_0591298 3300046463 Bacteria 683
139 Ga0495580_0270768 3300046472 Bacteria 1160
140 Ga0495580_0314471 3300046472 Bacteria 1065
141 Ga0495639_0325510 3300046475 Unclassified 769
142 Ga0495594_0427171 3300046499 Unclassified 753
143 Ga0495596_0097674 3300046500 Bacteria 1140
144 Ga0495607_0041031 3300046501 Bacteria 2751
145 Ga0495583_0347159 3300046506 Bacteria 586
146 Ga0495606_0010446 3300046507 Bacteria 7705
147 Ga0495606_0138445 3300046507 Bacteria 1439
148 Ga0495606_0141769 3300046507 Bacteria 1419
149 Ga0495606_0568804 3300046507 Bacteria 561
150 Ga0495610_0036504 3300046512 Bacteria 2510
151 Ga0495630_1515372 3300046517 Bacteria 503
152 Ga0495631_0063661 3300046518 Bacteria 1597
153 Ga0495643_0106445 3300046522 Bacteria 1431
154 Ga0495643_0324814 3300046522 Bacteria 695
155 Ga0495648_0129042 3300046524 Bacteria 1347
156 Ga0495648_0473125 3300046524 Bacteria 543
157 Ga0495654_0251154 3300046530 Bacteria 736
158 Ga0495665_0048458 3300046531 Bacteria 2253
159 Ga0495586_0031457 3300046535 Bacteria 2843
160 Ga0495586_0439313 3300046535 Unclassified 752
161 Ga0495622_0445472 3300046557 Bacteria 555
162 Ga0495622_0488113 3300046557 Bacteria 527
163 Ga0495667_0071164 3300046559 Bacteria 2269
164 Ga0495667_0487414 3300046559 Bacteria 773
165 Ga0495625_0015808 3300046660 Bacteria 5958
166 Ga0495661_0018277 3300046665 Bacteria 4614
167 Ga0495588_0059271 3300046674 Bacteria 1980
168 Ga0495657_0656866 3300046675 Bacteria 604
169 Ga0495623_0293781 3300046679 Bacteria 900
170 Ga0495613_0189247 3300046689 Bacteria 1455
171 Ga0495671_0219899 3300046692 Bacteria 919
172 Ga0495649_0147399 3300046694 Bacteria 1237
173 Ga0495600_0124836 3300046809 Bacteria 1674
174 Ga0495581_0163888 3300047315 Bacteria 1300
175 Ga0495604_0258001 3300047317 Bacteria 1186
176 Ga0495604_0465322 3300047317 Bacteria 824
177 Ga0495674_0080989 3300047319 Bacteria 2786
178 Ga0495680_0052577 3300047322 Bacteria 3175
179 Ga0495680_0388725 3300047322 Bacteria 965
180 Ga0495683_0225382 3300047323 Bacteria 834
181 Ga0495673_0200523 3300047469 Bacteria 747
182 Ga0495684_0731287 3300047471 Unclassified 653
183 Ga0495686_0399266 3300047472 Bacteria 738
184 Ga0495602_0195153 3300048088 Bacteria 1549
185 Ga0496100_0201837 3300048903 Bacteria 1450
186 Ga0496100_0443062 3300048903 Bacteria 995
187 Ga0496104_0218464 3300048907 Bacteria 1818
188 Ga0496105_0418617 3300048908 Bacteria 1061
189 Ga0496106_0050864 3300048909 Bacteria 3124
190 Ga0496108_0259869 3300048911 Bacteria 1511
191 Ga0496108_0374228 3300048911 Bacteria 1244
192 Ga0496112_1350235 3300048915 Bacteria 628
193 Ga0496115_0511506 3300048918 Bacteria 964
194 Ga0496116_0000614 3300048919 Bacteria 47004
195 Ga0496117_0155848 3300048920 Bacteria 1344
196 Ga0496117_0312672 3300048920 Bacteria 827
197 Ga0496118_0019208 3300048921 Bacteria 6117
198 Ga0496118_0115341 3300048921 Bacteria 1768
199 Ga0496118_0308746 3300048921 Bacteria 864
200 Ga0496119_0084324 3300048922 Bacteria 1822
201 Ga0496119_0213579 3300048922 Bacteria 991
202 Ga0496119_0247267 3300048922 Bacteria 901
203 Ga0496120_0043081 3300048923 Bacteria 2632
204 Ga0496120_0120934 3300048923 Bacteria 1354
205 Ga0496120_0303434 3300048923 Bacteria 730
206 Ga0496121_0004034 3300048924 Bacteria 20175
207 Ga0496121_0215243 3300048924 Bacteria 1358
208 Ga0496121_0285205 3300048924 Bacteria 1127
209 Ga0496122_0025525 3300048925 Bacteria 5128
210 Ga0496122_0071430 3300048925 Bacteria 2474
211 Ga0496122_0266689 3300048925 Bacteria 946
212 Ga0496123_0029904 3300048926 Bacteria 3998
213 Ga0496123_0034034 3300048926 Bacteria 3657
214 Ga0496123_0336125 3300048926 Bacteria 707
215 Ga0496124_0024074 3300048927 Bacteria 5543
216 Ga0496124_0212173 3300048927 Bacteria 1464
217 Ga0496125_0005549 3300048928 Bacteria 13958
218 Ga0496125_0064344 3300048928 Bacteria 2915
219 Ga0496125_0125845 3300048928 Bacteria 1816
220 Ga0496126_0021086 3300048929 Bacteria 6373
221 Ga0496126_0270760 3300048929 Bacteria 1409
222 Ga0496126_0295447 3300048929 Bacteria 1338
223 Ga0496126_0304670 3300048929 Bacteria 1313
224 Ga0496126_0770597 3300048929 Unclassified 741
225 Ga0501031_0259900 3300049568 Bacteria 1128
226 Ga0501032_0101532 3300049569 Bacteria 1906
227 Ga0501032_0372725 3300049569 Bacteria 918
228 Ga0501033_0078706 3300049570 Bacteria 2419
229 Ga0501034_0001292 3300049571 Bacteria 33866
230 Ga0501034_0491720 3300049571 Bacteria 1141
231 Ga0501038_0395767 3300049574 Bacteria 1069
232 Ga0501039_0528313 3300049575 Bacteria 926
233 Ga0501043_0641785 3300049579 Bacteria 780
234 Ga0501047_0043848 3300049581 Bacteria 4320
235 Ga0501068_0077663 3300049584 Bacteria 2033
236 Ga0501070_0045506 3300049586 Bacteria 3650
237 Ga0501070_0141439 3300049586 Bacteria 1987
238 Ga0501080_0279142 3300049742 Bacteria 1519
239 Ga0501035_0918725 3300049822 Bacteria 692
240 Ga0501035_1293321 3300049822 Bacteria 562
241 Ga0501044_0021986 3300049823 Bacteria 6801
242 Ga0501044_0099093 3300049823 Bacteria 2933
243 nmdc:mga00v17_16967_c1 3300050491 Bacteria 4112
244 nmdc:mga0yw44_182649_c1 3300050492 Bacteria 1381
245 nmdc:mga05p37_288820_c1 3300050507 Bacteria 1953
246 nmdc:mga0n895_2082565_c1 3300050512 Unclassified 524
247 nmdc:mga08x19_440511_c1 3300050514 Bacteria 916
248 nmdc:mga08x19_639674_c1 3300050514 Bacteria 754
249 nmdc:mga0sz30_128665_c1 3300050516 Bacteria 1115
250 nmdc:mga0sz30_274080_c1 3300050516 Bacteria 752
251 Ga0495601_0449224 3300053077 Bacteria 834
252 Ga0495655_0099162 3300053083 Bacteria 860
253 Ga0495595_0179804 3300053084 Bacteria 1049
254 Ga0500643_038714 3300053087 Bacteria 1412
255 Ga0500643_104546 3300053087 Bacteria 767
256 Ga0500644_0025242 3300053088 Bacteria 1826
257 Ga0500646_0019041 3300053090 Bacteria 1813
258 Ga0500651_0121827 3300053093 Bacteria 1583
259 Ga0500651_0179612 3300053093 Bacteria 1258
260 Ga0500651_0521582 3300053093 Bacteria 653
261 Ga0500566_0000253 3300053094 Bacteria 28776
262 Ga0500641_0010086 3300053096 Bacteria 3405
263 Ga0500650_0003633 3300053098 Bacteria 5420
264 Ga0500556_0000030 3300053104 Bacteria 165098
265 Ga0500562_163951 3300053108 Bacteria 604
266 Ga0500569_080020 3300053109 Bacteria 1043
267 Ga0500594_0282600 3300053118 Bacteria 555
268 Ga0500607_058441 3300053121 Bacteria 2029
269 Ga0500608_080908 3300053122 Bacteria 1532
270 Ga0500618_014460 3300053125 Bacteria 2014
271 Ga0500642_0000028 3300053130 Bacteria 117281
272 Ga0500652_000170 3300053131 Bacteria 25102
273 Ga0500658_0248389 3300053134 Bacteria 817
274 Ga0500559_0000204 3300053136 Bacteria 47160
275 Ga0500568_0000772 3300053139 Bacteria 22609
276 Ga0500590_020983 3300053148 Bacteria 3392
277 Ga0500604_0057799 3300053151 Bacteria 1211
278 Ga0500616_0000413 3300053153 Bacteria 57779
279 Ga0500622_0000968 3300053156 Bacteria 24366
280 Ga0500634_0052191 3300053161 Bacteria 2197
281 Ga0500634_0110487 3300053161 Bacteria 1357
282 Ga0500636_0000598 3300053177 Bacteria 19638
283 Ga0500636_0086211 3300053177 Bacteria 1804
284 Ga0500637_0032084 3300053178 Bacteria 2928
285 Ga0500645_033525 3300053730 Bacteria 1536
286 Ga0501084_1746310 3300054114 Bacteria 520
287 2603859755 2602042107 Bacteria 6226103
288 2857530642 2857524615 Bacteria 6615449
289 2885415926 2885409591 Bacteria 9235467
290 2893070287 2893066018 Bacteria 6158120
291 2919076240 2919073203 Bacteria 6531949
292 Ga0068860_100970008
293 JGI24744J21845_10056703
294 Ga0070658_10868981
295 Ga0070658_11552109
296 Ga0070680_100138794
297 Ga0070682_100029855
298 Ga0070691_10179009
299 Ga0070709_10011866
300 Ga0070709_11420919
301 Ga0070714_100629216
302 Ga0070714_101818128
303 Ga0070713_100928093
304 Ga0070708_102013686
305 Ga0070663_101058447
306 Ga0070681_10043569
307 Ga0070679_100057603
308 Ga0070696_100727208
309 Ga0070693_100511372
310 Ga0070665_100093615
311 Ga0068855_101226992
312 Ga0081455_10049749
313 Ga0070717_10057734
314 Ga0075364_10563032
315 Ga0070716_100141476
316 Ga0070712_100044979
317 Ga0070712_101857413
318 Ga0075367_10239831
319 Ga0075369_10247516
320 Ga0075369_10495315
321 Ga0097621_100961460
322 Ga0068871_100435090
323 Ga0075433_10768060
324 Ga0099794_10314075
325 Ga0105240_10084577
326 Ga0105240_11985075
327 Ga0114129_11256599
328 Ga0105248_10036060
329 Ga0105248_11024116
330 Ga0105237_10009308
331 Ga0105237_10559049
332 Ga0105238_10464167
333 Ga0105238_10840169
334 Ga0105238_11877925
335 Ga0105239_11620705
336 Ga0157370_11923165
337 Ga0157374_11564173
338 Ga0157374_11934597
339 Ga0157372_12789954
340 Ga0157375_10006361
341 Ga0163163_10185274
342 Ga0163163_11108078
343 Ga0157376_11838009
344 Ga0209233_1062815
345 Ga0209564_1041209
346 Ga0209758_1020012
347 Ga0207426_1086939
348 Ga0207692_10106994
349 Ga0207680_10699546
350 Ga0207699_10010714
351 Ga0207707_10715876
352 Ga0207695_10029587
353 Ga0207671_10018965
354 Ga0207671_10181483
355 Ga0207693_10040706
356 Ga0207660_10106486
357 Ga0207652_10056192
358 Ga0207681_11540662
359 Ga0207700_11073621
360 Ga0207664_10858771
361 Ga0207664_11728629
362 Ga0207664_11755239
363 Ga0207690_11397864
364 Ga0207665_10284204
365 Ga0207665_10288780
366 Ga0207640_10114402
367 Ga0207640_11238295
368 Ga0207678_10031061
369 Ga0265356_1009379
370 Ga0268266_10000769
371 Ga0268266_10026239
372 Ga0268264_11244766
373 Ga0265337_1030845
374 Ga0265323_10008256
375 Ga0265322_10002469
376 Ga0265338_10100189
377 Ga0265338_10451071
378 Ga0265338_10940216
379 Ga0265324_10141298
380 Ga0265324_10216773
381 Ga0265762_1002881
382 Ga0265330_10038897
383 Ga0265325_10002097
384 Ga0265329_10125682
385 Ga0265340_10305103
386 Ga0265339_10002570
387 Ga0265339_10486753
388 Ga0265327_10000127
389 Ga0265316_10004626
390 Ga0265316_10109640
391 Ga0265316_10208459
392 Ga0265313_10000510
393 Ga0265313_10007946
394 Ga0265314_10119688
395 Ga0265342_10027137
396 Ga0265342_10502260
397 Ga0265342_10564165
398 Ga0307409_101960847
399 Ga0373926_0424261
400 Ga0373929_0239615
401 Ga0373944_0220919
402 Ga0373952_0220635
403 Ga0373945_0300820
404 Ga0373953_0532511
405 Ga0373960_0382848
406 Ga0373943_0077651
407 Ga0373955_0273927
408 Ga0373962_0016338
409 Ga0373931_0541286
410 Ga0373927_0017113
411 Ga0373927_0087016
412 Ga0373933_1018773
413 Ga0373947_0020816
414 Ga0373947_0061900
415 Ga0373947_0080596
416 Ga0373937_0354224
417 Ga0373937_0891467
418 Ga0373937_1386275
419 Ga0373925_0290685
420 Ga0373925_0530430
421 Ga0373925_0571649
422 Ga0436361_0549747
423 Ga0451793_0138418
424 Ga0453683_0973675
425 Ga0495638_0029482
426 Ga0495638_0266689
427 Ga0495651_0075738
428 Ga0495651_0780363
429 Ga0495653_0591298
430 Ga0495580_0270768
431 Ga0495580_0314471
432 Ga0495639_0325510
433 Ga0495594_0427171
434 Ga0495596_0097674
435 Ga0495607_0041031
436 Ga0495583_0347159
437 Ga0495606_0010446
438 Ga0495606_0138445
439 Ga0495606_0141769
440 Ga0495606_0568804
441 Ga0495610_0036504
442 Ga0495630_1515372
443 Ga0495631_0063661
444 Ga0495643_0106445
445 Ga0495643_0324814
446 Ga0495648_0129042
447 Ga0495648_0473125
448 Ga0495654_0251154
449 Ga0495665_0048458
450 Ga0495586_0031457
451 Ga0495586_0439313
452 Ga0495622_0445472
453 Ga0495622_0488113
454 Ga0495667_0071164
455 Ga0495667_0487414
456 Ga0495625_0015808
457 Ga0495661_0018277
458 Ga0495588_0059271
459 Ga0495657_0656866
460 Ga0495623_0293781
461 Ga0495613_0189247
462 Ga0495671_0219899
463 Ga0495649_0147399
464 Ga0495600_0124836
465 Ga0495581_0163888
466 Ga0495604_0258001
467 Ga0495604_0465322
468 Ga0495674_0080989
469 Ga0495680_0052577
470 Ga0495680_0388725
471 Ga0495683_0225382
472 Ga0495673_0200523
473 Ga0495684_0731287
474 Ga0495686_0399266
475 Ga0495602_0195153
476 Ga0496100_0201837
477 Ga0496100_0443062
478 Ga0496104_0218464
479 Ga0496105_0418617
480 Ga0496106_0050864
481 Ga0496108_0259869
482 Ga0496108_0374228
483 Ga0496112_1350235
484 Ga0496115_0511506
485 Ga0496116_0000614
486 Ga0496117_0155848
487 Ga0496117_0312672
488 Ga0496118_0019208
489 Ga0496118_0115341
490 Ga0496118_0308746
491 Ga0496119_0084324
492 Ga0496119_0213579
493 Ga0496119_0247267
494 Ga0496120_0043081
495 Ga0496120_0120934
496 Ga0496120_0303434
497 Ga0496121_0004034
498 Ga0496121_0215243
499 Ga0496121_0285205
500 Ga0496122_0025525
501 Ga0496122_0071430
502 Ga0496122_0266689
503 Ga0496123_0029904
504 Ga0496123_0034034
505 Ga0496123_0336125
506 Ga0496124_0024074
507 Ga0496124_0212173
508 Ga0496125_0005549
509 Ga0496125_0064344
510 Ga0496125_0125845
511 Ga0496126_0021086
512 Ga0496126_0270760
513 Ga0496126_0295447
514 Ga0496126_0304670
515 Ga0496126_0770597
516 Ga0501031_0259900
517 Ga0501032_0101532
518 Ga0501032_0372725
519 Ga0501033_0078706
520 Ga0501034_0001292
521 Ga0501034_0491720
522 Ga0501038_0395767
523 Ga0501039_0528313
524 Ga0501043_0641785
525 Ga0501047_0043848
526 Ga0501068_0077663
527 Ga0501070_0045506
528 Ga0501070_0141439
529 Ga0501080_0279142
530 Ga0501035_0918725
531 Ga0501035_1293321
532 Ga0501044_0021986
533 Ga0501044_0099093
534 nmdc:mga00v17_16967_c1
535 nmdc:mga0yw44_182649_c1
536 nmdc:mga05p37_288820_c1
537 nmdc:mga0n895_2082565_c1
538 nmdc:mga08x19_440511_c1
539 nmdc:mga08x19_639674_c1
540 nmdc:mga0sz30_128665_c1
541 nmdc:mga0sz30_274080_c1
542 Ga0495601_0449224
543 Ga0495655_0099162
544 Ga0495595_0179804
545 Ga0500643_038714
546 Ga0500643_104546
547 Ga0500644_0025242
548 Ga0500646_0019041
549 Ga0500651_0121827
550 Ga0500651_0179612
551 Ga0500651_0521582
552 Ga0500566_0000253
553 Ga0500641_0010086
554 Ga0500650_0003633
555 Ga0500556_0000030
556 Ga0500562_163951
557 Ga0500569_080020
558 Ga0500594_0282600
559 Ga0500607_058441
560 Ga0500608_080908
561 Ga0500618_014460
562 Ga0500642_0000028
563 Ga0500652_000170
564 Ga0500658_0248389
565 Ga0500559_0000204
566 Ga0500568_0000772
567 Ga0500590_020983
568 Ga0500604_0057799
569 Ga0500616_0000413
570 Ga0500622_0000968
571 Ga0500634_0052191
572 Ga0500634_0110487
573 Ga0500636_0000598
574 Ga0500636_0086211
575 Ga0500637_0032084
576 Ga0500645_033525
577 Ga0501084_1746310
578 2603859755
579 2857530642
580 2885415926
581 2893070287
582 2919076240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map