F390229

General Info

Members Datasets Scaffolds Average Seq Length
291 181 290 251

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100033253|Ga0068853_1000332532
Length 274
Sequence MPAVPDLSLILPAYNEQARIAGTIREVHAYGLSRRLTIEIIVAADGTDGTREAAGSLCGEIPHLTVLGSPERRGKGHGIRQAVRKATGKFIGFADADNKTPITEFDNFLPLLQEGCHAVIGSRGLSESRIERPQRWYRRWGSRGFRVLLSTLIGLPNIRDTQCGFKFFQAHVARDLFARQRIDGYMFDVEILMLAARAGYGIKSVPVRWRDDADSRLELFRGNVRNLVDVLKIRFGSYPQPLRTHEAGAGTPQTVPGAVQNGVVSNTVMKNRAA

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 3.44
Rhizosphere 94.5
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10069174 3300005290 Bacteria 7821
2 Ga0065715_10394816 3300005293 Unclassified 889
3 Ga0070683_100000579 3300005329 Bacteria 26124
4 Ga0070683_100790912 3300005329 Bacteria 909
5 Ga0070670_100015108 3300005331 Bacteria 6626
6 Ga0070666_10294895 3300005335 Unclassified 1154
7 Ga0070680_100395757 3300005336 Bacteria 1177
8 Ga0068868_100635441 3300005338 Unclassified 949
9 Ga0070689_100048872 3300005340 Bacteria 3264
10 Ga0070661_100313192 3300005344 Unclassified 1224
11 Ga0070669_100245503 3300005353 Bacteria 1424
12 Ga0070671_100058324 3300005355 Bacteria 3214
13 Ga0070671_100461507 3300005355 Unclassified 1090
14 Ga0070673_100021578 3300005364 Bacteria 4672
15 Ga0070673_100022700 3300005364 Unclassified 4571
16 Ga0070673_100116671 3300005364 Bacteria 2221
17 Ga0070673_100218106 3300005364 Bacteria 1650
18 Ga0070688_100024794 3300005365 Bacteria 3544
19 Ga0070688_100456334 3300005365 Bacteria 956
20 Ga0070659_100124844 3300005366 Bacteria 2088
21 Ga0070714_100112187 3300005435 Unclassified 2416
22 Ga0070714_100521432 3300005435 Bacteria 1135
23 Ga0070713_100005020 3300005436 Bacteria 8990
24 Ga0070713_100544694 3300005436 Unclassified 1098
25 Ga0070700_100218152 3300005441 Bacteria 1350
26 Ga0070700_100601860 3300005441 Bacteria 861
27 Ga0070662_100537303 3300005457 Bacteria 978
28 Ga0070681_10042540 3300005458 Unclassified 4552
29 Ga0068867_100158063 3300005459 Bacteria 1786
30 Ga0070685_10219367 3300005466 Bacteria 1245
31 Ga0070685_10306165 3300005466 Bacteria 1072
32 Ga0070706_100039965 3300005467 Bacteria 4330
33 Ga0070707_100002532 3300005468 Bacteria 17383
34 Ga0070698_100064138 3300005471 Bacteria 3702
35 Ga0070679_100288649 3300005530 Bacteria 1592
36 Ga0070684_100000553 3300005535 Bacteria 25675
37 Ga0070684_100029399 3300005535 Unclassified 4657
38 Ga0070684_100163060 3300005535 Bacteria 2023
39 Ga0070697_100386206 3300005536 Bacteria 1213
40 Ga0068853_100033253 3300005539 Unclassified 4374
41 Ga0070672_100058847 3300005543 Bacteria 3022
42 Ga0070672_100234227 3300005543 Bacteria 1543
43 Ga0070672_100348882 3300005543 Bacteria 1261
44 Ga0070665_100023099 3300005548 Bacteria 6265
45 Ga0070665_100161728 3300005548 Bacteria 2241
46 Ga0070665_100481223 3300005548 Bacteria 1252
47 Ga0070704_100068464 3300005549 Bacteria 2567
48 Ga0070664_100000785 3300005564 Bacteria 24477
49 Ga0070664_100191711 3300005564 Bacteria 1821
50 Ga0070664_100242638 3300005564 Bacteria 1618
51 Ga0068857_100239957 3300005577 Bacteria 1659
52 Ga0068856_100370543 3300005614 Bacteria 1451
53 Ga0068859_100003129 3300005617 Bacteria 16814
54 Ga0068859_100136074 3300005617 Bacteria 2530
55 Ga0068864_100092258 3300005618 Bacteria 2673
56 Ga0068864_100179667 3300005618 Bacteria 1934
57 Ga0068861_100412687 3300005719 Bacteria 1201
58 Ga0068863_100067620 3300005841 Bacteria 3380
59 Ga0068863_100145690 3300005841 Bacteria 2265
60 Ga0068858_100632827 3300005842 Unclassified 1039
61 Ga0068862_100206793 3300005844 Bacteria 1772
62 Ga0068862_100427431 3300005844 Bacteria 1244
63 Ga0081539_10009615 3300005985 Bacteria 8031
64 Ga0070712_100231008 3300006175 Bacteria 1469
65 Ga0075367_10006202 3300006178 Bacteria 6022
66 Ga0075428_100006442 3300006844 Bacteria 13060
67 Ga0075428_100065190 3300006844 Bacteria 3989
68 Ga0075430_100043311 3300006846 Bacteria 3804
69 Ga0075430_100132839 3300006846 Bacteria 2074
70 Ga0075431_100000173 3300006847 Bacteria 45790
71 Ga0075433_10079142 3300006852 Bacteria 2896
72 Ga0075433_10548714 3300006852 Bacteria 1016
73 Ga0075434_100026829 3300006871 Bacteria 5650
74 Ga0075434_100370423 3300006871 Bacteria 1453
75 Ga0075429_100005706 3300006880 Bacteria 10739
76 Ga0075429_100420493 3300006880 Bacteria 1171
77 Ga0075436_100271911 3300006914 Bacteria 1210
78 Ga0097620_100003129 3300006931 Bacteria 16814
79 Ga0097620_100136067 3300006931 Bacteria 2530
80 Ga0075435_100017054 3300007076 Bacteria 5487
81 Ga0105240_10001475 3300009093 Bacteria 40095
82 Ga0105240_10214060 3300009093 Bacteria 2249
83 Ga0111539_10690282 3300009094 Bacteria 1188
84 Ga0111539_10869261 3300009094 Bacteria 1049
85 Ga0105245_10613948 3300009098 Bacteria 1115
86 Ga0105247_10024134 3300009101 Unclassified 3663
87 Ga0105247_10061873 3300009101 Bacteria 2322
88 Ga0105247_10291860 3300009101 Bacteria 1128
89 Ga0114129_10203519 3300009147 Bacteria 2680
90 Ga0105241_10162374 3300009174 Bacteria 1838
91 Ga0105242_10075340 3300009176 Unclassified 2809
92 Ga0105242_10232636 3300009176 Bacteria 1652
93 Ga0105242_10539080 3300009176 Bacteria 1117
94 Ga0105248_10018567 3300009177 Bacteria 7688
95 Ga0105248_10026281 3300009177 Bacteria 6476
96 Ga0105248_10160047 3300009177 Bacteria 2540
97 Ga0105248_10267831 3300009177 Bacteria 1923
98 Ga0105248_10641763 3300009177 Bacteria 1198
99 Ga0105248_10686019 3300009177 Bacteria 1156
100 Ga0105248_11077124 3300009177 Bacteria 908
101 Ga0105237_10001652 3300009545 Bacteria 28953
102 Ga0105249_10236393 3300009553 Bacteria 1804
103 Ga0105249_10383299 3300009553 Bacteria 1432
104 Ga0105239_10851996 3300010375 Unclassified 1045
105 Ga0157370_10634747 3300013104 Bacteria 977
106 Ga0157369_10015825 3300013105 Bacteria 8496
107 Ga0157369_10200148 3300013105 Bacteria 2097
108 Ga0163162_10267763 3300013306 Bacteria 1840
109 Ga0163162_10267890 3300013306 Bacteria 1840
110 Ga0163162_10884515 3300013306 Bacteria 1007
111 Ga0157375_10055126 3300013308 Bacteria 3918
112 Ga0157375_10757962 3300013308 Bacteria 1121
113 Ga0157375_11135888 3300013308 Bacteria 915
114 Ga0163163_10028996 3300014325 Bacteria 5322
115 Ga0163163_10039369 3300014325 Unclassified 4613
116 Ga0163163_10396183 3300014325 Bacteria 1439
117 Ga0163163_10852377 3300014325 Unclassified 975
118 Ga0157380_10073891 3300014326 Bacteria 2766
119 Ga0157380_10335687 3300014326 Bacteria 1407
120 Ga0157379_10338921 3300014968 Bacteria 1375
121 Ga0157376_10367087 3300014969 Bacteria 1382
122 Ga0157376_10537955 3300014969 Unclassified 1154
123 Ga0157376_10888654 3300014969 Bacteria 908
124 Ga0207697_10025873 3300025315 Bacteria 2399
125 Ga0207680_10274050 3300025903 Bacteria 1171
126 Ga0207680_10355892 3300025903 Bacteria 1029
127 Ga0207684_10033689 3300025910 Bacteria 4357
128 Ga0207707_10106676 3300025912 Unclassified 2449
129 Ga0207695_10007121 3300025913 Bacteria 14322
130 Ga0207671_10002144 3300025914 Bacteria 21531
131 Ga0207693_10569828 3300025915 Unclassified 882
132 Ga0207660_10325653 3300025917 Bacteria 1228
133 Ga0207662_10267902 3300025918 Bacteria 1126
134 Ga0207649_10164846 3300025920 Bacteria 1538
135 Ga0207652_10144248 3300025921 Bacteria 2130
136 Ga0207646_10003602 3300025922 Bacteria 17364
137 Ga0207650_10011692 3300025925 Bacteria 6048
138 Ga0207650_10138590 3300025925 Bacteria 1911
139 Ga0207650_10584408 3300025925 Bacteria 938
140 Ga0207687_10394121 3300025927 Bacteria 1137
141 Ga0207700_10011307 3300025928 Bacteria 5685
142 Ga0207664_10341193 3300025929 Bacteria 1324
143 Ga0207644_10348232 3300025931 Bacteria 1202
144 Ga0207644_10421800 3300025931 Unclassified 1093
145 Ga0207686_10314223 3300025934 Unclassified 1168
146 Ga0207670_10173761 3300025936 Bacteria 1617
147 Ga0207670_10521057 3300025936 Unclassified 968
148 Ga0207691_10006064 3300025940 Bacteria 11677
149 Ga0207691_10023148 3300025940 Bacteria 5849
150 Ga0207691_10200304 3300025940 Bacteria 1738
151 Ga0207711_10050789 3300025941 Bacteria 3551
152 Ga0207711_10091047 3300025941 Unclassified 2682
153 Ga0207711_10137719 3300025941 Bacteria 2194
154 Ga0207711_10267247 3300025941 Unclassified 1573
155 Ga0207711_10538541 3300025941 Bacteria 1089
156 Ga0207711_10609339 3300025941 Unclassified 1019
157 Ga0207689_10029071 3300025942 Bacteria 4619
158 Ga0207661_10147468 3300025944 Bacteria 2031
159 Ga0207661_10601113 3300025944 Bacteria 1010
160 Ga0207679_10047377 3300025945 Bacteria 3122
161 Ga0207679_10118209 3300025945 Bacteria 2105
162 Ga0207679_10119677 3300025945 Bacteria 2094
163 Ga0207651_10021201 3300025960 Bacteria 3943
164 Ga0207651_10070324 3300025960 Bacteria 2476
165 Ga0207651_10080740 3300025960 Bacteria 2342
166 Ga0207651_10423974 3300025960 Unclassified 1136
167 Ga0207651_10602939 3300025960 Unclassified 960
168 Ga0207712_10299515 3300025961 Unclassified 1319
169 Ga0207658_10189673 3300025986 Bacteria 1708
170 Ga0207658_10365095 3300025986 Bacteria 1261
171 Ga0207703_10035289 3300026035 Unclassified 3974
172 Ga0207639_10024424 3300026041 Unclassified 4374
173 Ga0207641_10003271 3300026088 Bacteria 14430
174 Ga0207641_10032901 3300026088 Unclassified 4307
175 Ga0207641_10444760 3300026088 Bacteria 1252
176 Ga0207676_10117608 3300026095 Bacteria 2236
177 Ga0207676_10145318 3300026095 Bacteria 2036
178 Ga0207676_10589357 3300026095 Bacteria 1067
179 Ga0207675_100160270 3300026118 Bacteria 2145
180 Ga0207683_10341427 3300026121 Bacteria 1373
181 Ga0268266_10032852 3300028379 Bacteria 4410
182 Ga0268266_10483090 3300028379 Bacteria 1181
183 Ga0268265_10009953 3300028380 Bacteria 6423
184 Ga0268265_10387250 3300028380 Bacteria 1288
185 Ga0265323_10001932 3300028653 Bacteria 9777
186 Ga0265316_10087330 3300031344 Bacteria 2383
187 Ga0265316_10220344 3300031344 Bacteria 1400
188 Ga0265316_10263837 3300031344 Bacteria 1262
189 Ga0373934_0089813 3300035086 Bacteria 1238
190 Ga0373937_0263121 3300036401 Bacteria 1627
191 Ga0373925_0088996 3300037068 Bacteria 2358
192 Ga0373925_0224880 3300037068 Unclassified 1499
193 Ga0436365_1567635 3300039437 Bacteria 967
194 Ga0466963_0164720 3300044694 Unclassified 1544
195 Ga0453684_0024418 3300044712 Bacteria 8837
196 Ga0453684_0071200 3300044712 Bacteria 4398
197 Ga0453684_0265311 3300044712 Bacteria 1965
198 Ga0453684_0948632 3300044712 Unclassified 918
199 Ga0451576_0264108 3300045051 Bacteria 1799
200 Ga0495592_0046715 3300046454 Bacteria 3227
201 Ga0495651_0215730 3300046462 Unclassified 1332
202 Ga0495580_0000955 3300046472 Bacteria 25312
203 Ga0495580_0028043 3300046472 Bacteria 4095
204 Ga0495582_0021863 3300046473 Bacteria 3500
205 Ga0495662_0271346 3300046476 Unclassified 835
206 Ga0495664_0208246 3300046477 Bacteria 1184
207 Ga0495594_0068265 3300046499 Bacteria 1974
208 Ga0495608_0125793 3300046511 Unclassified 1642
209 Ga0495608_0377405 3300046511 Bacteria 869
210 Ga0495628_0098742 3300046516 Bacteria 2255
211 Ga0495666_0056667 3300046526 Unclassified 1877
212 Ga0495652_0422520 3300046529 Bacteria 939
213 Ga0495665_0006125 3300046531 Bacteria 6495
214 Ga0495640_0144538 3300046533 Bacteria 1531
215 Ga0495645_0063007 3300046543 Unclassified 2685
216 Ga0495645_0167912 3300046543 Bacteria 1512
217 Ga0495645_0192388 3300046543 Bacteria 1389
218 Ga0495645_0269641 3300046543 Bacteria 1124
219 Ga0495667_0002274 3300046559 Bacteria 12866
220 Ga0495634_0041558 3300046642 Bacteria 3122
221 Ga0495623_0033322 3300046679 Bacteria 3305
222 Ga0495623_0085981 3300046679 Bacteria 1939
223 Ga0495623_0253133 3300046679 Bacteria 989
224 Ga0495613_0263246 3300046689 Bacteria 1201
225 Ga0495624_0128326 3300046690 Bacteria 1556
226 Ga0495600_0263713 3300046809 Bacteria 1094
227 Ga0495600_0391335 3300046809 Unclassified 866
228 Ga0495604_0020210 3300047317 Bacteria 5321
229 Ga0495604_0204859 3300047317 Bacteria 1366
230 Ga0495604_0336885 3300047317 Unclassified 1005
231 Ga0495674_0006539 3300047319 Bacteria 11187
232 Ga0495674_0011213 3300047319 Bacteria 8463
233 Ga0495674_0414393 3300047319 Unclassified 1086
234 Ga0495674_0636275 3300047319 Unclassified 842
235 Ga0495675_0045412 3300047444 Bacteria 2797
236 Ga0495675_0088483 3300047444 Bacteria 1945
237 Ga0495684_0006375 3300047471 Bacteria 9161
238 Ga0495684_0110852 3300047471 Bacteria 2070
239 Ga0495602_0023719 3300048088 Bacteria 5971
240 Ga0495602_0434543 3300048088 Bacteria 929
241 Ga0496104_0004201 3300048907 Bacteria 12506
242 Ga0496106_0499252 3300048909 Unclassified 977
243 Ga0496108_0021168 3300048911 Bacteria 5344
244 Ga0496109_0002574 3300048912 Bacteria 15193
245 Ga0496110_0023714 3300048913 Bacteria 5220
246 Ga0496111_0048707 3300048914 Unclassified 3053
247 Ga0496112_0011020 3300048915 Bacteria 8240
248 Ga0496113_0079628 3300048916 Bacteria 2509
249 Ga0496114_0083219 3300048917 Bacteria 2707
250 Ga0496115_0502007 3300048918 Bacteria 975
251 Ga0501034_0576993 3300049571 Bacteria 1032
252 Ga0501036_0166776 3300049572 Bacteria 1856
253 Ga0501039_0093553 3300049575 Bacteria 2343
254 Ga0501040_0064965 3300049576 Bacteria 2513
255 Ga0501040_0552831 3300049576 Bacteria 831
256 Ga0501041_0094398 3300049577 Bacteria 1848
257 Ga0501042_0348851 3300049578 Bacteria 1070
258 Ga0501046_0090736 3300049580 Bacteria 2351
259 Ga0501071_0196507 3300049587 Bacteria 1514
260 Ga0501072_0018878 3300049588 Bacteria 5319
261 Ga0501075_0149504 3300049591 Bacteria 1780
262 Ga0501075_0186656 3300049591 Bacteria 1581
263 Ga0501076_0149456 3300049592 Bacteria 1900
264 Ga0501076_0264808 3300049592 Bacteria 1407
265 Ga0501079_0225399 3300049741 Bacteria 1464
266 Ga0501081_0014193 3300049743 Bacteria 5252
267 Ga0501081_0051419 3300049743 Bacteria 2842
268 Ga0501083_0092213 3300049744 Bacteria 2000
269 Ga0501035_0405350 3300049822 Bacteria 1134
270 Ga0501044_0316647 3300049823 Bacteria 1486
271 Ga0501045_0291514 3300049824 Bacteria 1214
272 nmdc:mga06z11_39103_c1 3300050494 Bacteria 2359
273 nmdc:mga09592_103272_c1 3300050508 Bacteria 2442
274 nmdc:mga09592_316517_c1 3300050508 Bacteria 1352
275 nmdc:mga0qj67_231503_c1 3300050509 Bacteria 1499
276 nmdc:mga0qj67_36596_c1 3300050509 Bacteria 3841
277 nmdc:mga06r32_224_c1 3300050510 Bacteria 45758
278 nmdc:mga08y16_332710_c1 3300050511 Bacteria 1562
279 nmdc:mga08y16_550794_c1 3300050511 Bacteria 1167
280 nmdc:mga08y16_742222_c1 3300050511 Bacteria 978
281 nmdc:mga0n895_119284_c1 3300050512 Bacteria 2659
282 nmdc:mga0rr50_9549_c1 3300050513 Bacteria 6105
283 nmdc:mga0a205_301467_c1 3300050515 Bacteria 1475
284 nmdc:mga0a205_97312_c1 3300050515 Bacteria 2842
285 Ga0500555_000211 3300053103 Bacteria 27096
286 Ga0500645_000284 3300053730 Bacteria 36344
287 Ga0501084_0011197 3300054114 Bacteria 7430
288 Ga0501082_0138581 3300060353 Bacteria 2111
289 Ga0530510_0008496 3300061734 Bacteria 7161
290 Ga0530510_0320177 3300061734 Bacteria 1162

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0020210 Ga0495604_0020210_4639_5301 214
2 3300025918 Ga0207662_10267902 Ga0207662_102679022 219
3 3300025942 Ga0207689_10029071 Ga0207689_100290713 222
4 3300005441 Ga0070700_100218152 Ga0070700_1002181523 227
5 3300005844 Ga0068862_100427431 Ga0068862_1004274312 227
6 3300025944 Ga0207661_10601113 Ga0207661_106011131 227
7 3300028380 Ga0268265_10387250 Ga0268265_103872502 227
8 3300049576 Ga0501040_0552831 Ga0501040_0552831_71_775 228
9 3300005549 Ga0070704_100068464 Ga0070704_1000684642 233
10 3300006852 Ga0075433_10548714 Ga0075433_105487142 233
11 3300006871 Ga0075434_100370423 Ga0075434_1003704231 233
12 3300028653 Ga0265323_10001932 Ga0265323_100019327 233
13 3300031344 Ga0265316_10087330 Ga0265316_100873304 233
14 3300050515 nmdc:mga0a205_301467_c1 nmdc:mga0a205_301467_c1_94_825 233
15 3300061734 Ga0530510_0320177 Ga0530510_0320177_302_1015 233
16 3300005329 Ga0070683_100790912 Ga0070683_1007909121 234
17 3300005335 Ga0070666_10294895 Ga0070666_102948952 234
18 3300005336 Ga0070680_100395757 Ga0070680_1003957572 234
19 3300005338 Ga0068868_100635441 Ga0068868_1006354411 234
20 3300005364 Ga0070673_100218106 Ga0070673_1002181063 234
21 3300005436 Ga0070713_100005020 Ga0070713_1000050203 234
22 3300005530 Ga0070679_100288649 Ga0070679_1002886492 234
23 3300005535 Ga0070684_100163060 Ga0070684_1001630603 234
24 3300005577 Ga0068857_100239957 Ga0068857_1002399572 234
25 3300005617 Ga0068859_100136074 Ga0068859_1001360742 234
26 3300006880 Ga0075429_100420493 Ga0075429_1004204931 234
27 3300006931 Ga0097620_100136067 Ga0097620_1001360673 234
28 3300009098 Ga0105245_10613948 Ga0105245_106139482 234
29 3300009176 Ga0105242_10232636 Ga0105242_102326362 234
30 3300009176 Ga0105242_10539080 Ga0105242_105390801 234
31 3300009177 Ga0105248_10026281 Ga0105248_100262812 234
32 3300009177 Ga0105248_10267831 Ga0105248_102678312 234
33 3300009177 Ga0105248_10641763 Ga0105248_106417631 234
34 3300009177 Ga0105248_10686019 Ga0105248_106860191 234
35 3300010375 Ga0105239_10851996 Ga0105239_108519961 234
36 3300013104 Ga0157370_10634747 Ga0157370_106347472 234
37 3300013105 Ga0157369_10200148 Ga0157369_102001482 234
38 3300013306 Ga0163162_10884515 Ga0163162_108845152 234
39 3300013308 Ga0157375_10757962 Ga0157375_107579622 234
40 3300014325 Ga0163163_10396183 Ga0163163_103961832 234
41 3300014325 Ga0163163_10852377 Ga0163163_108523772 234
42 3300014969 Ga0157376_10888654 Ga0157376_108886542 234
43 3300025903 Ga0207680_10355892 Ga0207680_103558921 234
44 3300025917 Ga0207660_10325653 Ga0207660_103256532 234
45 3300025921 Ga0207652_10144248 Ga0207652_101442482 234
46 3300025925 Ga0207650_10584408 Ga0207650_105844082 234
47 3300025927 Ga0207687_10394121 Ga0207687_103941212 234
48 3300025928 Ga0207700_10011307 Ga0207700_100113076 234
49 3300025934 Ga0207686_10314223 Ga0207686_103142232 234
50 3300025936 Ga0207670_10173761 Ga0207670_101737612 234
51 3300025936 Ga0207670_10521057 Ga0207670_105210572 234
52 3300025941 Ga0207711_10091047 Ga0207711_100910472 234
53 3300025960 Ga0207651_10602939 Ga0207651_106029392 234
54 3300025986 Ga0207658_10189673 Ga0207658_101896732 234
55 3300026088 Ga0207641_10032901 Ga0207641_100329012 234
56 3300026088 Ga0207641_10444760 Ga0207641_104447602 234
57 3300026095 Ga0207676_10589357 Ga0207676_105893572 234
58 3300028379 Ga0268266_10483090 Ga0268266_104830902 234
59 3300037068 Ga0373925_0088996 Ga0373925_0088996_411_1142 234
60 3300046462 Ga0495651_0215730 Ga0495651_0215730_453_1214 234
61 3300046472 Ga0495580_0000955 Ga0495580_0000955_19291_20016 234
62 3300046472 Ga0495580_0028043 Ga0495580_0028043_2697_3428 234
63 3300046473 Ga0495582_0021863 Ga0495582_0021863_1989_2714 234
64 3300046476 Ga0495662_0271346 Ga0495662_0271346_27_752 234
65 3300046477 Ga0495664_0208246 Ga0495664_0208246_443_1168 234
66 3300046499 Ga0495594_0068265 Ga0495594_0068265_334_1059 234
67 3300046511 Ga0495608_0125793 Ga0495608_0125793_325_1050 234
68 3300046511 Ga0495608_0377405 Ga0495608_0377405_124_849 234
69 3300046526 Ga0495666_0056667 Ga0495666_0056667_976_1701 234
70 3300046529 Ga0495652_0422520 Ga0495652_0422520_108_833 234
71 3300046531 Ga0495665_0006125 Ga0495665_0006125_3671_4396 234
72 3300046533 Ga0495640_0144538 Ga0495640_0144538_391_1116 234
73 3300046543 Ga0495645_0063007 Ga0495645_0063007_1520_2245 234
74 3300046543 Ga0495645_0167912 Ga0495645_0167912_55_780 234
75 3300046543 Ga0495645_0192388 Ga0495645_0192388_442_1167 234
76 3300046543 Ga0495645_0269641 Ga0495645_0269641_33_764 234
77 3300046559 Ga0495667_0002274 Ga0495667_0002274_3267_3992 234
78 3300046679 Ga0495623_0033322 Ga0495623_0033322_903_1628 234
79 3300046679 Ga0495623_0085981 Ga0495623_0085981_1139_1900 234
80 3300046679 Ga0495623_0253133 Ga0495623_0253133_34_759 234
81 3300046689 Ga0495613_0263246 Ga0495613_0263246_160_885 234
82 3300046690 Ga0495624_0128326 Ga0495624_0128326_589_1314 234
83 3300046809 Ga0495600_0263713 Ga0495600_0263713_85_810 234
84 3300047317 Ga0495604_0204859 Ga0495604_0204859_359_1120 234
85 3300047317 Ga0495604_0336885 Ga0495604_0336885_107_832 234
86 3300047319 Ga0495674_0006539 Ga0495674_0006539_6332_7057 234
87 3300047319 Ga0495674_0011213 Ga0495674_0011213_6856_7581 234
88 3300047319 Ga0495674_0414393 Ga0495674_0414393_207_932 234
89 3300047444 Ga0495675_0045412 Ga0495675_0045412_103_828 234
90 3300047444 Ga0495675_0088483 Ga0495675_0088483_531_1256 234
91 3300047471 Ga0495684_0006375 Ga0495684_0006375_7344_8069 234
92 3300047471 Ga0495684_0110852 Ga0495684_0110852_1109_1834 234
93 3300048088 Ga0495602_0023719 Ga0495602_0023719_903_1628 234
94 3300048088 Ga0495602_0434543 Ga0495602_0434543_63_794 234
95 3300048918 Ga0496115_0502007 Ga0496115_0502007_94_819 234
96 3300050508 nmdc:mga09592_316517_c1 nmdc:mga09592_316517_c1_603_1328 234
97 iso_pu_bacteria 2671180531 2673162602 234
98 3300005458 Ga0070681_10042540 Ga0070681_100425403 235
99 3300005614 Ga0068856_100370543 Ga0068856_1003705432 235
100 3300005841 Ga0068863_100067620 Ga0068863_1000676202 235
101 3300006914 Ga0075436_100271911 Ga0075436_1002719112 235
102 3300009093 Ga0105240_10001475 Ga0105240_100014756 235
103 3300009093 Ga0105240_10214060 Ga0105240_102140602 235
104 3300009545 Ga0105237_10001652 Ga0105237_100016526 235
105 3300014969 Ga0157376_10367087 Ga0157376_103670871 235
106 3300025912 Ga0207707_10106676 Ga0207707_101066762 235
107 3300025913 Ga0207695_10007121 Ga0207695_100071212 235
108 3300025914 Ga0207671_10002144 Ga0207671_100021442 235
109 3300026088 Ga0207641_10003271 Ga0207641_100032712 235
110 3300031344 Ga0265316_10220344 Ga0265316_102203441 235
111 3300044712 Ga0453684_0024418 Ga0453684_0024418_6019_6759 235
112 3300049744 Ga0501083_0092213 Ga0501083_0092213_714_1427 235
113 3300050509 nmdc:mga0qj67_231503_c1 nmdc:mga0qj67_231503_c1_22_795 235
114 3300049571 Ga0501034_0576993 Ga0501034_0576993_200_946 236
115 3300049823 Ga0501044_0316647 Ga0501044_0316647_539_1285 236
116 3300005436 Ga0070713_100544694 Ga0070713_1005446941 237
117 3300049572 Ga0501036_0166776 Ga0501036_0166776_246_1019 237
118 3300049576 Ga0501040_0064965 Ga0501040_0064965_1253_2026 237
119 3300049580 Ga0501046_0090736 Ga0501046_0090736_447_1220 237
120 3300049587 Ga0501071_0196507 Ga0501071_0196507_346_1119 237
121 3300049591 Ga0501075_0186656 Ga0501075_0186656_166_939 237
122 3300049592 Ga0501076_0264808 Ga0501076_0264808_213_986 237
123 3300049741 Ga0501079_0225399 Ga0501079_0225399_195_968 237
124 3300049743 Ga0501081_0014193 Ga0501081_0014193_3935_4708 237
125 3300054114 Ga0501084_0011197 Ga0501084_0011197_2097_2870 237
126 3300060353 Ga0501082_0138581 Ga0501082_0138581_746_1519 237
127 3300061734 Ga0530510_0008496 Ga0530510_0008496_459_1232 237
128 3300006844 Ga0075428_100065190 Ga0075428_1000651902 238
129 3300046809 Ga0495600_0391335 Ga0495600_0391335_72_815 238
130 3300005355 Ga0070671_100461507 Ga0070671_1004615071 239
131 3300005364 Ga0070673_100022700 Ga0070673_1000227002 239
132 3300005365 Ga0070688_100456334 Ga0070688_1004563341 239
133 3300005459 Ga0068867_100158063 Ga0068867_1001580632 239
134 3300005543 Ga0070672_100348882 Ga0070672_1003488822 239
135 3300009553 Ga0105249_10383299 Ga0105249_103832992 239
136 3300025931 Ga0207644_10421800 Ga0207644_104218002 239
137 3300025960 Ga0207651_10423974 Ga0207651_104239742 239
138 3300025961 Ga0207712_10299515 Ga0207712_102995152 239
139 3300035086 Ga0373934_0089813 Ga0373934_0089813_272_1003 239
140 3300050511 nmdc:mga08y16_742222_c1 nmdc:mga08y16_742222_c1_213_950 239
141 3300005985 Ga0081539_10009615 Ga0081539_100096159 241
142 3300006852 Ga0075433_10079142 Ga0075433_100791423 241
143 3300006871 Ga0075434_100026829 Ga0075434_1000268292 241
144 3300007076 Ga0075435_100017054 Ga0075435_1000170542 241
145 3300009094 Ga0111539_10690282 Ga0111539_106902821 241
146 3300050511 nmdc:mga08y16_332710_c1 nmdc:mga08y16_332710_c1_152_961 241
147 3300050512 nmdc:mga0n895_119284_c1 nmdc:mga0n895_119284_c1_1711_2520 241
148 3300050513 nmdc:mga0rr50_9549_c1 nmdc:mga0rr50_9549_c1_5102_5911 241
149 3300050515 nmdc:mga0a205_97312_c1 nmdc:mga0a205_97312_c1_1857_2666 241
150 3300005340 Ga0070689_100048872 Ga0070689_1000488723 242
151 3300005364 Ga0070673_100021578 Ga0070673_1000215782 242
152 3300005365 Ga0070688_100024794 Ga0070688_1000247944 242
153 3300005466 Ga0070685_10219367 Ga0070685_102193671 242
154 3300005543 Ga0070672_100234227 Ga0070672_1002342272 242
155 3300005564 Ga0070664_100191711 Ga0070664_1001917112 242
156 3300005617 Ga0068859_100003129 Ga0068859_1000031293 242
157 3300005618 Ga0068864_100179667 Ga0068864_1001796672 242
158 3300005719 Ga0068861_100412687 Ga0068861_1004126872 242
159 3300005841 Ga0068863_100145690 Ga0068863_1001456902 242
160 3300006931 Ga0097620_100003129 Ga0097620_1000031293 242
161 3300009177 Ga0105248_10160047 Ga0105248_101600472 242
162 3300013308 Ga0157375_11135888 Ga0157375_111358881 242
163 3300025940 Ga0207691_10200304 Ga0207691_102003042 242
164 3300025941 Ga0207711_10137719 Ga0207711_101377192 242
165 3300025945 Ga0207679_10119677 Ga0207679_101196772 242
166 3300025960 Ga0207651_10021201 Ga0207651_100212013 242
167 3300026095 Ga0207676_10145318 Ga0207676_101453182 242
168 3300026121 Ga0207683_10341427 Ga0207683_103414271 242
169 3300046454 Ga0495592_0046715 Ga0495592_0046715_1457_2248 242
170 3300046516 Ga0495628_0098742 Ga0495628_0098742_1262_2053 242
171 3300005441 Ga0070700_100601860 Ga0070700_1006018601 243
172 3300005457 Ga0070662_100537303 Ga0070662_1005373031 243
173 3300005844 Ga0068862_100206793 Ga0068862_1002067932 243
174 3300009553 Ga0105249_10236393 Ga0105249_102363933 243
175 3300014326 Ga0157380_10073891 Ga0157380_100738913 243
176 3300026118 Ga0207675_100160270 Ga0207675_1001602702 243
177 3300005353 Ga0070669_100245503 Ga0070669_1002455032 244
178 3300005435 Ga0070714_100521432 Ga0070714_1005214322 244
179 3300005467 Ga0070706_100039965 Ga0070706_1000399654 244
180 3300009094 Ga0111539_10869261 Ga0111539_108692612 244
181 3300009177 Ga0105248_11077124 Ga0105248_110771241 244
182 3300014326 Ga0157380_10335687 Ga0157380_103356871 244
183 3300025910 Ga0207684_10033689 Ga0207684_100336894 244
184 3300025929 Ga0207664_10341193 Ga0207664_103411931 244
185 3300025940 Ga0207691_10006064 Ga0207691_100060643 244
186 3300025941 Ga0207711_10538541 Ga0207711_105385412 244
187 3300025960 Ga0207651_10070324 Ga0207651_100703242 244
188 3300028380 Ga0268265_10009953 Ga0268265_100099533 244
189 3300044694 Ga0466963_0164720 Ga0466963_0164720_573_1334 244
190 3300044712 Ga0453684_0071200 Ga0453684_0071200_120_875 244
191 3300050511 nmdc:mga08y16_550794_c1 nmdc:mga08y16_550794_c1_276_1037 244
192 3300005471 Ga0070698_100064138 Ga0070698_1000641383 245
193 3300039437 Ga0436365_1567635 Ga0436365_1567635_97_870 245
194 3300044712 Ga0453684_0948632 Ga0453684_0948632_42_806 245
195 3300045051 Ga0451576_0264108 Ga0451576_0264108_660_1418 245
196 3300005466 Ga0070685_10306165 Ga0070685_103061651 246
197 3300005536 Ga0070697_100386206 Ga0070697_1003862062 246
198 3300006178 Ga0075367_10006202 Ga0075367_100062023 246
199 3300049575 Ga0501039_0093553 Ga0501039_0093553_1520_2284 246
200 3300049577 Ga0501041_0094398 Ga0501041_0094398_849_1613 246
201 3300049578 Ga0501042_0348851 Ga0501042_0348851_19_783 246
202 3300049588 Ga0501072_0018878 Ga0501072_0018878_1853_2617 246
203 3300049591 Ga0501075_0149504 Ga0501075_0149504_177_941 246
204 3300049592 Ga0501076_0149456 Ga0501076_0149456_459_1223 246
205 3300049743 Ga0501081_0051419 Ga0501081_0051419_526_1290 246
206 3300049822 Ga0501035_0405350 Ga0501035_0405350_183_947 246
207 3300049824 Ga0501045_0291514 Ga0501045_0291514_218_982 246
208 3300053103 Ga0500555_000211 Ga0500555_000211_10922_11677 246
209 3300053730 Ga0500645_000284 Ga0500645_000284_11015_11770 246
210 3300044712 Ga0453684_0265311 Ga0453684_0265311_318_1139 247
211 3300005468 Ga0070707_100002532 Ga0070707_1000025324 248
212 3300005548 Ga0070665_100023099 Ga0070665_1000230995 248
213 3300005548 Ga0070665_100481223 Ga0070665_1004812232 248
214 3300006175 Ga0070712_100231008 Ga0070712_1002310082 248
215 3300009101 Ga0105247_10024134 Ga0105247_100241342 248
216 3300009101 Ga0105247_10061873 Ga0105247_100618732 248
217 3300009174 Ga0105241_10162374 Ga0105241_101623742 248
218 3300013105 Ga0157369_10015825 Ga0157369_1001582511 248
219 3300025903 Ga0207680_10274050 Ga0207680_102740502 248
220 3300025922 Ga0207646_10003602 Ga0207646_100036024 248
221 3300028379 Ga0268266_10032852 Ga0268266_100328522 248
222 3300031344 Ga0265316_10263837 Ga0265316_102638372 248
223 3300036401 Ga0373937_0263121 Ga0373937_0263121_500_1261 248
224 3300048917 Ga0496114_0083219 Ga0496114_0083219_658_1431 248
225 3300050494 nmdc:mga06z11_39103_c1 nmdc:mga06z11_39103_c1_1198_1998 248
226 3300005435 Ga0070714_100112187 Ga0070714_1001121872 249
227 3300005535 Ga0070684_100029399 Ga0070684_1000293993 249
228 3300005539 Ga0068853_100033253 Ga0068853_1000332532 249
229 3300005564 Ga0070664_100242638 Ga0070664_1002426382 249
230 3300005842 Ga0068858_100632827 Ga0068858_1006328272 249
231 3300006846 Ga0075430_100132839 Ga0075430_1001328392 249
232 3300009176 Ga0105242_10075340 Ga0105242_100753401 249
233 3300013306 Ga0163162_10267890 Ga0163162_102678901 249
234 3300014325 Ga0163163_10039369 Ga0163163_100393691 249
235 3300025915 Ga0207693_10569828 Ga0207693_105698281 249
236 3300025925 Ga0207650_10138590 Ga0207650_101385902 249
237 3300025945 Ga0207679_10118209 Ga0207679_101182092 249
238 3300025986 Ga0207658_10365095 Ga0207658_103650952 249
239 3300026035 Ga0207703_10035289 Ga0207703_100352893 249
240 3300026041 Ga0207639_10024424 Ga0207639_100244243 249
241 3300037068 Ga0373925_0224880 Ga0373925_0224880_614_1378 249
242 3300047319 Ga0495674_0636275 Ga0495674_0636275_31_792 249
243 3300006844 Ga0075428_100006442 Ga0075428_1000064422 250
244 3300006846 Ga0075430_100043311 Ga0075430_1000433113 250
245 3300006847 Ga0075431_100000173 Ga0075431_10000017314 250
246 3300006880 Ga0075429_100005706 Ga0075429_1000057067 250
247 3300009147 Ga0114129_10203519 Ga0114129_102035193 250
248 3300050508 nmdc:mga09592_103272_c1 nmdc:mga09592_103272_c1_1319_2128 250
249 3300050509 nmdc:mga0qj67_36596_c1 nmdc:mga0qj67_36596_c1_1247_2056 250
250 3300050510 nmdc:mga06r32_224_c1 nmdc:mga06r32_224_c1_27662_28471 250
251 3300005290 Ga0065712_10069174 Ga0065712_100691741 252
252 3300005293 Ga0065715_10394816 Ga0065715_103948161 252
253 3300005329 Ga0070683_100000579 Ga0070683_10000057919 252
254 3300005331 Ga0070670_100015108 Ga0070670_1000151082 252
255 3300005344 Ga0070661_100313192 Ga0070661_1003131922 252
256 3300005355 Ga0070671_100058324 Ga0070671_1000583242 252
257 3300005364 Ga0070673_100116671 Ga0070673_1001166712 252
258 3300005366 Ga0070659_100124844 Ga0070659_1001248441 252
259 3300005535 Ga0070684_100000553 Ga0070684_10000055318 252
260 3300005543 Ga0070672_100058847 Ga0070672_1000588473 252
261 3300005548 Ga0070665_100161728 Ga0070665_1001617282 252
262 3300005564 Ga0070664_100000785 Ga0070664_10000078520 252
263 3300005618 Ga0068864_100092258 Ga0068864_1000922582 252
264 3300009101 Ga0105247_10291860 Ga0105247_102918602 252
265 3300009177 Ga0105248_10018567 Ga0105248_100185677 252
266 3300013306 Ga0163162_10267763 Ga0163162_102677632 252
267 3300013308 Ga0157375_10055126 Ga0157375_100551263 252
268 3300014325 Ga0163163_10028996 Ga0163163_100289962 252
269 3300014968 Ga0157379_10338921 Ga0157379_103389212 252
270 3300014969 Ga0157376_10537955 Ga0157376_105379552 252
271 3300025315 Ga0207697_10025873 Ga0207697_100258732 252
272 3300025920 Ga0207649_10164846 Ga0207649_101648462 252
273 3300025925 Ga0207650_10011692 Ga0207650_100116923 252
274 3300025931 Ga0207644_10348232 Ga0207644_103482321 252
275 3300025940 Ga0207691_10023148 Ga0207691_100231485 252
276 3300025941 Ga0207711_10050789 Ga0207711_100507892 252
277 3300025941 Ga0207711_10267247 Ga0207711_102672471 252
278 3300025941 Ga0207711_10609339 Ga0207711_106093392 252
279 3300025944 Ga0207661_10147468 Ga0207661_101474682 252
280 3300025945 Ga0207679_10047377 Ga0207679_100473772 252
281 3300025960 Ga0207651_10080740 Ga0207651_100807402 252
282 3300026095 Ga0207676_10117608 Ga0207676_101176082 252
283 3300046642 Ga0495634_0041558 Ga0495634_0041558_2192_2968 252
284 3300048907 Ga0496104_0004201 Ga0496104_0004201_5714_6472 252
285 3300048909 Ga0496106_0499252 Ga0496106_0499252_159_917 252
286 3300048911 Ga0496108_0021168 Ga0496108_0021168_42_800 252
287 3300048912 Ga0496109_0002574 Ga0496109_0002574_13557_14315 252
288 3300048913 Ga0496110_0023714 Ga0496110_0023714_2794_3552 252
289 3300048914 Ga0496111_0048707 Ga0496111_0048707_2127_2885 252
290 3300048915 Ga0496112_0011020 Ga0496112_0011020_1433_2191 252
291 3300048916 Ga0496113_0079628 Ga0496113_0079628_469_1227 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

8

177

0.82

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

5

209

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.794 2 240
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7829 4 240
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7514 2 211
7pvl-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 - apo form 0.7484 2 234
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.746 2 234
ID Description Score Start End Superfamily
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9045 3 240 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8786 4 220 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8729 4 241 3.90.550.10
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.865 4 237 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8638 4 211 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F7S2C7-F1-model_v4 dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) 0.9588 3 210 GO:0006487
GO:0016757
AF-A0A7T9JXL4-F1-model_v4 deleted 0.9471 4 235
AF-A0A3D4H2S3-F1-model_v4 dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) 0.9444 2 238 GO:0006487
GO:0016757
AF-A0A7X7N537-F1-model_v4 Glycosyltransferase 0.9442 76 235 GO:0006487
GO:0016740
AF-K2AKH5-F1-model_v4 dolichyl-phosphate beta-glucosyltransferase (EC 2.4.1.117) 0.9402 4 240 GO:0006487
GO:0016757

Feature Viewer

pLDDT pTM Quality
85.74 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map