F390167

General Info

Members Datasets Scaffolds Average Seq Length
291 216 225 302

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100069498|Ga0070670_1000694983
Length 341
Sequence VNTFDYAPDRPDLPKSALVGYCLPCFPPQHFASRKTKDTMAGSSFFALIDDIAGILDDVSAMTKVAAKKTAGVLGDDLALNAQQVSGVNADRELPVVWAVALGSLKNKAILVPAALAISAFAPWAVTPLLMLGGAFLCFEGFEKLAHKYLPHEEEHHDQAAPETAESESDKIKGAIRTDFILSAEIIAITLGTVAGAPLQQQITVLIGIALIMTVGVYGVVAGIVKLDDGGLYLLRTGGKFAQRIGRAILVAAPYMMKSLTVIGTVAMFMVGGGILTHGIAPVHHWIADVSAPLATVPVVGGLLSVLAPPALDAVFGVIAGAVVLLLVTMVKRVLNIFKKN

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
7 2547132374 Acidovorax radicis N35 Isolate Unclassified
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
10 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
11 2643221569 Achromobacter sp. Root565 Isolate Unclassified
12 2643221594 Achromobacter sp. Root170 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221611 Acidovorax sp. Root219 Isolate Unclassified
16 2643221621 Achromobacter sp. Root83 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
19 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
20 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
21 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
24 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
25 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
26 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
27 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
28 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
29 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
30 2816332133 Acidovorax radicis 2721A Isolate Unclassified
31 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
32 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
33 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
34 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
35 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
36 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
37 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
38 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
39 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
40 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
41 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
42 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
43 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
44 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
45 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
46 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
47 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
48 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
49 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
50 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
51 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
52 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
53 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
54 2932406140 Serratia sp. 2723 Isolate Rhizosphere
55 2937967321 Serratia sp. YC16 Isolate Unclassified
56 2939577877 Serratia sp. 509 Isolate Rhizosphere
57 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
58 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
59 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
60 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
133 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
144 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
145 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
210 640753048 Serratia proteamaculans 568 Isolate Endosphere
211 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
212 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
213 8004592986 Serratia sp. S119 Isolate Unclassified
214 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
215 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
216 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.29
Metatranscriptomes 1.03
Isolates 22.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 2.06
Rhizoplane 0.34
Rhizosphere 65.98
Stem 0
Stem Tuber 0
Unclassified 25.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000603 3300002704 Bacteria 7671
2 JGI25155J39150_1000840 3300002704 Bacteria 4659
3 JGI25156J39149_1000453 3300002705 Bacteria 24978
4 JGI25156J39149_1002052 3300002705 Bacteria 7659
5 JGI25154J39366_1000767 3300002738 Bacteria 14236
6 JGI25154J39366_1001609 3300002738 Bacteria 7667
7 JGI25157J39369_1000350 3300002741 Bacteria 32509
8 JGI25159J45721_1004898 3300002987 Bacteria 4307
9 JGI25151J46595_10005186 3300003187 Bacteria 6758
10 JGI25151J46595_10009835 3300003187 Bacteria 4495
11 Ga0055532_1000018 3300003758 Bacteria 305466
12 Ga0055535_1005367 3300003761 Bacteria 2831
13 Ga0065165_1016216 3300005262 Bacteria 2799
14 Ga0065704_10127944 3300005289 Bacteria 1668
15 Ga0070670_100069498 3300005331 Bacteria 3023
16 Ga0070678_100095737 3300005456 Bacteria 2289
17 Ga0068855_100007751 3300005563 Bacteria 12965
18 Ga0068855_100031971 3300005563 Bacteria 6283
19 Ga0068854_100007964 3300005578 Bacteria 6785
20 Ga0068854_100209420 3300005578 Bacteria 1537
21 Ga0068856_100133263 3300005614 Bacteria 2490
22 Ga0068852_100072140 3300005616 Bacteria 3034
23 Ga0075362_10077706 3300006177 Bacteria 1526
24 Ga0097621_100186849 3300006237 Bacteria 1793
25 Ga0079104_1000734 3300006946 Bacteria 29048
26 Ga0079104_1003078 3300006946 Bacteria 8132
27 Ga0105251_10000262 3300009011 Bacteria 52352
28 Ga0105251_10000479 3300009011 Bacteria 37816
29 Ga0105251_10006621 3300009011 Bacteria 7335
30 Ga0105251_10008060 3300009011 Bacteria 6386
31 Ga0105244_10000020 3300009036 Bacteria 241021
32 Ga0105244_10001810 3300009036 Bacteria 16728
33 Ga0105244_10005682 3300009036 Bacteria 8229
34 Ga0105244_10084448 3300009036 Bacteria 1568
35 Ga0105250_10005830 3300009092 Bacteria 5469
36 Ga0105250_10011676 3300009092 Bacteria 3641
37 Ga0105240_10001931 3300009093 Bacteria 34408
38 Ga0105240_10002138 3300009093 Bacteria 32275
39 Ga0105247_10000018 3300009101 Bacteria 259335
40 Ga0105241_10000004 3300009174 Bacteria 803007
41 Ga0105237_10065160 3300009545 Bacteria 3640
42 Ga0105238_10000004 3300009551 Bacteria 390514
43 Ga0105239_10001658 3300010375 Bacteria 29346
44 Ga0157373_10003030 3300013100 Bacteria 12666
45 Ga0157369_10280149 3300013105 Bacteria 1736
46 Ga0182008_10019345 3300014497 Bacteria 3516
47 Ga0182008_10021597 3300014497 Bacteria 3305
48 Ga0182006_1003475 3300015261 Bacteria 8041
49 Ga0182006_1039313 3300015261 Bacteria 1867
50 Ga0163161_10000001 3300017792 Bacteria 2041488
51 Ga0163161_10006564 3300017792 Bacteria 8052
52 Ga0213872_10005876 3300021361 Bacteria 6229
53 Ga0213872_10033810 3300021361 Bacteria 2342
54 Ga0209435_100007 3300025206 Bacteria 516857
55 Ga0209435_100151 3300025206 Bacteria 22562
56 Ga0209147_100017 3300025229 Bacteria 516857
57 Ga0209437_100088 3300025233 Bacteria 251174
58 Ga0209258_100215 3300025242 Bacteria 114444
59 Ga0209646_1000044 3300025246 Bacteria 334596
60 Ga0209646_1000282 3300025246 Bacteria 44376
61 Ga0209646_1000287 3300025246 Bacteria 43455
62 Ga0209026_1000353 3300025250 Bacteria 43358
63 Ga0209026_1005158 3300025250 Bacteria 3594
64 Ga0209759_1000255 3300025256 Bacteria 78459
65 Ga0209759_1000388 3300025256 Bacteria 54852
66 Ga0209455_1003563 3300025272 Bacteria 5441
67 Ga0209676_1002654 3300025292 Bacteria 12152
68 Ga0209050_1006674 3300025298 Bacteria 6754
69 Ga0207696_1000001 3300025711 Bacteria 2579611
70 Ga0207696_1003312 3300025711 Bacteria 7415
71 Ga0207655_1000011 3300025728 Bacteria 643321
72 Ga0207655_1041497 3300025728 Bacteria 1971
73 Ga0207713_1000024 3300025735 Bacteria 339156
74 Ga0207713_1000026 3300025735 Bacteria 319032
75 Ga0207713_1002505 3300025735 Bacteria 13311
76 Ga0207713_1009430 3300025735 Bacteria 5500
77 Ga0207710_10000049 3300025900 Bacteria 186492
78 Ga0207654_10000006 3300025911 Bacteria 815027
79 Ga0207695_10000392 3300025913 Bacteria 98469
80 Ga0207695_10001007 3300025913 Bacteria 49769
81 Ga0207695_10005275 3300025913 Bacteria 17229
82 Ga0207671_10194387 3300025914 Bacteria 1583
83 Ga0207694_10000021 3300025924 Bacteria 300246
84 Ga0207650_10230404 3300025925 Bacteria 1494
85 Ga0207686_10197734 3300025934 Bacteria 1438
86 Ga0207667_10000235 3300025949 Bacteria 77134
87 Ga0207667_10018886 3300025949 Bacteria 7713
88 Ga0207667_10174035 3300025949 Bacteria 2212
89 Ga0207640_10089059 3300025981 Bacteria 2132
90 Ga0207702_10032758 3300026078 Bacteria 4337
91 Ga0207683_10022971 3300026121 Bacteria 5361
92 Ga0209281_1000008 3300027111 Bacteria 867470
93 Ga0209371_1015957 3300027312 Bacteria 1998
94 Ga0209996_1002631 3300027395 Bacteria 2230
95 Ga0209999_1007928 3300027543 Bacteria 1910
96 Ga0209983_1000521 3300027665 Bacteria 8279
97 Ga0209971_1002425 3300027682 Bacteria 4485
98 Ga0307408_100000337 3300031548 Bacteria 44537
99 Ga0307408_100106445 3300031548 Bacteria 2146
100 Ga0316575_10004223 3300031665 Bacteria 5041
101 Ga0316579_10003340 3300031691 Bacteria 6235
102 Ga0316576_10016180 3300031727 Bacteria 5030
103 Ga0316576_10027527 3300031727 Bacteria 3998
104 Ga0316576_10116094 3300031727 Bacteria 2008
105 Ga0316578_10002807 3300031728 Bacteria 7774
106 Ga0316578_10006509 3300031728 Bacteria 5775
107 Ga0316578_10051738 3300031728 Bacteria 2405
108 Ga0316578_10209919 3300031728 Bacteria 1171
109 Ga0316577_10080817 3300031733 Bacteria 1817
110 Ga0307406_10004849 3300031901 Bacteria 7327
111 Ga0316583_10015296 3300032133 Bacteria 2761
112 Ga0316585_10010719 3300032137 Bacteria 2693
113 Ga0316580_10026761 3300032139 Bacteria 1783
114 Ga0316580_10047370 3300032139 Bacteria 1325
115 Ga0316592_1014268 3300033524 Bacteria 1646
116 Ga0316588_1016728 3300033528 Bacteria 1629
117 Ga0316596_1019344 3300033541 Bacteria 1728
118 Ga0316574_0003681 3300035398 Bacteria 7937
119 Ga0316582_0034892 3300036647 Bacteria 3101
120 Ga0316582_0244489 3300036647 Bacteria 1229
121 Ga0316584_0006339 3300036712 Bacteria 8013
122 Ga0316584_0015750 3300036712 Bacteria 5412
123 Ga0316584_0094732 3300036712 Bacteria 2235
124 Ga0395905_0007933 3300037471 Bacteria 10501
125 Ga0436361_0181767 3300039447 Bacteria 1091
126 Ga0436361_0888604 3300039447 Bacteria 23958
127 Ga0436361_1197998 3300039447 Bacteria 4340
128 Ga0439447_001257 3300041407 Bacteria 9223
129 Ga0439432_002725 3300042006 Bacteria 6604
130 Ga0439452_018796 3300042010 Bacteria 1835
131 Ga0450911_000374 3300042115 Bacteria 14904
132 Ga0450915_001686 3300042119 Bacteria 1066
133 Ga0450923_013583 3300042125 Bacteria 1498
134 Ga0450888_002425 3300042126 Bacteria 1842
135 Ga0439446_0003517 3300042156 Bacteria 3900
136 Ga0495627_000028 3300046453 Bacteria 234737
137 Ga0495650_0000680 3300046471 Bacteria 44187
138 Ga0495650_0016676 3300046471 Bacteria 3710
139 Ga0495605_0117846 3300046474 Bacteria 1206
140 Ga0495594_0006749 3300046499 Bacteria 5905
141 Ga0495594_0017989 3300046499 Bacteria 3741
142 Ga0495594_0101749 3300046499 Bacteria 1616
143 Ga0495606_0005714 3300046507 Bacteria 11769
144 Ga0495606_0090360 3300046507 Bacteria 1885
145 Ga0495637_0003374 3300046520 Bacteria 8483
146 Ga0495648_0001760 3300046524 Bacteria 20908
147 Ga0495654_0000384 3300046530 Bacteria 38167
148 Ga0495654_0001911 3300046530 Bacteria 13829
149 Ga0495654_0010649 3300046530 Bacteria 4995
150 Ga0495654_0021790 3300046530 Bacteria 3332
151 Ga0495654_0092700 3300046530 Bacteria 1400
152 Ga0495587_0054837 3300046536 Bacteria 2348
153 Ga0495597_0000545 3300046542 Bacteria 31204
154 Ga0495597_0001509 3300046542 Bacteria 16616
155 Ga0495622_0000019 3300046557 Bacteria 169931
156 Ga0495622_0034778 3300046557 Bacteria 2350
157 Ga0495611_0107841 3300046648 Bacteria 1295
158 Ga0495625_0004933 3300046660 Bacteria 12409
159 Ga0495625_0022326 3300046660 Bacteria 4854
160 Ga0495588_0028883 3300046674 Bacteria 2779
161 Ga0495670_0004748 3300046691 Bacteria 6673
162 Ga0495670_0015800 3300046691 Bacteria 3710
163 Ga0495589_0000002 3300046794 Bacteria 758846
164 Ga0495636_0000290 3300047318 Bacteria 19663
165 Ga0495672_0000204 3300047320 Bacteria 84394
166 Ga0495676_0013607 3300047321 Bacteria 7304
167 Ga0495679_000052 3300047446 Bacteria 120793
168 Ga0495681_0019831 3300047470 Bacteria 3660
169 Ga0495626_0000001 3300048091 Bacteria 1077129
170 Ga0495626_0004047 3300048091 Bacteria 9138
171 Ga0496116_0000023 3300048919 Bacteria 475792
172 Ga0496116_0002159 3300048919 Bacteria 20949
173 Ga0496116_0113900 3300048919 Bacteria 1581
174 Ga0496117_0012293 3300048920 Bacteria 7566
175 Ga0496118_0072602 3300048921 Bacteria 2470
176 Ga0496118_0121270 3300048921 Bacteria 1704
177 Ga0496119_0002699 3300048922 Bacteria 19172
178 Ga0496119_0002726 3300048922 Bacteria 19044
179 Ga0496119_0003692 3300048922 Bacteria 15676
180 Ga0496119_0040015 3300048922 Bacteria 3005
181 Ga0496120_0000084 3300048923 Bacteria 156678
182 Ga0496120_0000427 3300048923 Bacteria 66859
183 Ga0496120_0002118 3300048923 Bacteria 21228
184 Ga0496121_0005876 3300048924 Bacteria 15543
185 Ga0496121_0011040 3300048924 Bacteria 10082
186 Ga0496121_0058532 3300048924 Bacteria 3185
187 Ga0496122_0005870 3300048925 Bacteria 14384
188 Ga0496123_0000392 3300048926 Bacteria 81982
189 Ga0496124_0000017 3300048927 Bacteria 444389
190 Ga0496124_0112508 3300048927 Bacteria 2189
191 Ga0496125_0005773 3300048928 Bacteria 13598
192 Ga0496125_0008570 3300048928 Bacteria 10679
193 Ga0496125_0024230 3300048928 Bacteria 5584
194 Ga0496125_0031472 3300048928 Bacteria 4728
195 Ga0496126_0180185 3300048929 Bacteria 1795
196 Ga0501032_0087743 3300049569 Bacteria 2065
197 Ga0501034_0002350 3300049571 Bacteria 23054
198 Ga0501036_0004892 3300049572 Bacteria 10821
199 Ga0501036_0007697 3300049572 Bacteria 8798
200 Ga0501037_0000099 3300049573 Bacteria 81092
201 Ga0501038_0001980 3300049574 Bacteria 18928
202 Ga0501039_0001012 3300049575 Bacteria 20498
203 Ga0501040_0071900 3300049576 Bacteria 2389
204 Ga0501042_0057588 3300049578 Bacteria 2773
205 Ga0501043_0000228 3300049579 Bacteria 51127
206 Ga0501047_0159523 3300049581 Bacteria 2127
207 Ga0501070_0003213 3300049586 Bacteria 14210
208 Ga0501072_0005084 3300049588 Bacteria 10015
209 Ga0501075_0002133 3300049591 Bacteria 13089
210 Ga0501076_0000399 3300049592 Bacteria 27186
211 Ga0501077_0161770 3300049593 Bacteria 1421
212 Ga0501227_001108 3300049665 Bacteria 5993
213 Ga0501083_0016192 3300049744 Bacteria 5221
214 Ga0501266_002442 3300049763 Bacteria 2343
215 Ga0501279_000464 3300049775 Bacteria 5385
216 Ga0501044_0014552 3300049823 Bacteria 8488
217 nmdc:mga0k408_70544_c1 3300050493 Bacteria 2039
218 Ga0500641_0151978 3300053096 Bacteria 999
219 Ga0500562_001096 3300053108 Bacteria 6653
220 Ga0500618_004652 3300053125 Bacteria 4322
221 Ga0501084_0018643 3300054114 Bacteria 5777
222 Ga0501084_0023948 3300054114 Bacteria 5093
223 Ga0501082_0038905 3300060353 Bacteria 4103
224 Ga0530510_0008412 3300061734 Bacteria 7192
225 Ga0530510_0014435 3300061734 Bacteria 5568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 640427133 640488402 245
2 3300053096 Ga0500641_0151978 Ga0500641_0151978_24_959 256
3 3300037471 Ga0395905_0007933 Ga0395905_0007933_64_984 263
4 3300047470 Ga0495681_0019831 Ga0495681_0019831_1794_2726 263
5 3300048091 Ga0495626_0004047 Ga0495626_0004047_6946_7878 263
6 3300015261 Ga0182006_1039313 Ga0182006_10393131 268
7 3300005563 Ga0068855_100031971 Ga0068855_1000319712 269
8 3300009551 Ga0105238_10000004 Ga0105238_10000004123 269
9 3300010375 Ga0105239_10001658 Ga0105239_1000165813 269
10 3300025913 Ga0207695_10001007 Ga0207695_1000100745 269
11 3300025924 Ga0207694_10000021 Ga0207694_1000002141 269
12 3300025949 Ga0207667_10018886 Ga0207667_100188864 269
13 3300046474 Ga0495605_0117846 Ga0495605_0117846_35_994 269
14 3300046530 Ga0495654_0000384 Ga0495654_0000384_6840_7799 269
15 3300009036 Ga0105244_10005682 Ga0105244_100056825 270
16 3300009036 Ga0105244_10084448 Ga0105244_100844481 270
17 3300009092 Ga0105250_10011676 Ga0105250_100116763 270
18 3300025711 Ga0207696_1003312 Ga0207696_10033124 270
19 3300025728 Ga0207655_1041497 Ga0207655_10414972 270
20 3300031727 Ga0316576_10016180 Ga0316576_100161804 270
21 3300031728 Ga0316578_10006509 Ga0316578_100065094 270
22 3300036712 Ga0316584_0006339 Ga0316584_0006339_6851_7819 270
23 3300046542 Ga0495597_0001509 Ga0495597_0001509_11576_12490 270
24 3300046674 Ga0495588_0028883 Ga0495588_0028883_1589_2503 270
25 3300047320 Ga0495672_0000204 Ga0495672_0000204_20137_21051 270
26 3300049665 Ga0501227_001108 Ga0501227_001108_4991_5920 270
27 3300049775 Ga0501279_000464 Ga0501279_000464_3186_4115 271
28 iso_pu_bacteria 2728369097 2729147917 271
29 3300048922 Ga0496119_0002699 Ga0496119_0002699_5243_6097 272
30 3300048922 Ga0496119_0003692 Ga0496119_0003692_3179_4033 272
31 3300048923 Ga0496120_0000084 Ga0496120_0000084_132162_133016 272
32 3300048923 Ga0496120_0000427 Ga0496120_0000427_43352_44206 272
33 3300048927 Ga0496124_0000017 Ga0496124_0000017_420831_421685 272
34 3300031548 Ga0307408_100000337 Ga0307408_1000003373 275
35 3300031901 Ga0307406_10004849 Ga0307406_100048493 275
36 3300046520 Ga0495637_0003374 Ga0495637_0003374_1244_2155 276
37 3300005578 Ga0068854_100007964 Ga0068854_1000079648 277
38 3300006237 Ga0097621_100186849 Ga0097621_1001868492 277
39 3300009545 Ga0105237_10065160 Ga0105237_100651604 277
40 3300015261 Ga0182006_1003475 Ga0182006_10034759 277
41 3300025914 Ga0207671_10194387 Ga0207671_101943872 277
42 3300025981 Ga0207640_10089059 Ga0207640_100890592 277
43 3300031727 Ga0316576_10027527 Ga0316576_100275274 277
44 3300005456 Ga0070678_100095737 Ga0070678_1000957372 278
45 3300017792 Ga0163161_10006564 Ga0163161_1000656410 278
46 3300026121 Ga0207683_10022971 Ga0207683_100229712 278
47 3300009036 Ga0105244_10000020 Ga0105244_10000020250 279
48 3300048927 Ga0496124_0112508 Ga0496124_0112508_1116_2033 279
49 3300009011 Ga0105251_10008060 Ga0105251_100080607 280
50 3300025735 Ga0207713_1009430 Ga0207713_10094307 280
51 3300041407 Ga0439447_001257 Ga0439447_001257_671_1585 280
52 3300042006 Ga0439432_002725 Ga0439432_002725_5373_6287 280
53 3300042010 Ga0439452_018796 Ga0439452_018796_105_1019 280
54 3300042115 Ga0450911_000374 Ga0450911_000374_5395_6324 280
55 3300042125 Ga0450923_013583 Ga0450923_013583_542_1456 280
56 3300042156 Ga0439446_0003517 Ga0439446_0003517_2719_3633 280
57 3300048924 Ga0496121_0005876 Ga0496121_0005876_9961_10875 280
58 3300048928 Ga0496125_0008570 Ga0496125_0008570_7189_8103 280
59 3300048928 Ga0496125_0031472 Ga0496125_0031472_385_1314 280
60 3300048929 Ga0496126_0180185 Ga0496126_0180185_526_1455 280
61 3300049569 Ga0501032_0087743 Ga0501032_0087743_397_1356 280
62 3300049571 Ga0501034_0002350 Ga0501034_0002350_19168_20127 280
63 3300049572 Ga0501036_0007697 Ga0501036_0007697_5430_6389 280
64 3300049573 Ga0501037_0000099 Ga0501037_0000099_67770_68729 280
65 3300049574 Ga0501038_0001980 Ga0501038_0001980_12736_13695 280
66 3300049575 Ga0501039_0001012 Ga0501039_0001012_18830_19789 280
67 3300049579 Ga0501043_0000228 Ga0501043_0000228_40593_41552 280
68 3300049586 Ga0501070_0003213 Ga0501070_0003213_8686_9645 280
69 3300049593 Ga0501077_0161770 Ga0501077_0161770_128_1069 280
70 3300049823 Ga0501044_0014552 Ga0501044_0014552_1516_2475 280
71 3300025292 Ga0209676_1002654 Ga0209676_10026543 281
72 3300025298 Ga0209050_1006674 Ga0209050_10066744 281
73 3300027312 Ga0209371_1015957 Ga0209371_10159572 281
74 3300046530 Ga0495654_0010649 Ga0495654_0010649_1444_2367 281
75 3300046530 Ga0495654_0021790 Ga0495654_0021790_1735_2658 281
76 3300046660 Ga0495625_0004933 Ga0495625_0004933_1751_2674 281
77 3300047446 Ga0495679_000052 Ga0495679_000052_69183_70106 281
78 3300042119 Ga0450915_001686 Ga0450915_001686_120_1034 282
79 3300042126 Ga0450888_002425 Ga0450888_002425_182_1096 282
80 3300046471 Ga0495650_0016676 Ga0495650_0016676_2436_3380 282
81 3300046524 Ga0495648_0001760 Ga0495648_0001760_17529_18524 282
82 3300025934 Ga0207686_10197734 Ga0207686_101977342 283
83 3300046507 Ga0495606_0005714 Ga0495606_0005714_7916_8854 283
84 3300053108 Ga0500562_001096 Ga0500562_001096_816_1751 283
85 3300005563 Ga0068855_100007751 Ga0068855_1000077517 284
86 3300025949 Ga0207667_10000235 Ga0207667_1000023564 284
87 3300031548 Ga0307408_100106445 Ga0307408_1001064453 284
88 3300049763 Ga0501266_002442 Ga0501266_002442_1074_2123 285
89 3300013105 Ga0157369_10280149 Ga0157369_102801492 286
90 3300046471 Ga0495650_0000680 Ga0495650_0000680_22965_23927 286
91 3300046542 Ga0495597_0000545 Ga0495597_0000545_12171_13133 286
92 3300048091 Ga0495626_0000001 Ga0495626_0000001_702397_703359 286
93 3300031728 Ga0316578_10051738 Ga0316578_100517382 287
94 3300046453 Ga0495627_000028 Ga0495627_000028_129692_130618 287
95 3300048922 Ga0496119_0002726 Ga0496119_0002726_9609_10514 287
96 3300048923 Ga0496120_0002118 Ga0496120_0002118_9298_10203 287
97 iso_pu_bacteria 2599185292 2599903107 287
98 iso_pu_bacteria 2643221569 2643862400 287
99 iso_pu_bacteria 2643221594 2643980594 287
100 iso_pu_bacteria 2643221621 2644122020 287
101 iso_pu_bacteria 2711768156 2712469521 287
102 iso_pu_bacteria 2808606395 2809032089 287
103 iso_pu_bacteria 2857537821 2857538584 287
104 iso_pu_bacteria 2891670763 2891671391 287
105 iso_pu_bacteria 3000376612 3000379570 287
106 iso_pu_bacteria 8054849141 8054851624 287
107 3300009011 Ga0105251_10006621 Ga0105251_100066216 288
108 3300031733 Ga0316577_10080817 Ga0316577_100808172 288
109 3300046530 Ga0495654_0092700 Ga0495654_0092700_335_1249 288
110 3300046660 Ga0495625_0022326 Ga0495625_0022326_1285_2250 288
111 3300048922 Ga0496119_0040015 Ga0496119_0040015_1420_2346 288
112 3300049572 Ga0501036_0004892 Ga0501036_0004892_3474_4415 288
113 3300049576 Ga0501040_0071900 Ga0501040_0071900_1016_1957 288
114 3300049578 Ga0501042_0057588 Ga0501042_0057588_744_1685 288
115 3300049588 Ga0501072_0005084 Ga0501072_0005084_7819_8760 288
116 3300049591 Ga0501075_0002133 Ga0501075_0002133_7505_8446 288
117 3300049592 Ga0501076_0000399 Ga0501076_0000399_2277_3218 288
118 3300054114 Ga0501084_0018643 Ga0501084_0018643_184_1125 288
119 3300061734 Ga0530510_0008412 Ga0530510_0008412_6177_7118 288
120 3300061734 Ga0530510_0014435 Ga0530510_0014435_2795_3736 288
121 3300017792 Ga0163161_10000001 Ga0163161_1000000185 289
122 3300025735 Ga0207713_1000024 Ga0207713_100002464 289
123 iso_pu_bacteria 2888373701 2888374451 289
124 iso_pu_bacteria 2506520007 2506577379 290
125 iso_pu_bacteria 2506520008 2506582517 290
126 iso_pu_bacteria 2508501071 2508851330 290
127 iso_pu_bacteria 2654587920 2656278296 290
128 iso_pu_bacteria 2687453601 2689443856 290
129 iso_pu_bacteria 2772190666 2772437891 290
130 iso_pu_bacteria 2806310673 2807180362 290
131 iso_pu_bacteria 2869551831 2869553243 290
132 iso_pu_bacteria 2888366609 2888367889 290
133 iso_pu_bacteria 2932406140 2932408592 290
134 iso_pu_bacteria 2937967321 2937969620 290
135 iso_pu_bacteria 2939577877 2939578984 290
136 iso_pu_bacteria 640753048 640936887 290
137 iso_pu_bacteria 8004592986 8004594904 290
138 iso_pu_bacteria 8015394850 8015399451 290
139 3300021361 Ga0213872_10005876 Ga0213872_100058766 291
140 3300039447 Ga0436361_0888604 Ga0436361_0888604_7012_7950 291
141 3300046557 Ga0495622_0034778 Ga0495622_0034778_1382_2296 291
142 3300048919 Ga0496116_0002159 Ga0496116_0002159_7209_8126 291
143 iso_pu_bacteria 2547132374 2548498606 292
144 iso_pu_bacteria 2643221717 2644649341 292
145 iso_pu_bacteria 651053060 651176437 292
146 iso_pu_bacteria 8055693939 8055696963 292
147 3300050493 nmdc:mga0k408_70544_c1 nmdc:mga0k408_70544_c1_480_1403 293
148 iso_pu_bacteria 2643221596 2643990622 293
149 iso_pu_bacteria 2643221609 2644061102 293
150 iso_pu_bacteria 2643221611 2644071811 293
151 iso_pu_bacteria 2738543012 2739243442 293
152 iso_pu_bacteria 2816332133 2816475342 293
153 iso_pu_bacteria 2990710928 2990712009 293
154 3300005289 Ga0065704_10127944 Ga0065704_101279441 294
155 3300006946 Ga0079104_1000734 Ga0079104_100073425 294
156 3300006946 Ga0079104_1003078 Ga0079104_10030789 294
157 3300009011 Ga0105251_10000262 Ga0105251_1000026221 294
158 3300009011 Ga0105251_10000479 Ga0105251_1000047931 294
159 3300009036 Ga0105244_10001810 Ga0105244_1000181016 294
160 3300009092 Ga0105250_10005830 Ga0105250_100058305 294
161 3300009101 Ga0105247_10000018 Ga0105247_10000018223 294
162 3300009174 Ga0105241_10000004 Ga0105241_10000004515 294
163 3300013100 Ga0157373_10003030 Ga0157373_1000303012 294
164 3300014497 Ga0182008_10019345 Ga0182008_100193454 294
165 3300025711 Ga0207696_1000001 Ga0207696_1000001138 294
166 3300025728 Ga0207655_1000011 Ga0207655_1000011400 294
167 3300025735 Ga0207713_1000026 Ga0207713_1000026271 294
168 3300025735 Ga0207713_1002505 Ga0207713_100250511 294
169 3300025900 Ga0207710_10000049 Ga0207710_1000004983 294
170 3300025911 Ga0207654_10000006 Ga0207654_10000006532 294
171 3300027111 Ga0209281_1000008 Ga0209281_1000008280 294
172 3300046530 Ga0495654_0001911 Ga0495654_0001911_6846_7766 294
173 3300046794 Ga0495589_0000002 Ga0495589_0000002_496323_497243 294
174 3300048919 Ga0496116_0000023 Ga0496116_0000023_70584_71510 294
175 3300048920 Ga0496117_0012293 Ga0496117_0012293_1376_2302 294
176 3300048921 Ga0496118_0072602 Ga0496118_0072602_1504_2430 294
177 iso_pu_bacteria 2548876994 2550694753 294
178 iso_pu_bacteria 2818991445 2819593856 294
179 iso_pu_bacteria 2834641062 2834643813 295
180 iso_pu_bacteria 2884811622 2884814431 295
181 iso_pu_bacteria 2884836552 2884839684 295
182 iso_pu_bacteria 2884852848 2884856505 295
183 iso_pu_bacteria 2896154374 2896158871 295
184 iso_pu_bacteria 8003400568 8003404770 295
185 3300003187 JGI25151J46595_10009835 JGI25151J46595_100098355 296
186 3300005262 Ga0065165_1016216 Ga0065165_10162163 296
187 3300027395 Ga0209996_1002631 Ga0209996_10026312 296
188 3300027543 Ga0209999_1007928 Ga0209999_10079283 296
189 3300027665 Ga0209983_1000521 Ga0209983_10005216 296
190 3300027682 Ga0209971_1002425 Ga0209971_10024255 296
191 3300046499 Ga0495594_0017989 Ga0495594_0017989_2246_3175 296
192 3300046499 Ga0495594_0101749 Ga0495594_0101749_47_988 296
193 3300046507 Ga0495606_0090360 Ga0495606_0090360_67_996 296
194 3300046557 Ga0495622_0000019 Ga0495622_0000019_99407_100339 296
195 3300046648 Ga0495611_0107841 Ga0495611_0107841_187_1116 296
196 3300046691 Ga0495670_0004748 Ga0495670_0004748_4633_5562 296
197 3300047318 Ga0495636_0000290 Ga0495636_0000290_65_994 296
198 3300047321 Ga0495676_0013607 Ga0495676_0013607_1870_2967 296
199 3300049581 Ga0501047_0159523 Ga0501047_0159523_1185_2114 296
200 3300049744 Ga0501083_0016192 Ga0501083_0016192_2815_3744 296
201 3300054114 Ga0501084_0023948 Ga0501084_0023948_2605_3534 296
202 3300060353 Ga0501082_0038905 Ga0501082_0038905_1157_2086 296
203 3300005331 Ga0070670_100069498 Ga0070670_1000694983 297
204 3300005578 Ga0068854_100209420 Ga0068854_1002094202 297
205 3300005614 Ga0068856_100133263 Ga0068856_1001332633 297
206 3300005616 Ga0068852_100072140 Ga0068852_1000721403 297
207 3300006177 Ga0075362_10077706 Ga0075362_100777061 297
208 3300009093 Ga0105240_10001931 Ga0105240_1000193134 297
209 3300021361 Ga0213872_10033810 Ga0213872_100338101 297
210 3300025233 Ga0209437_100088 Ga0209437_10008831 297
211 3300025913 Ga0207695_10000392 Ga0207695_1000039252 297
212 3300025925 Ga0207650_10230404 Ga0207650_102304042 297
213 3300026078 Ga0207702_10032758 Ga0207702_100327584 297
214 3300031665 Ga0316575_10004223 Ga0316575_100042234 297
215 3300031691 Ga0316579_10003340 Ga0316579_100033401 297
216 3300031728 Ga0316578_10002807 Ga0316578_100028073 297
217 3300031728 Ga0316578_10209919 Ga0316578_102099191 297
218 3300032133 Ga0316583_10015296 Ga0316583_100152962 297
219 3300032137 Ga0316585_10010719 Ga0316585_100107192 297
220 3300032139 Ga0316580_10026761 Ga0316580_100267611 297
221 3300032139 Ga0316580_10047370 Ga0316580_100473702 297
222 3300033524 Ga0316592_1014268 Ga0316592_10142682 297
223 3300033528 Ga0316588_1016728 Ga0316588_10167282 297
224 3300033541 Ga0316596_1019344 Ga0316596_10193442 297
225 3300035398 Ga0316574_0003681 Ga0316574_0003681_1942_2877 297
226 3300036647 Ga0316582_0034892 Ga0316582_0034892_1325_2260 297
227 3300036647 Ga0316582_0244489 Ga0316582_0244489_156_1091 297
228 3300036712 Ga0316584_0094732 Ga0316584_0094732_447_1382 297
229 3300039447 Ga0436361_0181767 Ga0436361_0181767_33_971 297
230 3300039447 Ga0436361_1197998 Ga0436361_1197998_1308_2246 297
231 3300046499 Ga0495594_0006749 Ga0495594_0006749_2087_3031 297
232 3300046536 Ga0495587_0054837 Ga0495587_0054837_331_1275 297
233 3300046691 Ga0495670_0015800 Ga0495670_0015800_43_1005 297
234 3300048919 Ga0496116_0113900 Ga0496116_0113900_237_1145 297
235 3300048921 Ga0496118_0121270 Ga0496118_0121270_726_1634 297
236 3300048924 Ga0496121_0058532 Ga0496121_0058532_72_980 297
237 3300048925 Ga0496122_0005870 Ga0496122_0005870_2680_3588 297
238 3300048926 Ga0496123_0000392 Ga0496123_0000392_56666_57574 297
239 3300048928 Ga0496125_0024230 Ga0496125_0024230_1334_2242 297
240 3300002704 JGI25155J39150_1000840 JGI25155J39150_10008404 298
241 3300002705 JGI25156J39149_1000453 JGI25156J39149_100045326 298
242 3300002738 JGI25154J39366_1000767 JGI25154J39366_10007671 298
243 3300002741 JGI25157J39369_1000350 JGI25157J39369_100035033 298
244 3300002987 JGI25159J45721_1004898 JGI25159J45721_10048985 298
245 3300003758 Ga0055532_1000018 Ga0055532_100001823 298
246 3300003761 Ga0055535_1005367 Ga0055535_10053673 298
247 3300014497 Ga0182008_10021597 Ga0182008_100215973 298
248 3300025206 Ga0209435_100007 Ga0209435_100007216 298
249 3300025229 Ga0209147_100017 Ga0209147_100017256 298
250 3300025242 Ga0209258_100215 Ga0209258_10021588 298
251 3300025246 Ga0209646_1000044 Ga0209646_100004497 298
252 3300025246 Ga0209646_1000287 Ga0209646_100028712 298
253 3300025250 Ga0209026_1000353 Ga0209026_100035333 298
254 3300025256 Ga0209759_1000255 Ga0209759_100025512 298
255 3300025272 Ga0209455_1003563 Ga0209455_10035636 298
256 3300025949 Ga0207667_10174035 Ga0207667_101740353 298
257 3300048928 Ga0496125_0005773 Ga0496125_0005773_9729_10646 298
258 iso_pu_bacteria 2511231026 2511386587 298
259 3300003187 JGI25151J46595_10005186 JGI25151J46595_100051863 300
260 iso_pu_bacteria 2511231003 2511251622 300
261 iso_pu_bacteria 2521172590 2521561147 300
262 iso_pu_bacteria 2551306416 2553005974 300
263 iso_pu_bacteria 2765235838 2765567578 300
264 iso_pu_bacteria 2808606386 2808982979 300
265 iso_pu_bacteria 2808606415 2809130498 300
266 iso_pu_bacteria 2808606419 2809150025 300
267 iso_pu_bacteria 2818991449 2819617527 300
268 iso_pu_bacteria 2839094727 2839099523 300
269 iso_pu_bacteria 2852618963 2852621756 300
270 iso_pu_bacteria 2904439833 2904442219 300
271 iso_pu_bacteria 2904530477 2904533501 300
272 iso_pu_bacteria 2904584206 2904586456 300
273 iso_pu_bacteria 2904589729 2904591731 300
274 iso_pu_bacteria 2904601388 2904602115 300
275 iso_pu_bacteria 2919046199 2919051223 300
276 iso_pu_bacteria 2919079590 2919083545 300
277 iso_pu_bacteria 2923510766 2923514986 300
278 iso_pu_bacteria 2928130867 2928133525 300
279 3300031727 Ga0316576_10116094 Ga0316576_101160942 301
280 3300036712 Ga0316584_0015750 Ga0316584_0015750_2045_2995 301
281 3300053125 Ga0500618_004652 Ga0500618_004652_2011_2943 302
282 3300002704 JGI25155J39150_1000603 JGI25155J39150_10006031 304
283 3300002705 JGI25156J39149_1002052 JGI25156J39149_100205210 304
284 3300002738 JGI25154J39366_1001609 JGI25154J39366_10016091 304
285 3300009093 Ga0105240_10002138 Ga0105240_100021383 304
286 3300025206 Ga0209435_100151 Ga0209435_1001511 304
287 3300025246 Ga0209646_1000282 Ga0209646_100028212 304
288 3300025250 Ga0209026_1005158 Ga0209026_10051584 304
289 3300025256 Ga0209759_1000388 Ga0209759_100038812 304
290 3300025913 Ga0207695_10005275 Ga0207695_1000527517 304
291 3300048924 Ga0496121_0011040 Ga0496121_0011040_1679_2608 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05661

DUF808

Protein of unknown function (DUF808)

43

327

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.3601 55 235
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.3591 56 245
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.343 55 235
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.3215 56 245
4avm-assembly1.cif.gz_A-2 crystal structure of the n-bar domain of human bridging integrator 2. 0.3012 65 249
ID Description Score Start End Superfamily
af_Q8IIV4_2_207_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4714 56 232 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4228 49 245 1.20.1250.20
af_O01928_12_231_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4218 48 236 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.415 49 245 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.41 55 216 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3B9L7X5-F1-model_v4 DUF808 domain-containing protein 0.9393 127 297 GO:0005886
AF-W7W382-F1-model_v4 Inner membrane protein YedI 0.9287 165 303 GO:0005886
AF-A0A847DVF1-F1-model_v4 DUF808 domain-containing protein 0.9128 122 304 GO:0005886
AF-A0A6D0EMU4-F1-model_v4 deleted 0.9039 44 193
AF-A0A2J4YGP3-F1-model_v4 DUF808 domain-containing protein 0.9014 51 298 GO:0005886

Feature Viewer

pLDDT pTM Quality
71.75 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map