F390229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 181 | 290 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100033253|Ga0068853_1000332532 |
| Length | 274 |
| Sequence | MPAVPDLSLILPAYNEQARIAGTIREVHAYGLSRRLTIEIIVAADGTDGTREAAGSLCGEIPHLTVLGSPERRGKGHGIRQAVRKATGKFIGFADADNKTPITEFDNFLPLLQEGCHAVIGSRGLSESRIERPQRWYRRWGSRGFRVLLSTLIGLPNIRDTQCGFKFFQAHVARDLFARQRIDGYMFDVEILMLAARAGYGIKSVPVRWRDDADSRLELFRGNVRNLVDVLKIRFGSYPQPLRTHEAGAGTPQTVPGAVQNGVVSNTVMKNRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 178 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 179 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 3.44 |
| Rhizosphere | 94.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10069174 | 3300005290 | Bacteria | 7821 |
| 2 | Ga0065715_10394816 | 3300005293 | Unclassified | 889 |
| 3 | Ga0070683_100000579 | 3300005329 | Bacteria | 26124 |
| 4 | Ga0070683_100790912 | 3300005329 | Bacteria | 909 |
| 5 | Ga0070670_100015108 | 3300005331 | Bacteria | 6626 |
| 6 | Ga0070666_10294895 | 3300005335 | Unclassified | 1154 |
| 7 | Ga0070680_100395757 | 3300005336 | Bacteria | 1177 |
| 8 | Ga0068868_100635441 | 3300005338 | Unclassified | 949 |
| 9 | Ga0070689_100048872 | 3300005340 | Bacteria | 3264 |
| 10 | Ga0070661_100313192 | 3300005344 | Unclassified | 1224 |
| 11 | Ga0070669_100245503 | 3300005353 | Bacteria | 1424 |
| 12 | Ga0070671_100058324 | 3300005355 | Bacteria | 3214 |
| 13 | Ga0070671_100461507 | 3300005355 | Unclassified | 1090 |
| 14 | Ga0070673_100021578 | 3300005364 | Bacteria | 4672 |
| 15 | Ga0070673_100022700 | 3300005364 | Unclassified | 4571 |
| 16 | Ga0070673_100116671 | 3300005364 | Bacteria | 2221 |
| 17 | Ga0070673_100218106 | 3300005364 | Bacteria | 1650 |
| 18 | Ga0070688_100024794 | 3300005365 | Bacteria | 3544 |
| 19 | Ga0070688_100456334 | 3300005365 | Bacteria | 956 |
| 20 | Ga0070659_100124844 | 3300005366 | Bacteria | 2088 |
| 21 | Ga0070714_100112187 | 3300005435 | Unclassified | 2416 |
| 22 | Ga0070714_100521432 | 3300005435 | Bacteria | 1135 |
| 23 | Ga0070713_100005020 | 3300005436 | Bacteria | 8990 |
| 24 | Ga0070713_100544694 | 3300005436 | Unclassified | 1098 |
| 25 | Ga0070700_100218152 | 3300005441 | Bacteria | 1350 |
| 26 | Ga0070700_100601860 | 3300005441 | Bacteria | 861 |
| 27 | Ga0070662_100537303 | 3300005457 | Bacteria | 978 |
| 28 | Ga0070681_10042540 | 3300005458 | Unclassified | 4552 |
| 29 | Ga0068867_100158063 | 3300005459 | Bacteria | 1786 |
| 30 | Ga0070685_10219367 | 3300005466 | Bacteria | 1245 |
| 31 | Ga0070685_10306165 | 3300005466 | Bacteria | 1072 |
| 32 | Ga0070706_100039965 | 3300005467 | Bacteria | 4330 |
| 33 | Ga0070707_100002532 | 3300005468 | Bacteria | 17383 |
| 34 | Ga0070698_100064138 | 3300005471 | Bacteria | 3702 |
| 35 | Ga0070679_100288649 | 3300005530 | Bacteria | 1592 |
| 36 | Ga0070684_100000553 | 3300005535 | Bacteria | 25675 |
| 37 | Ga0070684_100029399 | 3300005535 | Unclassified | 4657 |
| 38 | Ga0070684_100163060 | 3300005535 | Bacteria | 2023 |
| 39 | Ga0070697_100386206 | 3300005536 | Bacteria | 1213 |
| 40 | Ga0068853_100033253 | 3300005539 | Unclassified | 4374 |
| 41 | Ga0070672_100058847 | 3300005543 | Bacteria | 3022 |
| 42 | Ga0070672_100234227 | 3300005543 | Bacteria | 1543 |
| 43 | Ga0070672_100348882 | 3300005543 | Bacteria | 1261 |
| 44 | Ga0070665_100023099 | 3300005548 | Bacteria | 6265 |
| 45 | Ga0070665_100161728 | 3300005548 | Bacteria | 2241 |
| 46 | Ga0070665_100481223 | 3300005548 | Bacteria | 1252 |
| 47 | Ga0070704_100068464 | 3300005549 | Bacteria | 2567 |
| 48 | Ga0070664_100000785 | 3300005564 | Bacteria | 24477 |
| 49 | Ga0070664_100191711 | 3300005564 | Bacteria | 1821 |
| 50 | Ga0070664_100242638 | 3300005564 | Bacteria | 1618 |
| 51 | Ga0068857_100239957 | 3300005577 | Bacteria | 1659 |
| 52 | Ga0068856_100370543 | 3300005614 | Bacteria | 1451 |
| 53 | Ga0068859_100003129 | 3300005617 | Bacteria | 16814 |
| 54 | Ga0068859_100136074 | 3300005617 | Bacteria | 2530 |
| 55 | Ga0068864_100092258 | 3300005618 | Bacteria | 2673 |
| 56 | Ga0068864_100179667 | 3300005618 | Bacteria | 1934 |
| 57 | Ga0068861_100412687 | 3300005719 | Bacteria | 1201 |
| 58 | Ga0068863_100067620 | 3300005841 | Bacteria | 3380 |
| 59 | Ga0068863_100145690 | 3300005841 | Bacteria | 2265 |
| 60 | Ga0068858_100632827 | 3300005842 | Unclassified | 1039 |
| 61 | Ga0068862_100206793 | 3300005844 | Bacteria | 1772 |
| 62 | Ga0068862_100427431 | 3300005844 | Bacteria | 1244 |
| 63 | Ga0081539_10009615 | 3300005985 | Bacteria | 8031 |
| 64 | Ga0070712_100231008 | 3300006175 | Bacteria | 1469 |
| 65 | Ga0075367_10006202 | 3300006178 | Bacteria | 6022 |
| 66 | Ga0075428_100006442 | 3300006844 | Bacteria | 13060 |
| 67 | Ga0075428_100065190 | 3300006844 | Bacteria | 3989 |
| 68 | Ga0075430_100043311 | 3300006846 | Bacteria | 3804 |
| 69 | Ga0075430_100132839 | 3300006846 | Bacteria | 2074 |
| 70 | Ga0075431_100000173 | 3300006847 | Bacteria | 45790 |
| 71 | Ga0075433_10079142 | 3300006852 | Bacteria | 2896 |
| 72 | Ga0075433_10548714 | 3300006852 | Bacteria | 1016 |
| 73 | Ga0075434_100026829 | 3300006871 | Bacteria | 5650 |
| 74 | Ga0075434_100370423 | 3300006871 | Bacteria | 1453 |
| 75 | Ga0075429_100005706 | 3300006880 | Bacteria | 10739 |
| 76 | Ga0075429_100420493 | 3300006880 | Bacteria | 1171 |
| 77 | Ga0075436_100271911 | 3300006914 | Bacteria | 1210 |
| 78 | Ga0097620_100003129 | 3300006931 | Bacteria | 16814 |
| 79 | Ga0097620_100136067 | 3300006931 | Bacteria | 2530 |
| 80 | Ga0075435_100017054 | 3300007076 | Bacteria | 5487 |
| 81 | Ga0105240_10001475 | 3300009093 | Bacteria | 40095 |
| 82 | Ga0105240_10214060 | 3300009093 | Bacteria | 2249 |
| 83 | Ga0111539_10690282 | 3300009094 | Bacteria | 1188 |
| 84 | Ga0111539_10869261 | 3300009094 | Bacteria | 1049 |
| 85 | Ga0105245_10613948 | 3300009098 | Bacteria | 1115 |
| 86 | Ga0105247_10024134 | 3300009101 | Unclassified | 3663 |
| 87 | Ga0105247_10061873 | 3300009101 | Bacteria | 2322 |
| 88 | Ga0105247_10291860 | 3300009101 | Bacteria | 1128 |
| 89 | Ga0114129_10203519 | 3300009147 | Bacteria | 2680 |
| 90 | Ga0105241_10162374 | 3300009174 | Bacteria | 1838 |
| 91 | Ga0105242_10075340 | 3300009176 | Unclassified | 2809 |
| 92 | Ga0105242_10232636 | 3300009176 | Bacteria | 1652 |
| 93 | Ga0105242_10539080 | 3300009176 | Bacteria | 1117 |
| 94 | Ga0105248_10018567 | 3300009177 | Bacteria | 7688 |
| 95 | Ga0105248_10026281 | 3300009177 | Bacteria | 6476 |
| 96 | Ga0105248_10160047 | 3300009177 | Bacteria | 2540 |
| 97 | Ga0105248_10267831 | 3300009177 | Bacteria | 1923 |
| 98 | Ga0105248_10641763 | 3300009177 | Bacteria | 1198 |
| 99 | Ga0105248_10686019 | 3300009177 | Bacteria | 1156 |
| 100 | Ga0105248_11077124 | 3300009177 | Bacteria | 908 |
| 101 | Ga0105237_10001652 | 3300009545 | Bacteria | 28953 |
| 102 | Ga0105249_10236393 | 3300009553 | Bacteria | 1804 |
| 103 | Ga0105249_10383299 | 3300009553 | Bacteria | 1432 |
| 104 | Ga0105239_10851996 | 3300010375 | Unclassified | 1045 |
| 105 | Ga0157370_10634747 | 3300013104 | Bacteria | 977 |
| 106 | Ga0157369_10015825 | 3300013105 | Bacteria | 8496 |
| 107 | Ga0157369_10200148 | 3300013105 | Bacteria | 2097 |
| 108 | Ga0163162_10267763 | 3300013306 | Bacteria | 1840 |
| 109 | Ga0163162_10267890 | 3300013306 | Bacteria | 1840 |
| 110 | Ga0163162_10884515 | 3300013306 | Bacteria | 1007 |
| 111 | Ga0157375_10055126 | 3300013308 | Bacteria | 3918 |
| 112 | Ga0157375_10757962 | 3300013308 | Bacteria | 1121 |
| 113 | Ga0157375_11135888 | 3300013308 | Bacteria | 915 |
| 114 | Ga0163163_10028996 | 3300014325 | Bacteria | 5322 |
| 115 | Ga0163163_10039369 | 3300014325 | Unclassified | 4613 |
| 116 | Ga0163163_10396183 | 3300014325 | Bacteria | 1439 |
| 117 | Ga0163163_10852377 | 3300014325 | Unclassified | 975 |
| 118 | Ga0157380_10073891 | 3300014326 | Bacteria | 2766 |
| 119 | Ga0157380_10335687 | 3300014326 | Bacteria | 1407 |
| 120 | Ga0157379_10338921 | 3300014968 | Bacteria | 1375 |
| 121 | Ga0157376_10367087 | 3300014969 | Bacteria | 1382 |
| 122 | Ga0157376_10537955 | 3300014969 | Unclassified | 1154 |
| 123 | Ga0157376_10888654 | 3300014969 | Bacteria | 908 |
| 124 | Ga0207697_10025873 | 3300025315 | Bacteria | 2399 |
| 125 | Ga0207680_10274050 | 3300025903 | Bacteria | 1171 |
| 126 | Ga0207680_10355892 | 3300025903 | Bacteria | 1029 |
| 127 | Ga0207684_10033689 | 3300025910 | Bacteria | 4357 |
| 128 | Ga0207707_10106676 | 3300025912 | Unclassified | 2449 |
| 129 | Ga0207695_10007121 | 3300025913 | Bacteria | 14322 |
| 130 | Ga0207671_10002144 | 3300025914 | Bacteria | 21531 |
| 131 | Ga0207693_10569828 | 3300025915 | Unclassified | 882 |
| 132 | Ga0207660_10325653 | 3300025917 | Bacteria | 1228 |
| 133 | Ga0207662_10267902 | 3300025918 | Bacteria | 1126 |
| 134 | Ga0207649_10164846 | 3300025920 | Bacteria | 1538 |
| 135 | Ga0207652_10144248 | 3300025921 | Bacteria | 2130 |
| 136 | Ga0207646_10003602 | 3300025922 | Bacteria | 17364 |
| 137 | Ga0207650_10011692 | 3300025925 | Bacteria | 6048 |
| 138 | Ga0207650_10138590 | 3300025925 | Bacteria | 1911 |
| 139 | Ga0207650_10584408 | 3300025925 | Bacteria | 938 |
| 140 | Ga0207687_10394121 | 3300025927 | Bacteria | 1137 |
| 141 | Ga0207700_10011307 | 3300025928 | Bacteria | 5685 |
| 142 | Ga0207664_10341193 | 3300025929 | Bacteria | 1324 |
| 143 | Ga0207644_10348232 | 3300025931 | Bacteria | 1202 |
| 144 | Ga0207644_10421800 | 3300025931 | Unclassified | 1093 |
| 145 | Ga0207686_10314223 | 3300025934 | Unclassified | 1168 |
| 146 | Ga0207670_10173761 | 3300025936 | Bacteria | 1617 |
| 147 | Ga0207670_10521057 | 3300025936 | Unclassified | 968 |
| 148 | Ga0207691_10006064 | 3300025940 | Bacteria | 11677 |
| 149 | Ga0207691_10023148 | 3300025940 | Bacteria | 5849 |
| 150 | Ga0207691_10200304 | 3300025940 | Bacteria | 1738 |
| 151 | Ga0207711_10050789 | 3300025941 | Bacteria | 3551 |
| 152 | Ga0207711_10091047 | 3300025941 | Unclassified | 2682 |
| 153 | Ga0207711_10137719 | 3300025941 | Bacteria | 2194 |
| 154 | Ga0207711_10267247 | 3300025941 | Unclassified | 1573 |
| 155 | Ga0207711_10538541 | 3300025941 | Bacteria | 1089 |
| 156 | Ga0207711_10609339 | 3300025941 | Unclassified | 1019 |
| 157 | Ga0207689_10029071 | 3300025942 | Bacteria | 4619 |
| 158 | Ga0207661_10147468 | 3300025944 | Bacteria | 2031 |
| 159 | Ga0207661_10601113 | 3300025944 | Bacteria | 1010 |
| 160 | Ga0207679_10047377 | 3300025945 | Bacteria | 3122 |
| 161 | Ga0207679_10118209 | 3300025945 | Bacteria | 2105 |
| 162 | Ga0207679_10119677 | 3300025945 | Bacteria | 2094 |
| 163 | Ga0207651_10021201 | 3300025960 | Bacteria | 3943 |
| 164 | Ga0207651_10070324 | 3300025960 | Bacteria | 2476 |
| 165 | Ga0207651_10080740 | 3300025960 | Bacteria | 2342 |
| 166 | Ga0207651_10423974 | 3300025960 | Unclassified | 1136 |
| 167 | Ga0207651_10602939 | 3300025960 | Unclassified | 960 |
| 168 | Ga0207712_10299515 | 3300025961 | Unclassified | 1319 |
| 169 | Ga0207658_10189673 | 3300025986 | Bacteria | 1708 |
| 170 | Ga0207658_10365095 | 3300025986 | Bacteria | 1261 |
| 171 | Ga0207703_10035289 | 3300026035 | Unclassified | 3974 |
| 172 | Ga0207639_10024424 | 3300026041 | Unclassified | 4374 |
| 173 | Ga0207641_10003271 | 3300026088 | Bacteria | 14430 |
| 174 | Ga0207641_10032901 | 3300026088 | Unclassified | 4307 |
| 175 | Ga0207641_10444760 | 3300026088 | Bacteria | 1252 |
| 176 | Ga0207676_10117608 | 3300026095 | Bacteria | 2236 |
| 177 | Ga0207676_10145318 | 3300026095 | Bacteria | 2036 |
| 178 | Ga0207676_10589357 | 3300026095 | Bacteria | 1067 |
| 179 | Ga0207675_100160270 | 3300026118 | Bacteria | 2145 |
| 180 | Ga0207683_10341427 | 3300026121 | Bacteria | 1373 |
| 181 | Ga0268266_10032852 | 3300028379 | Bacteria | 4410 |
| 182 | Ga0268266_10483090 | 3300028379 | Bacteria | 1181 |
| 183 | Ga0268265_10009953 | 3300028380 | Bacteria | 6423 |
| 184 | Ga0268265_10387250 | 3300028380 | Bacteria | 1288 |
| 185 | Ga0265323_10001932 | 3300028653 | Bacteria | 9777 |
| 186 | Ga0265316_10087330 | 3300031344 | Bacteria | 2383 |
| 187 | Ga0265316_10220344 | 3300031344 | Bacteria | 1400 |
| 188 | Ga0265316_10263837 | 3300031344 | Bacteria | 1262 |
| 189 | Ga0373934_0089813 | 3300035086 | Bacteria | 1238 |
| 190 | Ga0373937_0263121 | 3300036401 | Bacteria | 1627 |
| 191 | Ga0373925_0088996 | 3300037068 | Bacteria | 2358 |
| 192 | Ga0373925_0224880 | 3300037068 | Unclassified | 1499 |
| 193 | Ga0436365_1567635 | 3300039437 | Bacteria | 967 |
| 194 | Ga0466963_0164720 | 3300044694 | Unclassified | 1544 |
| 195 | Ga0453684_0024418 | 3300044712 | Bacteria | 8837 |
| 196 | Ga0453684_0071200 | 3300044712 | Bacteria | 4398 |
| 197 | Ga0453684_0265311 | 3300044712 | Bacteria | 1965 |
| 198 | Ga0453684_0948632 | 3300044712 | Unclassified | 918 |
| 199 | Ga0451576_0264108 | 3300045051 | Bacteria | 1799 |
| 200 | Ga0495592_0046715 | 3300046454 | Bacteria | 3227 |
| 201 | Ga0495651_0215730 | 3300046462 | Unclassified | 1332 |
| 202 | Ga0495580_0000955 | 3300046472 | Bacteria | 25312 |
| 203 | Ga0495580_0028043 | 3300046472 | Bacteria | 4095 |
| 204 | Ga0495582_0021863 | 3300046473 | Bacteria | 3500 |
| 205 | Ga0495662_0271346 | 3300046476 | Unclassified | 835 |
| 206 | Ga0495664_0208246 | 3300046477 | Bacteria | 1184 |
| 207 | Ga0495594_0068265 | 3300046499 | Bacteria | 1974 |
| 208 | Ga0495608_0125793 | 3300046511 | Unclassified | 1642 |
| 209 | Ga0495608_0377405 | 3300046511 | Bacteria | 869 |
| 210 | Ga0495628_0098742 | 3300046516 | Bacteria | 2255 |
| 211 | Ga0495666_0056667 | 3300046526 | Unclassified | 1877 |
| 212 | Ga0495652_0422520 | 3300046529 | Bacteria | 939 |
| 213 | Ga0495665_0006125 | 3300046531 | Bacteria | 6495 |
| 214 | Ga0495640_0144538 | 3300046533 | Bacteria | 1531 |
| 215 | Ga0495645_0063007 | 3300046543 | Unclassified | 2685 |
| 216 | Ga0495645_0167912 | 3300046543 | Bacteria | 1512 |
| 217 | Ga0495645_0192388 | 3300046543 | Bacteria | 1389 |
| 218 | Ga0495645_0269641 | 3300046543 | Bacteria | 1124 |
| 219 | Ga0495667_0002274 | 3300046559 | Bacteria | 12866 |
| 220 | Ga0495634_0041558 | 3300046642 | Bacteria | 3122 |
| 221 | Ga0495623_0033322 | 3300046679 | Bacteria | 3305 |
| 222 | Ga0495623_0085981 | 3300046679 | Bacteria | 1939 |
| 223 | Ga0495623_0253133 | 3300046679 | Bacteria | 989 |
| 224 | Ga0495613_0263246 | 3300046689 | Bacteria | 1201 |
| 225 | Ga0495624_0128326 | 3300046690 | Bacteria | 1556 |
| 226 | Ga0495600_0263713 | 3300046809 | Bacteria | 1094 |
| 227 | Ga0495600_0391335 | 3300046809 | Unclassified | 866 |
| 228 | Ga0495604_0020210 | 3300047317 | Bacteria | 5321 |
| 229 | Ga0495604_0204859 | 3300047317 | Bacteria | 1366 |
| 230 | Ga0495604_0336885 | 3300047317 | Unclassified | 1005 |
| 231 | Ga0495674_0006539 | 3300047319 | Bacteria | 11187 |
| 232 | Ga0495674_0011213 | 3300047319 | Bacteria | 8463 |
| 233 | Ga0495674_0414393 | 3300047319 | Unclassified | 1086 |
| 234 | Ga0495674_0636275 | 3300047319 | Unclassified | 842 |
| 235 | Ga0495675_0045412 | 3300047444 | Bacteria | 2797 |
| 236 | Ga0495675_0088483 | 3300047444 | Bacteria | 1945 |
| 237 | Ga0495684_0006375 | 3300047471 | Bacteria | 9161 |
| 238 | Ga0495684_0110852 | 3300047471 | Bacteria | 2070 |
| 239 | Ga0495602_0023719 | 3300048088 | Bacteria | 5971 |
| 240 | Ga0495602_0434543 | 3300048088 | Bacteria | 929 |
| 241 | Ga0496104_0004201 | 3300048907 | Bacteria | 12506 |
| 242 | Ga0496106_0499252 | 3300048909 | Unclassified | 977 |
| 243 | Ga0496108_0021168 | 3300048911 | Bacteria | 5344 |
| 244 | Ga0496109_0002574 | 3300048912 | Bacteria | 15193 |
| 245 | Ga0496110_0023714 | 3300048913 | Bacteria | 5220 |
| 246 | Ga0496111_0048707 | 3300048914 | Unclassified | 3053 |
| 247 | Ga0496112_0011020 | 3300048915 | Bacteria | 8240 |
| 248 | Ga0496113_0079628 | 3300048916 | Bacteria | 2509 |
| 249 | Ga0496114_0083219 | 3300048917 | Bacteria | 2707 |
| 250 | Ga0496115_0502007 | 3300048918 | Bacteria | 975 |
| 251 | Ga0501034_0576993 | 3300049571 | Bacteria | 1032 |
| 252 | Ga0501036_0166776 | 3300049572 | Bacteria | 1856 |
| 253 | Ga0501039_0093553 | 3300049575 | Bacteria | 2343 |
| 254 | Ga0501040_0064965 | 3300049576 | Bacteria | 2513 |
| 255 | Ga0501040_0552831 | 3300049576 | Bacteria | 831 |
| 256 | Ga0501041_0094398 | 3300049577 | Bacteria | 1848 |
| 257 | Ga0501042_0348851 | 3300049578 | Bacteria | 1070 |
| 258 | Ga0501046_0090736 | 3300049580 | Bacteria | 2351 |
| 259 | Ga0501071_0196507 | 3300049587 | Bacteria | 1514 |
| 260 | Ga0501072_0018878 | 3300049588 | Bacteria | 5319 |
| 261 | Ga0501075_0149504 | 3300049591 | Bacteria | 1780 |
| 262 | Ga0501075_0186656 | 3300049591 | Bacteria | 1581 |
| 263 | Ga0501076_0149456 | 3300049592 | Bacteria | 1900 |
| 264 | Ga0501076_0264808 | 3300049592 | Bacteria | 1407 |
| 265 | Ga0501079_0225399 | 3300049741 | Bacteria | 1464 |
| 266 | Ga0501081_0014193 | 3300049743 | Bacteria | 5252 |
| 267 | Ga0501081_0051419 | 3300049743 | Bacteria | 2842 |
| 268 | Ga0501083_0092213 | 3300049744 | Bacteria | 2000 |
| 269 | Ga0501035_0405350 | 3300049822 | Bacteria | 1134 |
| 270 | Ga0501044_0316647 | 3300049823 | Bacteria | 1486 |
| 271 | Ga0501045_0291514 | 3300049824 | Bacteria | 1214 |
| 272 | nmdc:mga06z11_39103_c1 | 3300050494 | Bacteria | 2359 |
| 273 | nmdc:mga09592_103272_c1 | 3300050508 | Bacteria | 2442 |
| 274 | nmdc:mga09592_316517_c1 | 3300050508 | Bacteria | 1352 |
| 275 | nmdc:mga0qj67_231503_c1 | 3300050509 | Bacteria | 1499 |
| 276 | nmdc:mga0qj67_36596_c1 | 3300050509 | Bacteria | 3841 |
| 277 | nmdc:mga06r32_224_c1 | 3300050510 | Bacteria | 45758 |
| 278 | nmdc:mga08y16_332710_c1 | 3300050511 | Bacteria | 1562 |
| 279 | nmdc:mga08y16_550794_c1 | 3300050511 | Bacteria | 1167 |
| 280 | nmdc:mga08y16_742222_c1 | 3300050511 | Bacteria | 978 |
| 281 | nmdc:mga0n895_119284_c1 | 3300050512 | Bacteria | 2659 |
| 282 | nmdc:mga0rr50_9549_c1 | 3300050513 | Bacteria | 6105 |
| 283 | nmdc:mga0a205_301467_c1 | 3300050515 | Bacteria | 1475 |
| 284 | nmdc:mga0a205_97312_c1 | 3300050515 | Bacteria | 2842 |
| 285 | Ga0500555_000211 | 3300053103 | Bacteria | 27096 |
| 286 | Ga0500645_000284 | 3300053730 | Bacteria | 36344 |
| 287 | Ga0501084_0011197 | 3300054114 | Bacteria | 7430 |
| 288 | Ga0501082_0138581 | 3300060353 | Bacteria | 2111 |
| 289 | Ga0530510_0008496 | 3300061734 | Bacteria | 7161 |
| 290 | Ga0530510_0320177 | 3300061734 | Bacteria | 1162 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0020210 | Ga0495604_0020210_4639_5301 | 214 |
| 2 | 3300025918 | Ga0207662_10267902 | Ga0207662_102679022 | 219 |
| 3 | 3300025942 | Ga0207689_10029071 | Ga0207689_100290713 | 222 |
| 4 | 3300005441 | Ga0070700_100218152 | Ga0070700_1002181523 | 227 |
| 5 | 3300005844 | Ga0068862_100427431 | Ga0068862_1004274312 | 227 |
| 6 | 3300025944 | Ga0207661_10601113 | Ga0207661_106011131 | 227 |
| 7 | 3300028380 | Ga0268265_10387250 | Ga0268265_103872502 | 227 |
| 8 | 3300049576 | Ga0501040_0552831 | Ga0501040_0552831_71_775 | 228 |
| 9 | 3300005549 | Ga0070704_100068464 | Ga0070704_1000684642 | 233 |
| 10 | 3300006852 | Ga0075433_10548714 | Ga0075433_105487142 | 233 |
| 11 | 3300006871 | Ga0075434_100370423 | Ga0075434_1003704231 | 233 |
| 12 | 3300028653 | Ga0265323_10001932 | Ga0265323_100019327 | 233 |
| 13 | 3300031344 | Ga0265316_10087330 | Ga0265316_100873304 | 233 |
| 14 | 3300050515 | nmdc:mga0a205_301467_c1 | nmdc:mga0a205_301467_c1_94_825 | 233 |
| 15 | 3300061734 | Ga0530510_0320177 | Ga0530510_0320177_302_1015 | 233 |
| 16 | 3300005329 | Ga0070683_100790912 | Ga0070683_1007909121 | 234 |
| 17 | 3300005335 | Ga0070666_10294895 | Ga0070666_102948952 | 234 |
| 18 | 3300005336 | Ga0070680_100395757 | Ga0070680_1003957572 | 234 |
| 19 | 3300005338 | Ga0068868_100635441 | Ga0068868_1006354411 | 234 |
| 20 | 3300005364 | Ga0070673_100218106 | Ga0070673_1002181063 | 234 |
| 21 | 3300005436 | Ga0070713_100005020 | Ga0070713_1000050203 | 234 |
| 22 | 3300005530 | Ga0070679_100288649 | Ga0070679_1002886492 | 234 |
| 23 | 3300005535 | Ga0070684_100163060 | Ga0070684_1001630603 | 234 |
| 24 | 3300005577 | Ga0068857_100239957 | Ga0068857_1002399572 | 234 |
| 25 | 3300005617 | Ga0068859_100136074 | Ga0068859_1001360742 | 234 |
| 26 | 3300006880 | Ga0075429_100420493 | Ga0075429_1004204931 | 234 |
| 27 | 3300006931 | Ga0097620_100136067 | Ga0097620_1001360673 | 234 |
| 28 | 3300009098 | Ga0105245_10613948 | Ga0105245_106139482 | 234 |
| 29 | 3300009176 | Ga0105242_10232636 | Ga0105242_102326362 | 234 |
| 30 | 3300009176 | Ga0105242_10539080 | Ga0105242_105390801 | 234 |
| 31 | 3300009177 | Ga0105248_10026281 | Ga0105248_100262812 | 234 |
| 32 | 3300009177 | Ga0105248_10267831 | Ga0105248_102678312 | 234 |
| 33 | 3300009177 | Ga0105248_10641763 | Ga0105248_106417631 | 234 |
| 34 | 3300009177 | Ga0105248_10686019 | Ga0105248_106860191 | 234 |
| 35 | 3300010375 | Ga0105239_10851996 | Ga0105239_108519961 | 234 |
| 36 | 3300013104 | Ga0157370_10634747 | Ga0157370_106347472 | 234 |
| 37 | 3300013105 | Ga0157369_10200148 | Ga0157369_102001482 | 234 |
| 38 | 3300013306 | Ga0163162_10884515 | Ga0163162_108845152 | 234 |
| 39 | 3300013308 | Ga0157375_10757962 | Ga0157375_107579622 | 234 |
| 40 | 3300014325 | Ga0163163_10396183 | Ga0163163_103961832 | 234 |
| 41 | 3300014325 | Ga0163163_10852377 | Ga0163163_108523772 | 234 |
| 42 | 3300014969 | Ga0157376_10888654 | Ga0157376_108886542 | 234 |
| 43 | 3300025903 | Ga0207680_10355892 | Ga0207680_103558921 | 234 |
| 44 | 3300025917 | Ga0207660_10325653 | Ga0207660_103256532 | 234 |
| 45 | 3300025921 | Ga0207652_10144248 | Ga0207652_101442482 | 234 |
| 46 | 3300025925 | Ga0207650_10584408 | Ga0207650_105844082 | 234 |
| 47 | 3300025927 | Ga0207687_10394121 | Ga0207687_103941212 | 234 |
| 48 | 3300025928 | Ga0207700_10011307 | Ga0207700_100113076 | 234 |
| 49 | 3300025934 | Ga0207686_10314223 | Ga0207686_103142232 | 234 |
| 50 | 3300025936 | Ga0207670_10173761 | Ga0207670_101737612 | 234 |
| 51 | 3300025936 | Ga0207670_10521057 | Ga0207670_105210572 | 234 |
| 52 | 3300025941 | Ga0207711_10091047 | Ga0207711_100910472 | 234 |
| 53 | 3300025960 | Ga0207651_10602939 | Ga0207651_106029392 | 234 |
| 54 | 3300025986 | Ga0207658_10189673 | Ga0207658_101896732 | 234 |
| 55 | 3300026088 | Ga0207641_10032901 | Ga0207641_100329012 | 234 |
| 56 | 3300026088 | Ga0207641_10444760 | Ga0207641_104447602 | 234 |
| 57 | 3300026095 | Ga0207676_10589357 | Ga0207676_105893572 | 234 |
| 58 | 3300028379 | Ga0268266_10483090 | Ga0268266_104830902 | 234 |
| 59 | 3300037068 | Ga0373925_0088996 | Ga0373925_0088996_411_1142 | 234 |
| 60 | 3300046462 | Ga0495651_0215730 | Ga0495651_0215730_453_1214 | 234 |
| 61 | 3300046472 | Ga0495580_0000955 | Ga0495580_0000955_19291_20016 | 234 |
| 62 | 3300046472 | Ga0495580_0028043 | Ga0495580_0028043_2697_3428 | 234 |
| 63 | 3300046473 | Ga0495582_0021863 | Ga0495582_0021863_1989_2714 | 234 |
| 64 | 3300046476 | Ga0495662_0271346 | Ga0495662_0271346_27_752 | 234 |
| 65 | 3300046477 | Ga0495664_0208246 | Ga0495664_0208246_443_1168 | 234 |
| 66 | 3300046499 | Ga0495594_0068265 | Ga0495594_0068265_334_1059 | 234 |
| 67 | 3300046511 | Ga0495608_0125793 | Ga0495608_0125793_325_1050 | 234 |
| 68 | 3300046511 | Ga0495608_0377405 | Ga0495608_0377405_124_849 | 234 |
| 69 | 3300046526 | Ga0495666_0056667 | Ga0495666_0056667_976_1701 | 234 |
| 70 | 3300046529 | Ga0495652_0422520 | Ga0495652_0422520_108_833 | 234 |
| 71 | 3300046531 | Ga0495665_0006125 | Ga0495665_0006125_3671_4396 | 234 |
| 72 | 3300046533 | Ga0495640_0144538 | Ga0495640_0144538_391_1116 | 234 |
| 73 | 3300046543 | Ga0495645_0063007 | Ga0495645_0063007_1520_2245 | 234 |
| 74 | 3300046543 | Ga0495645_0167912 | Ga0495645_0167912_55_780 | 234 |
| 75 | 3300046543 | Ga0495645_0192388 | Ga0495645_0192388_442_1167 | 234 |
| 76 | 3300046543 | Ga0495645_0269641 | Ga0495645_0269641_33_764 | 234 |
| 77 | 3300046559 | Ga0495667_0002274 | Ga0495667_0002274_3267_3992 | 234 |
| 78 | 3300046679 | Ga0495623_0033322 | Ga0495623_0033322_903_1628 | 234 |
| 79 | 3300046679 | Ga0495623_0085981 | Ga0495623_0085981_1139_1900 | 234 |
| 80 | 3300046679 | Ga0495623_0253133 | Ga0495623_0253133_34_759 | 234 |
| 81 | 3300046689 | Ga0495613_0263246 | Ga0495613_0263246_160_885 | 234 |
| 82 | 3300046690 | Ga0495624_0128326 | Ga0495624_0128326_589_1314 | 234 |
| 83 | 3300046809 | Ga0495600_0263713 | Ga0495600_0263713_85_810 | 234 |
| 84 | 3300047317 | Ga0495604_0204859 | Ga0495604_0204859_359_1120 | 234 |
| 85 | 3300047317 | Ga0495604_0336885 | Ga0495604_0336885_107_832 | 234 |
| 86 | 3300047319 | Ga0495674_0006539 | Ga0495674_0006539_6332_7057 | 234 |
| 87 | 3300047319 | Ga0495674_0011213 | Ga0495674_0011213_6856_7581 | 234 |
| 88 | 3300047319 | Ga0495674_0414393 | Ga0495674_0414393_207_932 | 234 |
| 89 | 3300047444 | Ga0495675_0045412 | Ga0495675_0045412_103_828 | 234 |
| 90 | 3300047444 | Ga0495675_0088483 | Ga0495675_0088483_531_1256 | 234 |
| 91 | 3300047471 | Ga0495684_0006375 | Ga0495684_0006375_7344_8069 | 234 |
| 92 | 3300047471 | Ga0495684_0110852 | Ga0495684_0110852_1109_1834 | 234 |
| 93 | 3300048088 | Ga0495602_0023719 | Ga0495602_0023719_903_1628 | 234 |
| 94 | 3300048088 | Ga0495602_0434543 | Ga0495602_0434543_63_794 | 234 |
| 95 | 3300048918 | Ga0496115_0502007 | Ga0496115_0502007_94_819 | 234 |
| 96 | 3300050508 | nmdc:mga09592_316517_c1 | nmdc:mga09592_316517_c1_603_1328 | 234 |
| 97 | iso_pu_bacteria | 2671180531 | 2673162602 | 234 |
| 98 | 3300005458 | Ga0070681_10042540 | Ga0070681_100425403 | 235 |
| 99 | 3300005614 | Ga0068856_100370543 | Ga0068856_1003705432 | 235 |
| 100 | 3300005841 | Ga0068863_100067620 | Ga0068863_1000676202 | 235 |
| 101 | 3300006914 | Ga0075436_100271911 | Ga0075436_1002719112 | 235 |
| 102 | 3300009093 | Ga0105240_10001475 | Ga0105240_100014756 | 235 |
| 103 | 3300009093 | Ga0105240_10214060 | Ga0105240_102140602 | 235 |
| 104 | 3300009545 | Ga0105237_10001652 | Ga0105237_100016526 | 235 |
| 105 | 3300014969 | Ga0157376_10367087 | Ga0157376_103670871 | 235 |
| 106 | 3300025912 | Ga0207707_10106676 | Ga0207707_101066762 | 235 |
| 107 | 3300025913 | Ga0207695_10007121 | Ga0207695_100071212 | 235 |
| 108 | 3300025914 | Ga0207671_10002144 | Ga0207671_100021442 | 235 |
| 109 | 3300026088 | Ga0207641_10003271 | Ga0207641_100032712 | 235 |
| 110 | 3300031344 | Ga0265316_10220344 | Ga0265316_102203441 | 235 |
| 111 | 3300044712 | Ga0453684_0024418 | Ga0453684_0024418_6019_6759 | 235 |
| 112 | 3300049744 | Ga0501083_0092213 | Ga0501083_0092213_714_1427 | 235 |
| 113 | 3300050509 | nmdc:mga0qj67_231503_c1 | nmdc:mga0qj67_231503_c1_22_795 | 235 |
| 114 | 3300049571 | Ga0501034_0576993 | Ga0501034_0576993_200_946 | 236 |
| 115 | 3300049823 | Ga0501044_0316647 | Ga0501044_0316647_539_1285 | 236 |
| 116 | 3300005436 | Ga0070713_100544694 | Ga0070713_1005446941 | 237 |
| 117 | 3300049572 | Ga0501036_0166776 | Ga0501036_0166776_246_1019 | 237 |
| 118 | 3300049576 | Ga0501040_0064965 | Ga0501040_0064965_1253_2026 | 237 |
| 119 | 3300049580 | Ga0501046_0090736 | Ga0501046_0090736_447_1220 | 237 |
| 120 | 3300049587 | Ga0501071_0196507 | Ga0501071_0196507_346_1119 | 237 |
| 121 | 3300049591 | Ga0501075_0186656 | Ga0501075_0186656_166_939 | 237 |
| 122 | 3300049592 | Ga0501076_0264808 | Ga0501076_0264808_213_986 | 237 |
| 123 | 3300049741 | Ga0501079_0225399 | Ga0501079_0225399_195_968 | 237 |
| 124 | 3300049743 | Ga0501081_0014193 | Ga0501081_0014193_3935_4708 | 237 |
| 125 | 3300054114 | Ga0501084_0011197 | Ga0501084_0011197_2097_2870 | 237 |
| 126 | 3300060353 | Ga0501082_0138581 | Ga0501082_0138581_746_1519 | 237 |
| 127 | 3300061734 | Ga0530510_0008496 | Ga0530510_0008496_459_1232 | 237 |
| 128 | 3300006844 | Ga0075428_100065190 | Ga0075428_1000651902 | 238 |
| 129 | 3300046809 | Ga0495600_0391335 | Ga0495600_0391335_72_815 | 238 |
| 130 | 3300005355 | Ga0070671_100461507 | Ga0070671_1004615071 | 239 |
| 131 | 3300005364 | Ga0070673_100022700 | Ga0070673_1000227002 | 239 |
| 132 | 3300005365 | Ga0070688_100456334 | Ga0070688_1004563341 | 239 |
| 133 | 3300005459 | Ga0068867_100158063 | Ga0068867_1001580632 | 239 |
| 134 | 3300005543 | Ga0070672_100348882 | Ga0070672_1003488822 | 239 |
| 135 | 3300009553 | Ga0105249_10383299 | Ga0105249_103832992 | 239 |
| 136 | 3300025931 | Ga0207644_10421800 | Ga0207644_104218002 | 239 |
| 137 | 3300025960 | Ga0207651_10423974 | Ga0207651_104239742 | 239 |
| 138 | 3300025961 | Ga0207712_10299515 | Ga0207712_102995152 | 239 |
| 139 | 3300035086 | Ga0373934_0089813 | Ga0373934_0089813_272_1003 | 239 |
| 140 | 3300050511 | nmdc:mga08y16_742222_c1 | nmdc:mga08y16_742222_c1_213_950 | 239 |
| 141 | 3300005985 | Ga0081539_10009615 | Ga0081539_100096159 | 241 |
| 142 | 3300006852 | Ga0075433_10079142 | Ga0075433_100791423 | 241 |
| 143 | 3300006871 | Ga0075434_100026829 | Ga0075434_1000268292 | 241 |
| 144 | 3300007076 | Ga0075435_100017054 | Ga0075435_1000170542 | 241 |
| 145 | 3300009094 | Ga0111539_10690282 | Ga0111539_106902821 | 241 |
| 146 | 3300050511 | nmdc:mga08y16_332710_c1 | nmdc:mga08y16_332710_c1_152_961 | 241 |
| 147 | 3300050512 | nmdc:mga0n895_119284_c1 | nmdc:mga0n895_119284_c1_1711_2520 | 241 |
| 148 | 3300050513 | nmdc:mga0rr50_9549_c1 | nmdc:mga0rr50_9549_c1_5102_5911 | 241 |
| 149 | 3300050515 | nmdc:mga0a205_97312_c1 | nmdc:mga0a205_97312_c1_1857_2666 | 241 |
| 150 | 3300005340 | Ga0070689_100048872 | Ga0070689_1000488723 | 242 |
| 151 | 3300005364 | Ga0070673_100021578 | Ga0070673_1000215782 | 242 |
| 152 | 3300005365 | Ga0070688_100024794 | Ga0070688_1000247944 | 242 |
| 153 | 3300005466 | Ga0070685_10219367 | Ga0070685_102193671 | 242 |
| 154 | 3300005543 | Ga0070672_100234227 | Ga0070672_1002342272 | 242 |
| 155 | 3300005564 | Ga0070664_100191711 | Ga0070664_1001917112 | 242 |
| 156 | 3300005617 | Ga0068859_100003129 | Ga0068859_1000031293 | 242 |
| 157 | 3300005618 | Ga0068864_100179667 | Ga0068864_1001796672 | 242 |
| 158 | 3300005719 | Ga0068861_100412687 | Ga0068861_1004126872 | 242 |
| 159 | 3300005841 | Ga0068863_100145690 | Ga0068863_1001456902 | 242 |
| 160 | 3300006931 | Ga0097620_100003129 | Ga0097620_1000031293 | 242 |
| 161 | 3300009177 | Ga0105248_10160047 | Ga0105248_101600472 | 242 |
| 162 | 3300013308 | Ga0157375_11135888 | Ga0157375_111358881 | 242 |
| 163 | 3300025940 | Ga0207691_10200304 | Ga0207691_102003042 | 242 |
| 164 | 3300025941 | Ga0207711_10137719 | Ga0207711_101377192 | 242 |
| 165 | 3300025945 | Ga0207679_10119677 | Ga0207679_101196772 | 242 |
| 166 | 3300025960 | Ga0207651_10021201 | Ga0207651_100212013 | 242 |
| 167 | 3300026095 | Ga0207676_10145318 | Ga0207676_101453182 | 242 |
| 168 | 3300026121 | Ga0207683_10341427 | Ga0207683_103414271 | 242 |
| 169 | 3300046454 | Ga0495592_0046715 | Ga0495592_0046715_1457_2248 | 242 |
| 170 | 3300046516 | Ga0495628_0098742 | Ga0495628_0098742_1262_2053 | 242 |
| 171 | 3300005441 | Ga0070700_100601860 | Ga0070700_1006018601 | 243 |
| 172 | 3300005457 | Ga0070662_100537303 | Ga0070662_1005373031 | 243 |
| 173 | 3300005844 | Ga0068862_100206793 | Ga0068862_1002067932 | 243 |
| 174 | 3300009553 | Ga0105249_10236393 | Ga0105249_102363933 | 243 |
| 175 | 3300014326 | Ga0157380_10073891 | Ga0157380_100738913 | 243 |
| 176 | 3300026118 | Ga0207675_100160270 | Ga0207675_1001602702 | 243 |
| 177 | 3300005353 | Ga0070669_100245503 | Ga0070669_1002455032 | 244 |
| 178 | 3300005435 | Ga0070714_100521432 | Ga0070714_1005214322 | 244 |
| 179 | 3300005467 | Ga0070706_100039965 | Ga0070706_1000399654 | 244 |
| 180 | 3300009094 | Ga0111539_10869261 | Ga0111539_108692612 | 244 |
| 181 | 3300009177 | Ga0105248_11077124 | Ga0105248_110771241 | 244 |
| 182 | 3300014326 | Ga0157380_10335687 | Ga0157380_103356871 | 244 |
| 183 | 3300025910 | Ga0207684_10033689 | Ga0207684_100336894 | 244 |
| 184 | 3300025929 | Ga0207664_10341193 | Ga0207664_103411931 | 244 |
| 185 | 3300025940 | Ga0207691_10006064 | Ga0207691_100060643 | 244 |
| 186 | 3300025941 | Ga0207711_10538541 | Ga0207711_105385412 | 244 |
| 187 | 3300025960 | Ga0207651_10070324 | Ga0207651_100703242 | 244 |
| 188 | 3300028380 | Ga0268265_10009953 | Ga0268265_100099533 | 244 |
| 189 | 3300044694 | Ga0466963_0164720 | Ga0466963_0164720_573_1334 | 244 |
| 190 | 3300044712 | Ga0453684_0071200 | Ga0453684_0071200_120_875 | 244 |
| 191 | 3300050511 | nmdc:mga08y16_550794_c1 | nmdc:mga08y16_550794_c1_276_1037 | 244 |
| 192 | 3300005471 | Ga0070698_100064138 | Ga0070698_1000641383 | 245 |
| 193 | 3300039437 | Ga0436365_1567635 | Ga0436365_1567635_97_870 | 245 |
| 194 | 3300044712 | Ga0453684_0948632 | Ga0453684_0948632_42_806 | 245 |
| 195 | 3300045051 | Ga0451576_0264108 | Ga0451576_0264108_660_1418 | 245 |
| 196 | 3300005466 | Ga0070685_10306165 | Ga0070685_103061651 | 246 |
| 197 | 3300005536 | Ga0070697_100386206 | Ga0070697_1003862062 | 246 |
| 198 | 3300006178 | Ga0075367_10006202 | Ga0075367_100062023 | 246 |
| 199 | 3300049575 | Ga0501039_0093553 | Ga0501039_0093553_1520_2284 | 246 |
| 200 | 3300049577 | Ga0501041_0094398 | Ga0501041_0094398_849_1613 | 246 |
| 201 | 3300049578 | Ga0501042_0348851 | Ga0501042_0348851_19_783 | 246 |
| 202 | 3300049588 | Ga0501072_0018878 | Ga0501072_0018878_1853_2617 | 246 |
| 203 | 3300049591 | Ga0501075_0149504 | Ga0501075_0149504_177_941 | 246 |
| 204 | 3300049592 | Ga0501076_0149456 | Ga0501076_0149456_459_1223 | 246 |
| 205 | 3300049743 | Ga0501081_0051419 | Ga0501081_0051419_526_1290 | 246 |
| 206 | 3300049822 | Ga0501035_0405350 | Ga0501035_0405350_183_947 | 246 |
| 207 | 3300049824 | Ga0501045_0291514 | Ga0501045_0291514_218_982 | 246 |
| 208 | 3300053103 | Ga0500555_000211 | Ga0500555_000211_10922_11677 | 246 |
| 209 | 3300053730 | Ga0500645_000284 | Ga0500645_000284_11015_11770 | 246 |
| 210 | 3300044712 | Ga0453684_0265311 | Ga0453684_0265311_318_1139 | 247 |
| 211 | 3300005468 | Ga0070707_100002532 | Ga0070707_1000025324 | 248 |
| 212 | 3300005548 | Ga0070665_100023099 | Ga0070665_1000230995 | 248 |
| 213 | 3300005548 | Ga0070665_100481223 | Ga0070665_1004812232 | 248 |
| 214 | 3300006175 | Ga0070712_100231008 | Ga0070712_1002310082 | 248 |
| 215 | 3300009101 | Ga0105247_10024134 | Ga0105247_100241342 | 248 |
| 216 | 3300009101 | Ga0105247_10061873 | Ga0105247_100618732 | 248 |
| 217 | 3300009174 | Ga0105241_10162374 | Ga0105241_101623742 | 248 |
| 218 | 3300013105 | Ga0157369_10015825 | Ga0157369_1001582511 | 248 |
| 219 | 3300025903 | Ga0207680_10274050 | Ga0207680_102740502 | 248 |
| 220 | 3300025922 | Ga0207646_10003602 | Ga0207646_100036024 | 248 |
| 221 | 3300028379 | Ga0268266_10032852 | Ga0268266_100328522 | 248 |
| 222 | 3300031344 | Ga0265316_10263837 | Ga0265316_102638372 | 248 |
| 223 | 3300036401 | Ga0373937_0263121 | Ga0373937_0263121_500_1261 | 248 |
| 224 | 3300048917 | Ga0496114_0083219 | Ga0496114_0083219_658_1431 | 248 |
| 225 | 3300050494 | nmdc:mga06z11_39103_c1 | nmdc:mga06z11_39103_c1_1198_1998 | 248 |
| 226 | 3300005435 | Ga0070714_100112187 | Ga0070714_1001121872 | 249 |
| 227 | 3300005535 | Ga0070684_100029399 | Ga0070684_1000293993 | 249 |
| 228 | 3300005539 | Ga0068853_100033253 | Ga0068853_1000332532 | 249 |
| 229 | 3300005564 | Ga0070664_100242638 | Ga0070664_1002426382 | 249 |
| 230 | 3300005842 | Ga0068858_100632827 | Ga0068858_1006328272 | 249 |
| 231 | 3300006846 | Ga0075430_100132839 | Ga0075430_1001328392 | 249 |
| 232 | 3300009176 | Ga0105242_10075340 | Ga0105242_100753401 | 249 |
| 233 | 3300013306 | Ga0163162_10267890 | Ga0163162_102678901 | 249 |
| 234 | 3300014325 | Ga0163163_10039369 | Ga0163163_100393691 | 249 |
| 235 | 3300025915 | Ga0207693_10569828 | Ga0207693_105698281 | 249 |
| 236 | 3300025925 | Ga0207650_10138590 | Ga0207650_101385902 | 249 |
| 237 | 3300025945 | Ga0207679_10118209 | Ga0207679_101182092 | 249 |
| 238 | 3300025986 | Ga0207658_10365095 | Ga0207658_103650952 | 249 |
| 239 | 3300026035 | Ga0207703_10035289 | Ga0207703_100352893 | 249 |
| 240 | 3300026041 | Ga0207639_10024424 | Ga0207639_100244243 | 249 |
| 241 | 3300037068 | Ga0373925_0224880 | Ga0373925_0224880_614_1378 | 249 |
| 242 | 3300047319 | Ga0495674_0636275 | Ga0495674_0636275_31_792 | 249 |
| 243 | 3300006844 | Ga0075428_100006442 | Ga0075428_1000064422 | 250 |
| 244 | 3300006846 | Ga0075430_100043311 | Ga0075430_1000433113 | 250 |
| 245 | 3300006847 | Ga0075431_100000173 | Ga0075431_10000017314 | 250 |
| 246 | 3300006880 | Ga0075429_100005706 | Ga0075429_1000057067 | 250 |
| 247 | 3300009147 | Ga0114129_10203519 | Ga0114129_102035193 | 250 |
| 248 | 3300050508 | nmdc:mga09592_103272_c1 | nmdc:mga09592_103272_c1_1319_2128 | 250 |
| 249 | 3300050509 | nmdc:mga0qj67_36596_c1 | nmdc:mga0qj67_36596_c1_1247_2056 | 250 |
| 250 | 3300050510 | nmdc:mga06r32_224_c1 | nmdc:mga06r32_224_c1_27662_28471 | 250 |
| 251 | 3300005290 | Ga0065712_10069174 | Ga0065712_100691741 | 252 |
| 252 | 3300005293 | Ga0065715_10394816 | Ga0065715_103948161 | 252 |
| 253 | 3300005329 | Ga0070683_100000579 | Ga0070683_10000057919 | 252 |
| 254 | 3300005331 | Ga0070670_100015108 | Ga0070670_1000151082 | 252 |
| 255 | 3300005344 | Ga0070661_100313192 | Ga0070661_1003131922 | 252 |
| 256 | 3300005355 | Ga0070671_100058324 | Ga0070671_1000583242 | 252 |
| 257 | 3300005364 | Ga0070673_100116671 | Ga0070673_1001166712 | 252 |
| 258 | 3300005366 | Ga0070659_100124844 | Ga0070659_1001248441 | 252 |
| 259 | 3300005535 | Ga0070684_100000553 | Ga0070684_10000055318 | 252 |
| 260 | 3300005543 | Ga0070672_100058847 | Ga0070672_1000588473 | 252 |
| 261 | 3300005548 | Ga0070665_100161728 | Ga0070665_1001617282 | 252 |
| 262 | 3300005564 | Ga0070664_100000785 | Ga0070664_10000078520 | 252 |
| 263 | 3300005618 | Ga0068864_100092258 | Ga0068864_1000922582 | 252 |
| 264 | 3300009101 | Ga0105247_10291860 | Ga0105247_102918602 | 252 |
| 265 | 3300009177 | Ga0105248_10018567 | Ga0105248_100185677 | 252 |
| 266 | 3300013306 | Ga0163162_10267763 | Ga0163162_102677632 | 252 |
| 267 | 3300013308 | Ga0157375_10055126 | Ga0157375_100551263 | 252 |
| 268 | 3300014325 | Ga0163163_10028996 | Ga0163163_100289962 | 252 |
| 269 | 3300014968 | Ga0157379_10338921 | Ga0157379_103389212 | 252 |
| 270 | 3300014969 | Ga0157376_10537955 | Ga0157376_105379552 | 252 |
| 271 | 3300025315 | Ga0207697_10025873 | Ga0207697_100258732 | 252 |
| 272 | 3300025920 | Ga0207649_10164846 | Ga0207649_101648462 | 252 |
| 273 | 3300025925 | Ga0207650_10011692 | Ga0207650_100116923 | 252 |
| 274 | 3300025931 | Ga0207644_10348232 | Ga0207644_103482321 | 252 |
| 275 | 3300025940 | Ga0207691_10023148 | Ga0207691_100231485 | 252 |
| 276 | 3300025941 | Ga0207711_10050789 | Ga0207711_100507892 | 252 |
| 277 | 3300025941 | Ga0207711_10267247 | Ga0207711_102672471 | 252 |
| 278 | 3300025941 | Ga0207711_10609339 | Ga0207711_106093392 | 252 |
| 279 | 3300025944 | Ga0207661_10147468 | Ga0207661_101474682 | 252 |
| 280 | 3300025945 | Ga0207679_10047377 | Ga0207679_100473772 | 252 |
| 281 | 3300025960 | Ga0207651_10080740 | Ga0207651_100807402 | 252 |
| 282 | 3300026095 | Ga0207676_10117608 | Ga0207676_101176082 | 252 |
| 283 | 3300046642 | Ga0495634_0041558 | Ga0495634_0041558_2192_2968 | 252 |
| 284 | 3300048907 | Ga0496104_0004201 | Ga0496104_0004201_5714_6472 | 252 |
| 285 | 3300048909 | Ga0496106_0499252 | Ga0496106_0499252_159_917 | 252 |
| 286 | 3300048911 | Ga0496108_0021168 | Ga0496108_0021168_42_800 | 252 |
| 287 | 3300048912 | Ga0496109_0002574 | Ga0496109_0002574_13557_14315 | 252 |
| 288 | 3300048913 | Ga0496110_0023714 | Ga0496110_0023714_2794_3552 | 252 |
| 289 | 3300048914 | Ga0496111_0048707 | Ga0496111_0048707_2127_2885 | 252 |
| 290 | 3300048915 | Ga0496112_0011020 | Ga0496112_0011020_1433_2191 | 252 |
| 291 | 3300048916 | Ga0496113_0079628 | Ga0496113_0079628_469_1227 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.794 | 2 | 240 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.7829 | 4 | 240 |
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7514 | 2 | 211 |
| 7pvl-assembly1.cif.gz_A | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 - apo form | 0.7484 | 2 | 234 |
| 4dec-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) | 0.746 | 2 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P40350_49_327_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9045 | 3 | 240 | 3.90.550.10 |
| af_K7MVE2_46_307_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8786 | 4 | 220 | 3.90.550.10 |
| af_Q9VLQ1_42_326_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8729 | 4 | 241 | 3.90.550.10 |
| af_Q8WSL9_63_329_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.865 | 4 | 237 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8638 | 4 | 211 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F7S2C7-F1-model_v4 | dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) | 0.9588 | 3 | 210 |
GO:0006487
GO:0016757 |
| AF-A0A7T9JXL4-F1-model_v4 | deleted | 0.9471 | 4 | 235 |
|
| AF-A0A3D4H2S3-F1-model_v4 | dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) | 0.9444 | 2 | 238 |
GO:0006487
GO:0016757 |
| AF-A0A7X7N537-F1-model_v4 | Glycosyltransferase | 0.9442 | 76 | 235 |
GO:0006487
GO:0016740 |
| AF-K2AKH5-F1-model_v4 | dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) | 0.9402 | 4 | 240 |
GO:0006487
GO:0016757 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar