F390225

General Info

Members Datasets Scaffolds Average Seq Length
291 163 582 465

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100082265|Ga0070699_1000822652
Length 487
Sequence MTATLIFQSVKEMTDAVKPAAAVLSDRVSVTNPAAVTGDVIDRLVWTSVFGGDAELKGTARWMLRSLAAAAGIRPTSIHDLYMAMGKGSAGGFTVPAINVRAMAYDTARAVVRSAKKLNAGAFIFEIARSEIGYTEQRPHEYAAVVVGAALREGFTGPLFIQGDHVQTNAKKFNSPERDKELDGLRALIKEEIAAGFYNIDIDTSTLVDLARPTLAEQQEVNVNLAADFTAFIRQQEPQDVTVSVGGEIGEVGGKNSDVHELHAYMDGYDAALRKKGGGLVGLSKISVQTGTAHGGFINADGTLRMDVKIDLQTLEELSRVARKEYGLAGAVQHGASTLPPEAFDAFPRAGACEIHLATNFQNMVYEHPQFPADLKNEMYAWVREHAQEERKPKDTEEQFLYKARKKAIGPFKRTMWDLSDEARRAIGRTLEEQFTFLMSKLKINDTAPVVARFVKAPQVPIDREKEIVAAGGKITAAEKKAEGLAD

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100082265 3300005518 Bacteria 2806
2 JGI24751J29686_10002791 3300002459 Bacteria 3514
3 Ga0070658_10027014 3300005327 Bacteria 4609
4 Ga0070670_100029951 3300005331 Bacteria 4687
5 Ga0070670_100101746 3300005331 Bacteria 2474
6 Ga0070680_100041031 3300005336 Unclassified 3752
7 Ga0070682_100000002 3300005337 Bacteria 506802
8 Ga0068868_100000058 3300005338 Bacteria 62047
9 Ga0068868_100031964 3300005338 Bacteria 4046
10 Ga0068868_100057991 3300005338 Bacteria 3060
11 Ga0070691_10000473 3300005341 Bacteria 15007
12 Ga0070668_100088997 3300005347 Bacteria 2431
13 Ga0070669_100068789 3300005353 Bacteria 2614
14 Ga0070675_100000202 3300005354 Bacteria 37748
15 Ga0070675_100042776 3300005354 Bacteria 3702
16 Ga0070671_100109407 3300005355 Bacteria 2321
17 Ga0070674_100024262 3300005356 Bacteria 3934
18 Ga0070673_100052274 3300005364 Bacteria 3205
19 Ga0070659_100055466 3300005366 Unclassified 3123
20 Ga0070713_100091876 3300005436 Bacteria 2612
21 Ga0070711_100018111 3300005439 Bacteria 4494
22 Ga0070694_100005856 3300005444 Bacteria 7457
23 Ga0070663_100079002 3300005455 Bacteria 2413
24 Ga0070662_100050986 3300005457 Bacteria 2987
25 Ga0070681_10019500 3300005458 Bacteria 6790
26 Ga0068867_100009353 3300005459 Bacteria 6917
27 Ga0068867_100013323 3300005459 Bacteria 5825
28 Ga0068867_100049821 3300005459 Bacteria 3084
29 Ga0070685_10095512 3300005466 Bacteria 1807
30 Ga0070707_100034134 3300005468 Bacteria 4852
31 Ga0070707_100059879 3300005468 Bacteria 3652
32 Ga0070707_100182872 3300005468 Bacteria 2044
33 Ga0070698_100029348 3300005471 Bacteria 5710
34 Ga0070698_100042958 3300005471 Unclassified 4636
35 Ga0070698_100054630 3300005471 Bacteria 4054
36 Ga0070679_100022602 3300005530 Bacteria 6148
37 Ga0070684_100024919 3300005535 Bacteria 5022
38 Ga0070684_100129817 3300005535 Bacteria 2273
39 Ga0070697_100005886 3300005536 Bacteria 9463
40 Ga0070697_100045173 3300005536 Bacteria 3570
41 Ga0070672_100139333 3300005543 Bacteria 2000
42 Ga0070696_100003637 3300005546 Bacteria 10272
43 Ga0070665_100006386 3300005548 Bacteria 12013
44 Ga0070665_100008967 3300005548 Bacteria 10134
45 Ga0070704_100012818 3300005549 Bacteria 5184
46 Ga0070704_100058778 3300005549 Unclassified 2740
47 Ga0068857_100026725 3300005577 Bacteria 5087
48 Ga0068854_100090334 3300005578 Bacteria 2277
49 Ga0068856_100037119 3300005614 Bacteria 4780
50 Ga0068859_100000031 3300005617 Bacteria 174715
51 Ga0068859_100017910 3300005617 Bacteria 7120
52 Ga0068864_100006553 3300005618 Bacteria 9539
53 Ga0068864_100034868 3300005618 Bacteria 4282
54 Ga0068866_10010359 3300005718 Bacteria 3994
55 Ga0068861_100025235 3300005719 Bacteria 4308
56 Ga0068861_100047849 3300005719 Bacteria 3230
57 Ga0068851_10053636 3300005834 Bacteria 2053
58 Ga0068858_100013146 3300005842 Bacteria 7805
59 Ga0068858_100140611 3300005842 Bacteria 2266
60 Ga0068860_100015495 3300005843 Bacteria 7444
61 Ga0068860_100074940 3300005843 Bacteria 3219
62 Ga0068862_100072129 3300005844 Bacteria 2982
63 Ga0081539_10039031 3300005985 Bacteria 2807
64 Ga0070717_10000046 3300006028 Bacteria 106495
65 Ga0097621_100000477 3300006237 Bacteria 28162
66 Ga0097621_100002349 3300006237 Bacteria 12970
67 Ga0068871_100012430 3300006358 Bacteria 6275
68 Ga0068871_100044812 3300006358 Bacteria 3559
69 Ga0068871_100057850 3300006358 Unclassified 3156
70 Ga0068871_100117301 3300006358 Bacteria 2245
71 Ga0075431_100029686 3300006847 Bacteria 5629
72 Ga0075431_100031531 3300006847 Bacteria 5459
73 Ga0075431_100034724 3300006847 Bacteria 5195
74 Ga0075433_10001662 3300006852 Bacteria 16547
75 Ga0075433_10007021 3300006852 Bacteria 8923
76 Ga0075433_10016600 3300006852 Bacteria 6075
77 Ga0075433_10038802 3300006852 Bacteria 4115
78 Ga0075433_10048561 3300006852 Bacteria 3691
79 Ga0075433_10228459 3300006852 Bacteria 1653
80 Ga0075434_100001265 3300006871 Bacteria 21080
81 Ga0075434_100004294 3300006871 Bacteria 12804
82 Ga0075434_100005549 3300006871 Bacteria 11495
83 Ga0075434_100016684 3300006871 Bacteria 7064
84 Ga0075434_100017468 3300006871 Bacteria 6914
85 Ga0075434_100035368 3300006871 Bacteria 4938
86 Ga0075434_100045559 3300006871 Bacteria 4351
87 Ga0075434_100059288 3300006871 Bacteria 3805
88 Ga0075434_100288664 3300006871 Unclassified 1660
89 Ga0075429_100154670 3300006880 Unclassified 2008
90 Ga0075436_100000295 3300006914 Bacteria 31676
91 Ga0075436_100006650 3300006914 Bacteria 7918
92 Ga0075436_100032132 3300006914 Bacteria 3616
93 Ga0075436_100042518 3300006914 Bacteria 3134
94 Ga0075436_100052564 3300006914 Bacteria 2812
95 Ga0075436_100095091 3300006914 Bacteria 2072
96 Ga0097620_100000031 3300006931 Bacteria 174715
97 Ga0097620_100017910 3300006931 Bacteria 7120
98 Ga0075435_100000147 3300007076 Bacteria 39845
99 Ga0075435_100012687 3300007076 Bacteria 6243
100 Ga0075435_100020798 3300007076 Bacteria 5036
101 Ga0075435_100037478 3300007076 Bacteria 3861
102 Ga0075435_100057865 3300007076 Bacteria 3137
103 Ga0075435_100092714 3300007076 Bacteria 2495
104 Ga0099794_10070987 3300007265 Unclassified 1706
105 Ga0105240_10011792 3300009093 Bacteria 12141
106 Ga0105240_10034088 3300009093 Bacteria 6571
107 Ga0111539_10002429 3300009094 Bacteria 24773
108 Ga0111539_10023244 3300009094 Bacteria 7615
109 Ga0105245_10006944 3300009098 Bacteria 9925
110 Ga0105247_10044984 3300009101 Bacteria 2708
111 Ga0114129_10001754 3300009147 Bacteria 29541
112 Ga0114129_10009067 3300009147 Bacteria 14179
113 Ga0114129_10034155 3300009147 Bacteria 7183
114 Ga0114129_10036366 3300009147 Bacteria 6954
115 Ga0114129_10112109 3300009147 Bacteria 3762
116 Ga0114129_10125831 3300009147 Bacteria 3524
117 Ga0114129_10239669 3300009147 Bacteria 2438
118 Ga0105243_10016882 3300009148 Bacteria 5520
119 Ga0105242_10003632 3300009176 Bacteria 12008
120 Ga0105242_10019645 3300009176 Bacteria 5296
121 Ga0105248_10004014 3300009177 Bacteria 16266
122 Ga0105248_10014472 3300009177 Bacteria 8684
123 Ga0105248_10033764 3300009177 Bacteria 5718
124 Ga0105248_10043896 3300009177 Bacteria 5014
125 Ga0105248_10245324 3300009177 Bacteria 2016
126 Ga0105237_10155042 3300009545 Bacteria 2287
127 Ga0105249_10017645 3300009553 Bacteria 6338
128 Ga0105239_10236555 3300010375 Bacteria 2050
129 Ga0157378_10001821 3300013297 Bacteria 19113
130 Ga0157378_10003680 3300013297 Bacteria 13596
131 Ga0157378_10023338 3300013297 Bacteria 5444
132 Ga0157378_10026628 3300013297 Bacteria 5096
133 Ga0163162_10004675 3300013306 Bacteria 13204
134 Ga0157375_10000047 3300013308 Bacteria 141526
135 Ga0157375_10028668 3300013308 Bacteria 5223
136 Ga0163163_10010892 3300014325 Bacteria 8216
137 Ga0163163_10013097 3300014325 Bacteria 7577
138 Ga0163163_10024760 3300014325 Bacteria 5715
139 Ga0163163_10113565 3300014325 Bacteria 2739
140 Ga0157377_10000220 3300014745 Bacteria 30207
141 Ga0157379_10036639 3300014968 Bacteria 4373
142 Ga0157379_10044495 3300014968 Bacteria 3963
143 Ga0157376_10011926 3300014969 Bacteria 6428
144 Ga0157376_10073430 3300014969 Bacteria 2913
145 Ga0207653_10001815 3300025885 Bacteria 6816
146 Ga0207682_10011954 3300025893 Bacteria 3390
147 Ga0207642_10032743 3300025899 Bacteria 2192
148 Ga0207705_10037376 3300025909 Bacteria 3475
149 Ga0207684_10108067 3300025910 Bacteria 2380
150 Ga0207707_10036870 3300025912 Bacteria 4273
151 Ga0207707_10039875 3300025912 Unclassified 4103
152 Ga0207693_10062656 3300025915 Bacteria 2914
153 Ga0207663_10007364 3300025916 Bacteria 5703
154 Ga0207649_10102284 3300025920 Bacteria 1899
155 Ga0207652_10038008 3300025921 Unclassified 4078
156 Ga0207646_10001582 3300025922 Bacteria 27811
157 Ga0207646_10105687 3300025922 Bacteria 2525
158 Ga0207681_10019225 3300025923 Bacteria 4314
159 Ga0207659_10000076 3300025926 Bacteria 62373
160 Ga0207659_10054425 3300025926 Bacteria 2858
161 Ga0207659_10060864 3300025926 Bacteria 2719
162 Ga0207659_10102371 3300025926 Bacteria 2162
163 Ga0207687_10030793 3300025927 Bacteria 3620
164 Ga0207700_10067925 3300025928 Bacteria 2731
165 Ga0207700_10091898 3300025928 Bacteria 2398
166 Ga0207706_10043137 3300025933 Bacteria 3998
167 Ga0207686_10017136 3300025934 Bacteria 4077
168 Ga0207686_10024153 3300025934 Bacteria 3518
169 Ga0207670_10177669 3300025936 Bacteria 1601
170 Ga0207669_10025967 3300025937 Bacteria 3177
171 Ga0207691_10127621 3300025940 Bacteria 2249
172 Ga0207711_10016158 3300025941 Bacteria 6196
173 Ga0207711_10077912 3300025941 Bacteria 2890
174 Ga0207711_10113862 3300025941 Unclassified 2408
175 Ga0207689_10038300 3300025942 Bacteria 3972
176 Ga0207689_10087355 3300025942 Bacteria 2562
177 Ga0207689_10109561 3300025942 Bacteria 2269
178 Ga0207667_10045125 3300025949 Bacteria 4668
179 Ga0207667_10146779 3300025949 Bacteria 2428
180 Ga0207651_10155426 3300025960 Bacteria 1786
181 Ga0207712_10019405 3300025961 Bacteria 4439
182 Ga0207712_10129688 3300025961 Bacteria 1919
183 Ga0207640_10026213 3300025981 Bacteria 3536
184 Ga0207677_10000004 3300026023 Bacteria 299062
185 Ga0207702_10079798 3300026078 Unclassified 2837
186 Ga0207641_10001113 3300026088 Bacteria 27018
187 Ga0207648_10015198 3300026089 Bacteria 7085
188 Ga0207648_10045998 3300026089 Bacteria 3827
189 Ga0207648_10049139 3300026089 Bacteria 3693
190 Ga0207676_10182301 3300026095 Bacteria 1840
191 Ga0207675_100009497 3300026118 Bacteria 9103
192 Ga0207675_100022324 3300026118 Bacteria 5893
193 Ga0207675_100030535 3300026118 Bacteria 5020
194 Ga0207675_100043211 3300026118 Bacteria 4208
195 Ga0207698_10095439 3300026142 Bacteria 2448
196 Ga0207428_10044726 3300027907 Bacteria 3570
197 Ga0207428_10090863 3300027907 Unclassified 2371
198 Ga0268266_10003789 3300028379 Bacteria 14802
199 Ga0268265_10005243 3300028380 Bacteria 8869
200 Ga0268265_10015893 3300028380 Bacteria 5162
201 Ga0268265_10053239 3300028380 Bacteria 3065
202 Ga0268264_10086899 3300028381 Bacteria 2688
203 Ga0265318_10028966 3300028577 Bacteria 2161
204 Ga0265323_10021116 3300028653 Bacteria 2498
205 Ga0265323_10022102 3300028653 Bacteria 2433
206 Ga0265322_10003337 3300028654 Bacteria 4863
207 Ga0265336_10000927 3300028666 Bacteria 14877
208 Ga0265338_10000128 3300028800 Bacteria 138764
209 Ga0265338_10032229 3300028800 Bacteria 5118
210 Ga0307511_10011008 3300030521 Bacteria 8932
211 Ga0265339_10024521 3300031249 Bacteria 3474
212 Ga0265316_10011285 3300031344 Bacteria 8071
213 Ga0265316_10019634 3300031344 Bacteria 5773
214 Ga0265342_10000014 3300031712 Bacteria 200596
215 Ga0307411_10013487 3300032005 Bacteria 4511
216 Ga0307415_100077487 3300032126 Bacteria 2361
217 Ga0373932_0000177 3300035112 Bacteria 18737
218 Ga0373941_0009941 3300035115 Bacteria 2413
219 Ga0373935_0024361 3300035692 Bacteria 3725
220 Ga0373933_0095151 3300035724 Bacteria 1843
221 Ga0373933_0124095 3300035724 Bacteria 1619
222 Ga0373947_0007561 3300035725 Bacteria 6286
223 Ga0373937_0066899 3300036401 Bacteria 3310
224 Ga0373937_0117406 3300036401 Bacteria 2478
225 Ga0373925_0000666 3300037068 Bacteria 32236
226 Ga0466967_0134139 3300045976 Bacteria 2302
227 Ga0495592_0047193 3300046454 Bacteria 3208
228 Ga0495580_0000822 3300046472 Bacteria 26922
229 Ga0495580_0034257 3300046472 Bacteria 3657
230 Ga0495608_0011561 3300046511 Bacteria 6140
231 Ga0495630_0013627 3300046517 Bacteria 5913
232 Ga0495586_0082806 3300046535 Bacteria 1765
233 Ga0495587_0082979 3300046536 Bacteria 1857
234 Ga0495621_0041121 3300046539 Unclassified 1622
235 Ga0495635_0073016 3300046663 Bacteria 2350
236 Ga0495635_0171795 3300046663 Unclassified 1474
237 Ga0495658_0024034 3300046683 Bacteria 3241
238 Ga0495658_0051242 3300046683 Bacteria 2338
239 Ga0495658_0060332 3300046683 Unclassified 2175
240 Ga0495669_0000990 3300046684 Bacteria 11874
241 Ga0495669_0016071 3300046684 Bacteria 3205
242 Ga0495613_0004695 3300046689 Bacteria 10249
243 Ga0495674_0029729 3300047319 Bacteria 4972
244 Ga0495684_0000228 3300047471 Bacteria 43929
245 Ga0496106_0030073 3300048909 Bacteria 4050
246 Ga0496107_0009828 3300048910 Bacteria 6635
247 Ga0496108_0358772 3300048911 Bacteria 1272
248 Ga0496112_0218151 3300048915 Unclassified 1864
249 Ga0496113_0023995 3300048916 Bacteria 4330
250 Ga0496115_0012077 3300048918 Bacteria 6495
251 Ga0501047_0014355 3300049581 Bacteria 7531
252 Ga0501073_0070459 3300049589 Bacteria 2436
253 Ga0501073_0093164 3300049589 Bacteria 2093
254 Ga0501044_0021184 3300049823 Bacteria 6941
255 nmdc:mga05p37_111968_c1 3300050507 Bacteria 3356
256 nmdc:mga05p37_182883_c1 3300050507 Archaea 2549
257 nmdc:mga05p37_4142_c1 3300050507 Bacteria 16948
258 nmdc:mga05p37_4236_c1 3300050507 Bacteria 16751
259 nmdc:mga05p37_48480_c1 3300050507 Bacteria 5224
260 nmdc:mga05p37_58327_c1 3300050507 Bacteria 4754
261 nmdc:mga09592_150043_c1 3300050508 Unclassified 2011
262 nmdc:mga06r32_23254_c1 3300050510 Bacteria 5732
263 nmdc:mga06r32_257070_c1 3300050510 Bacteria 1734
264 nmdc:mga06r32_27021_c1 3300050510 Bacteria 5357
265 nmdc:mga08y16_10497_c1 3300050511 Bacteria 9716
266 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
267 nmdc:mga08y16_35300_c1 3300050511 Bacteria 5251
268 nmdc:mga0n895_146681_c1 3300050512 Bacteria 2390
269 nmdc:mga0n895_18026_c1 3300050512 Bacteria 6526
270 nmdc:mga0n895_227726_c1 3300050512 Bacteria 1892
271 nmdc:mga0n895_317218_c1 3300050512 Bacteria 1580
272 nmdc:mga0n895_331998_c1 3300050512 Bacteria 1540
273 nmdc:mga0n895_66159_c1 3300050512 Bacteria 3579
274 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
275 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
276 nmdc:mga0rr50_31819_c1 3300050513 Bacteria 3752
277 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
278 nmdc:mga08x19_40141_c1 3300050514 Bacteria 2978
279 nmdc:mga08x19_41524_c1 3300050514 Bacteria 2930
280 nmdc:mga0a205_140726_c1 3300050515 Bacteria 2313
281 nmdc:mga0a205_171547_c1 3300050515 Bacteria 2065
282 nmdc:mga0a205_2824_c1 3300050515 Bacteria 15368
283 nmdc:mga0a205_3446_c1 3300050515 Bacteria 14116
284 nmdc:mga0a205_5784_c3 3300050515 Bacteria 5597
285 nmdc:mga0a205_65143_c1 3300050515 Unclassified 3520
286 Ga0495595_0054826 3300053084 Bacteria 1854
287 Ga0495619_0000422 3300053085 Bacteria 28636
288 Ga0495619_0078227 3300053085 Bacteria 2223
289 Ga0501084_0067260 3300054114 Bacteria 2999
290 Ga0501082_0084998 3300060353 Bacteria 2729
291 Ga0501082_0110547 3300060353 Bacteria 2379
292 Ga0070699_100082265
293 JGI24751J29686_10002791
294 Ga0070658_10027014
295 Ga0070670_100029951
296 Ga0070670_100101746
297 Ga0070680_100041031
298 Ga0070682_100000002
299 Ga0068868_100000058
300 Ga0068868_100031964
301 Ga0068868_100057991
302 Ga0070691_10000473
303 Ga0070668_100088997
304 Ga0070669_100068789
305 Ga0070675_100000202
306 Ga0070675_100042776
307 Ga0070671_100109407
308 Ga0070674_100024262
309 Ga0070673_100052274
310 Ga0070659_100055466
311 Ga0070713_100091876
312 Ga0070711_100018111
313 Ga0070694_100005856
314 Ga0070663_100079002
315 Ga0070662_100050986
316 Ga0070681_10019500
317 Ga0068867_100009353
318 Ga0068867_100013323
319 Ga0068867_100049821
320 Ga0070685_10095512
321 Ga0070707_100034134
322 Ga0070707_100059879
323 Ga0070707_100182872
324 Ga0070698_100029348
325 Ga0070698_100042958
326 Ga0070698_100054630
327 Ga0070679_100022602
328 Ga0070684_100024919
329 Ga0070684_100129817
330 Ga0070697_100005886
331 Ga0070697_100045173
332 Ga0070672_100139333
333 Ga0070696_100003637
334 Ga0070665_100006386
335 Ga0070665_100008967
336 Ga0070704_100012818
337 Ga0070704_100058778
338 Ga0068857_100026725
339 Ga0068854_100090334
340 Ga0068856_100037119
341 Ga0068859_100000031
342 Ga0068859_100017910
343 Ga0068864_100006553
344 Ga0068864_100034868
345 Ga0068866_10010359
346 Ga0068861_100025235
347 Ga0068861_100047849
348 Ga0068851_10053636
349 Ga0068858_100013146
350 Ga0068858_100140611
351 Ga0068860_100015495
352 Ga0068860_100074940
353 Ga0068862_100072129
354 Ga0081539_10039031
355 Ga0070717_10000046
356 Ga0097621_100000477
357 Ga0097621_100002349
358 Ga0068871_100012430
359 Ga0068871_100044812
360 Ga0068871_100057850
361 Ga0068871_100117301
362 Ga0075431_100029686
363 Ga0075431_100031531
364 Ga0075431_100034724
365 Ga0075433_10001662
366 Ga0075433_10007021
367 Ga0075433_10016600
368 Ga0075433_10038802
369 Ga0075433_10048561
370 Ga0075433_10228459
371 Ga0075434_100001265
372 Ga0075434_100004294
373 Ga0075434_100005549
374 Ga0075434_100016684
375 Ga0075434_100017468
376 Ga0075434_100035368
377 Ga0075434_100045559
378 Ga0075434_100059288
379 Ga0075434_100288664
380 Ga0075429_100154670
381 Ga0075436_100000295
382 Ga0075436_100006650
383 Ga0075436_100032132
384 Ga0075436_100042518
385 Ga0075436_100052564
386 Ga0075436_100095091
387 Ga0097620_100000031
388 Ga0097620_100017910
389 Ga0075435_100000147
390 Ga0075435_100012687
391 Ga0075435_100020798
392 Ga0075435_100037478
393 Ga0075435_100057865
394 Ga0075435_100092714
395 Ga0099794_10070987
396 Ga0105240_10011792
397 Ga0105240_10034088
398 Ga0111539_10002429
399 Ga0111539_10023244
400 Ga0105245_10006944
401 Ga0105247_10044984
402 Ga0114129_10001754
403 Ga0114129_10009067
404 Ga0114129_10034155
405 Ga0114129_10036366
406 Ga0114129_10112109
407 Ga0114129_10125831
408 Ga0114129_10239669
409 Ga0105243_10016882
410 Ga0105242_10003632
411 Ga0105242_10019645
412 Ga0105248_10004014
413 Ga0105248_10014472
414 Ga0105248_10033764
415 Ga0105248_10043896
416 Ga0105248_10245324
417 Ga0105237_10155042
418 Ga0105249_10017645
419 Ga0105239_10236555
420 Ga0157378_10001821
421 Ga0157378_10003680
422 Ga0157378_10023338
423 Ga0157378_10026628
424 Ga0163162_10004675
425 Ga0157375_10000047
426 Ga0157375_10028668
427 Ga0163163_10010892
428 Ga0163163_10013097
429 Ga0163163_10024760
430 Ga0163163_10113565
431 Ga0157377_10000220
432 Ga0157379_10036639
433 Ga0157379_10044495
434 Ga0157376_10011926
435 Ga0157376_10073430
436 Ga0207653_10001815
437 Ga0207682_10011954
438 Ga0207642_10032743
439 Ga0207705_10037376
440 Ga0207684_10108067
441 Ga0207707_10036870
442 Ga0207707_10039875
443 Ga0207693_10062656
444 Ga0207663_10007364
445 Ga0207649_10102284
446 Ga0207652_10038008
447 Ga0207646_10001582
448 Ga0207646_10105687
449 Ga0207681_10019225
450 Ga0207659_10000076
451 Ga0207659_10054425
452 Ga0207659_10060864
453 Ga0207659_10102371
454 Ga0207687_10030793
455 Ga0207700_10067925
456 Ga0207700_10091898
457 Ga0207706_10043137
458 Ga0207686_10017136
459 Ga0207686_10024153
460 Ga0207670_10177669
461 Ga0207669_10025967
462 Ga0207691_10127621
463 Ga0207711_10016158
464 Ga0207711_10077912
465 Ga0207711_10113862
466 Ga0207689_10038300
467 Ga0207689_10087355
468 Ga0207689_10109561
469 Ga0207667_10045125
470 Ga0207667_10146779
471 Ga0207651_10155426
472 Ga0207712_10019405
473 Ga0207712_10129688
474 Ga0207640_10026213
475 Ga0207677_10000004
476 Ga0207702_10079798
477 Ga0207641_10001113
478 Ga0207648_10015198
479 Ga0207648_10045998
480 Ga0207648_10049139
481 Ga0207676_10182301
482 Ga0207675_100009497
483 Ga0207675_100022324
484 Ga0207675_100030535
485 Ga0207675_100043211
486 Ga0207698_10095439
487 Ga0207428_10044726
488 Ga0207428_10090863
489 Ga0268266_10003789
490 Ga0268265_10005243
491 Ga0268265_10015893
492 Ga0268265_10053239
493 Ga0268264_10086899
494 Ga0265318_10028966
495 Ga0265323_10021116
496 Ga0265323_10022102
497 Ga0265322_10003337
498 Ga0265336_10000927
499 Ga0265338_10000128
500 Ga0265338_10032229
501 Ga0307511_10011008
502 Ga0265339_10024521
503 Ga0265316_10011285
504 Ga0265316_10019634
505 Ga0265342_10000014
506 Ga0307411_10013487
507 Ga0307415_100077487
508 Ga0373932_0000177
509 Ga0373941_0009941
510 Ga0373935_0024361
511 Ga0373933_0095151
512 Ga0373933_0124095
513 Ga0373947_0007561
514 Ga0373937_0066899
515 Ga0373937_0117406
516 Ga0373925_0000666
517 Ga0466967_0134139
518 Ga0495592_0047193
519 Ga0495580_0000822
520 Ga0495580_0034257
521 Ga0495608_0011561
522 Ga0495630_0013627
523 Ga0495586_0082806
524 Ga0495587_0082979
525 Ga0495621_0041121
526 Ga0495635_0073016
527 Ga0495635_0171795
528 Ga0495658_0024034
529 Ga0495658_0051242
530 Ga0495658_0060332
531 Ga0495669_0000990
532 Ga0495669_0016071
533 Ga0495613_0004695
534 Ga0495674_0029729
535 Ga0495684_0000228
536 Ga0496106_0030073
537 Ga0496107_0009828
538 Ga0496108_0358772
539 Ga0496112_0218151
540 Ga0496113_0023995
541 Ga0496115_0012077
542 Ga0501047_0014355
543 Ga0501073_0070459
544 Ga0501073_0093164
545 Ga0501044_0021184
546 nmdc:mga05p37_111968_c1
547 nmdc:mga05p37_182883_c1
548 nmdc:mga05p37_4142_c1
549 nmdc:mga05p37_4236_c1
550 nmdc:mga05p37_48480_c1
551 nmdc:mga05p37_58327_c1
552 nmdc:mga09592_150043_c1
553 nmdc:mga06r32_23254_c1
554 nmdc:mga06r32_257070_c1
555 nmdc:mga06r32_27021_c1
556 nmdc:mga08y16_10497_c1
557 nmdc:mga08y16_1923_c1
558 nmdc:mga08y16_35300_c1
559 nmdc:mga0n895_146681_c1
560 nmdc:mga0n895_18026_c1
561 nmdc:mga0n895_227726_c1
562 nmdc:mga0n895_317218_c1
563 nmdc:mga0n895_331998_c1
564 nmdc:mga0n895_66159_c1
565 nmdc:mga0n895_97_c2
566 nmdc:mga0rr50_20_c1
567 nmdc:mga0rr50_31819_c1
568 nmdc:mga08x19_178_c1
569 nmdc:mga08x19_40141_c1
570 nmdc:mga08x19_41524_c1
571 nmdc:mga0a205_140726_c1
572 nmdc:mga0a205_171547_c1
573 nmdc:mga0a205_2824_c1
574 nmdc:mga0a205_3446_c1
575 nmdc:mga0a205_5784_c3
576 nmdc:mga0a205_65143_c1
577 Ga0495595_0054826
578 Ga0495619_0000422
579 Ga0495619_0078227
580 Ga0501084_0067260
581 Ga0501082_0084998
582 Ga0501082_0110547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08013

GatZ_KbaZ-like

D-tagatose-1,6-bisphosphate aldolase subunit GatZ/KbaZ-like

127

272

0.8

PF01116

F_bP_aldolase

Fructose-bisphosphate aldolase class-II

80

438

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q57-assembly1.cif.gz_A crystal structure of class ii sfp aldolase from yersinia aldovae (yasqia-zn-so4) with bound sulfate ions 0.7511 67 447
8q57-assembly1.cif.gz_A crystal structure of class ii sfp aldolase from yersinia aldovae (yasqia-zn-so4) with bound sulfate ions 0.7438 67 447
7nc7-assembly1.cif.gz_B crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.7087 67 440
8q5a-assembly1.cif.gz_A crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) 0.7085 75 417
3n9r-assembly4.cif.gz_P class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor 0.7039 71 442
ID Description Score Start End Superfamily
2fiqD01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7785 76 357 3.20.20.70
2fiqD01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7459 76 357 3.20.20.70
af_Q652S1_1097_1376_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.687 71 416 3.20.20.70
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6794 68 417 3.20.20.70
af_Q58499_2_234_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.6787 90 353 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A2V8EFU5-F1-model_v4 Aldolase 0.9939 2 273 GO:0005975
GO:0008270
GO:0016832
AF-A0A2V7ER36-F1-model_v4 Aldolase 0.9937 36 456 GO:0005975
GO:0008270
GO:0016832
AF-A0A656DDC2-F1-model_v4 Fructose-bisphosphate aldolase class-II 0.9916 63 450 GO:0005975
GO:0008270
GO:0016832
AF-A0A2V7GEJ8-F1-model_v4 Aldolase 0.9905 36 406 GO:0005975
GO:0008270
GO:0016832
AF-A0A3N5ZFG2-F1-model_v4 Aldolase 0.9902 4 482 GO:0005975
GO:0008270
GO:0016832

Map