F389980

General Info

Members Datasets Scaffolds Average Seq Length
290 224 580 147

Family's Representative Sequence

Representative Sequence 3300047315|Ga0495581_0049067|Ga0495581_0049067_439_954
Length 171
Sequence MIRVRAGVESCRDRINTSDDGTEVMPLEGEYEPSPTQWVRDQVELYEGSGGTKGTTLLDTGLPVIILTTLGAKSGKIRKTPLMRVEHEGRYAVVASQGGAPKHPVWYFNVQSDPHVELQDGAERQDMTAREVTGEEKAQWWERAVAAYPPYADYQKKTDREIPVFVLEPTG

Samples

Sample ID Description Type Environment
1 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
222 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
223 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
224 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 3.1
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 5.52
Rhizosphere 79.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495581_0049067 3300047315 Bacteria 2437
2 rootH1_10008929 3300003316 Bacteria 7578
3 rootH2_10030276 3300003320 Bacteria 5175
4 rootH1_10112942 3300003323 Bacteria 4014
5 Ga0070683_100670256 3300005329 Bacteria 993
6 Ga0068869_100627990 3300005334 Bacteria 910
7 Ga0070680_100041892 3300005336 Bacteria 3713
8 Ga0068868_100320468 3300005338 Bacteria 1320
9 Ga0070674_101358682 3300005356 Bacteria 635
10 Ga0070673_102007451 3300005364 Bacteria 549
11 Ga0070659_101042696 3300005366 Bacteria 719
12 Ga0070709_10167895 3300005434 Bacteria 1531
13 Ga0070714_100033632 3300005435 Bacteria 4288
14 Ga0070678_100714668 3300005456 Bacteria 904
15 Ga0070679_100463933 3300005530 Bacteria 1211
16 Ga0068853_100022742 3300005539 Bacteria 5240
17 Ga0070665_101145431 3300005548 Bacteria 789
18 Ga0070704_101425368 3300005549 Bacteria 636
19 Ga0068857_100458513 3300005577 Bacteria 1192
20 Ga0068854_100465840 3300005578 Bacteria 1058
21 Ga0070702_100208038 3300005615 Bacteria 1300
22 Ga0068852_100542016 3300005616 Bacteria 1163
23 Ga0068863_100032325 3300005841 Bacteria 4988
24 Ga0068860_100011962 3300005843 Bacteria 8553
25 Ga0075365_10001889 3300006038 Bacteria 9862
26 Ga0075365_10521253 3300006038 Bacteria 840
27 Ga0075368_10018826 3300006042 Bacteria 2600
28 Ga0075363_100194240 3300006048 Bacteria 1158
29 Ga0075364_10002270 3300006051 Bacteria 10785
30 Ga0075364_10288491 3300006051 Bacteria 1117
31 Ga0075362_10004814 3300006177 Bacteria 4875
32 Ga0075362_10264562 3300006177 Bacteria 848
33 Ga0075369_10203989 3300006186 Bacteria 913
34 Ga0075428_100923566 3300006844 Bacteria 925
35 Ga0075430_100158681 3300006846 Bacteria 1883
36 Ga0105251_10006186 3300009011 Bacteria 7688
37 Ga0105240_12006274 3300009093 Bacteria 601
38 Ga0111539_10968889 3300009094 Bacteria 989
39 Ga0105245_10035045 3300009098 Bacteria 4452
40 Ga0105245_10390209 3300009098 Bacteria 1389
41 Ga0105245_10412670 3300009098 Bacteria 1352
42 Ga0105243_10508339 3300009148 Bacteria 1143
43 Ga0105243_11239323 3300009148 Bacteria 761
44 Ga0105242_10069968 3300009176 Bacteria 2908
45 Ga0105238_10731248 3300009551 Bacteria 1003
46 Ga0105238_11127994 3300009551 Bacteria 807
47 Ga0105246_10579300 3300011119 Bacteria 966
48 Ga0157371_10413807 3300013102 Bacteria 988
49 Ga0157370_10778117 3300013104 Bacteria 871
50 Ga0157369_10083391 3300013105 Bacteria 3419
51 Ga0157369_10421798 3300013105 Bacteria 1383
52 Ga0163162_11582333 3300013306 Bacteria 747
53 Ga0157372_11643742 3300013307 Bacteria 739
54 Ga0157375_10449274 3300013308 Bacteria 1454
55 Ga0157375_11211556 3300013308 Bacteria 886
56 Ga0163163_10015167 3300014325 Bacteria 7115
57 Ga0163163_11471575 3300014325 Bacteria 743
58 Ga0157380_13173166 3300014326 Bacteria 525
59 Ga0157377_10834634 3300014745 Bacteria 683
60 Ga0197907_10526131 3300020069 Bacteria 1042
61 Ga0206351_10045337 3300020077 Bacteria 1195
62 Ga0206350_10227038 3300020080 Bacteria 1070
63 Ga0206350_10721755 3300020080 Bacteria 796
64 Ga0206354_11601127 3300020081 Bacteria 1304
65 Ga0206353_10855082 3300020082 Bacteria 4235
66 Ga0213876_10134608 3300021384 Bacteria 1314
67 Ga0224712_10019881 3300022467 Bacteria 2272
68 Ga0224712_10113213 3300022467 Bacteria 1166
69 Ga0224712_10398117 3300022467 Bacteria 656
70 Ga0207656_10111908 3300025321 Bacteria 1262
71 Ga0207642_10594041 3300025899 Bacteria 688
72 Ga0207688_10259073 3300025901 Bacteria 1055
73 Ga0207647_10067891 3300025904 Bacteria 2159
74 Ga0207699_10362008 3300025906 Bacteria 1026
75 Ga0207707_10553417 3300025912 Bacteria 977
76 Ga0207660_10280558 3300025917 Bacteria 1322
77 Ga0207662_10115412 3300025918 Bacteria 1678
78 Ga0207652_10097135 3300025921 Bacteria 2596
79 Ga0207652_10217120 3300025921 Bacteria 1723
80 Ga0207652_10365629 3300025921 Bacteria 1302
81 Ga0207687_10958411 3300025927 Bacteria 733
82 Ga0207687_11091936 3300025927 Bacteria 685
83 Ga0207664_11022888 3300025929 Bacteria 740
84 Ga0207690_10713255 3300025932 Bacteria 825
85 Ga0207686_10289698 3300025934 Bacteria 1212
86 Ga0207709_10158603 3300025935 Bacteria 1575
87 Ga0207669_10437231 3300025937 Bacteria 1034
88 Ga0207669_10523930 3300025937 Bacteria 952
89 Ga0207691_10573230 3300025940 Bacteria 956
90 Ga0207689_10813030 3300025942 Bacteria 789
91 Ga0207661_11222443 3300025944 Bacteria 691
92 Ga0207640_10346588 3300025981 Bacteria 1192
93 Ga0207708_11305545 3300026075 Bacteria 636
94 Ga0207641_10068961 3300026088 Bacteria 3034
95 Ga0207641_10440449 3300026088 Bacteria 1258
96 Ga0207648_11054124 3300026089 Bacteria 762
97 Ga0207674_10279853 3300026116 Bacteria 1616
98 Ga0207683_10135847 3300026121 Bacteria 2214
99 Ga0268264_10008444 3300028381 Bacteria 8565
100 Ga0307515_10534188 3300028794 Bacteria 782
101 Ga0307512_10043256 3300030522 Bacteria 3717
102 Ga0265327_10008842 3300031251 Bacteria 7408
103 Ga0307513_10000844 3300031456 Bacteria 44769
104 Ga0307513_10372255 3300031456 Bacteria 1170
105 Ga0307509_10009368 3300031507 Bacteria 12267
106 Ga0307509_10026738 3300031507 Bacteria 6430
107 Ga0307514_10118808 3300031649 Bacteria 1850
108 Ga0307516_10056166 3300031730 Bacteria 3840
109 Ga0307518_10030517 3300031838 Bacteria 3904
110 Ga0307416_101306542 3300032002 Bacteria 831
111 Ga0307510_10026252 3300033180 Bacteria 6699
112 Ga0373961_0085144 3300035241 Bacteria 1001
113 Ga0395900_1547398 3300037418 Bacteria 575
114 Ga0395898_0209963 3300037466 Bacteria 1857
115 Ga0436365_0213660 3300039437 Bacteria 8610
116 Ga0436365_0762633 3300039437 Bacteria 1275
117 Ga0436365_1710752 3300039437 Bacteria 5056
118 Ga0436363_0915880 3300039450 Bacteria 586
119 Ga0436362_0429308 3300039453 Bacteria 985
120 Ga0439436_0042671 3300041404 Bacteria 1296
121 Ga0451789_0459602 3300041443 Bacteria 784
122 Ga0451800_0616245 3300041459 Bacteria 727
123 Ga0451837_1306142 3300041494 Bacteria 4293
124 Ga0451839_1558567 3300041496 Bacteria 932
125 Ga0451845_0218004 3300041501 Bacteria 743
126 Ga0451853_1091282 3300041512 Bacteria 2091
127 Ga0439432_115226 3300042006 Bacteria 798
128 Ga0439457_004057 3300042014 Bacteria 3880
129 Ga0466969_0014621 3300044656 Bacteria 4127
130 Ga0466972_0002943 3300044658 Bacteria 8442
131 Ga0466972_0019956 3300044658 Bacteria 3349
132 Ga0466965_0034045 3300044683 Bacteria 2491
133 Ga0466965_0133319 3300044683 Bacteria 1289
134 Ga0466966_0004457 3300044684 Bacteria 9233
135 Ga0466966_0518676 3300044684 Bacteria 717
136 Ga0466961_0047508 3300044693 Bacteria 2745
137 Ga0466961_0140169 3300044693 Bacteria 1514
138 Ga0466961_0623796 3300044693 Bacteria 648
139 Ga0466964_0092699 3300044706 Bacteria 1318
140 Ga0466964_0347451 3300044706 Bacteria 761
141 Ga0466964_0582514 3300044706 Bacteria 611
142 Ga0466971_0715088 3300044719 Bacteria 504
143 Ga0466968_0085862 3300044735 Bacteria 1389
144 Ga0466970_0141631 3300044765 Bacteria 1325
145 Ga0466970_0174493 3300044765 Bacteria 1192
146 Ga0466970_0344707 3300044765 Bacteria 845
147 Ga0466957_0064033 3300044842 Bacteria 2261
148 Ga0466960_0030593 3300044901 Bacteria 2478
149 Ga0466959_0196311 3300045049 Bacteria 1406
150 Ga0466959_0457081 3300045049 Bacteria 865
151 Ga0466959_0554889 3300045049 Bacteria 775
152 Ga0466967_0097716 3300045976 Bacteria 2680
153 Ga0466967_0179390 3300045976 Bacteria 1997
154 Ga0495603_0006499 3300046455 Bacteria 7005
155 Ga0495603_0043282 3300046455 Bacteria 2689
156 Ga0495603_0619056 3300046455 Bacteria 620
157 Ga0495590_0174707 3300046457 Bacteria 784
158 Ga0495629_0015840 3300046459 Bacteria 5416
159 Ga0495629_0024927 3300046459 Bacteria 4255
160 Ga0495651_0083704 3300046462 Bacteria 2405
161 Ga0495653_0023967 3300046463 Bacteria 4924
162 Ga0495580_0157644 3300046472 Bacteria 1572
163 Ga0495605_0021180 3300046474 Bacteria 3446
164 Ga0495639_0003174 3300046475 Bacteria 7142
165 Ga0495585_0092681 3300046492 Bacteria 1625
166 Ga0495594_0063865 3300046499 Bacteria 2040
167 Ga0495583_0054477 3300046506 Bacteria 1810
168 Ga0495606_0066616 3300046507 Bacteria 2283
169 Ga0495608_0178946 3300046511 Bacteria 1342
170 Ga0495610_0142471 3300046512 Bacteria 1030
171 Ga0495616_0098590 3300046513 Bacteria 1373
172 Ga0495618_0082960 3300046514 Bacteria 2047
173 Ga0495618_0343546 3300046514 Bacteria 921
174 Ga0495620_0003368 3300046515 Bacteria 9158
175 Ga0495628_0023495 3300046516 Bacteria 5059
176 Ga0495630_0069837 3300046517 Bacteria 2643
177 Ga0495630_0261259 3300046517 Bacteria 1323
178 Ga0495631_0017202 3300046518 Bacteria 3426
179 Ga0495632_0225279 3300046519 Bacteria 847
180 Ga0495637_0065119 3300046520 Bacteria 1485
181 Ga0495643_0002749 3300046522 Bacteria 13509
182 Ga0495666_0022402 3300046526 Bacteria 3128
183 Ga0495652_0079577 3300046529 Bacteria 2709
184 Ga0495640_0020118 3300046533 Bacteria 4917
185 Ga0495640_0236135 3300046533 Bacteria 1148
186 Ga0495609_0009556 3300046538 Bacteria 4689
187 Ga0495597_0247415 3300046542 Bacteria 701
188 Ga0495622_0265653 3300046557 Bacteria 752
189 Ga0495667_0044519 3300046559 Bacteria 2940
190 Ga0495668_0208652 3300046616 Bacteria 1069
191 Ga0495634_0897657 3300046642 Bacteria 502
192 Ga0495611_0034353 3300046648 Bacteria 2241
193 Ga0495625_0100769 3300046660 Bacteria 1984
194 Ga0495635_0139732 3300046663 Bacteria 1650
195 Ga0495635_0465853 3300046663 Bacteria 834
196 Ga0495635_0707597 3300046663 Bacteria 653
197 Ga0495661_0121896 3300046665 Bacteria 1439
198 Ga0495588_0068111 3300046674 Bacteria 1848
199 Ga0495657_0016468 3300046675 Bacteria 5386
200 Ga0495657_0089444 3300046675 Bacteria 1978
201 Ga0495623_0044733 3300046679 Bacteria 2813
202 Ga0495646_0089037 3300046680 Bacteria 1787
203 Ga0495613_0081562 3300046689 Bacteria 2349
204 Ga0495613_0104897 3300046689 Bacteria 2040
205 Ga0495671_0083241 3300046692 Bacteria 1568
206 Ga0495589_0034855 3300046794 Bacteria 2524
207 Ga0495600_0743699 3300046809 Bacteria 587
208 Ga0495604_0104802 3300047317 Bacteria 2071
209 Ga0495636_0017844 3300047318 Bacteria 2843
210 Ga0495636_0063679 3300047318 Bacteria 1563
211 Ga0495674_0048413 3300047319 Bacteria 3762
212 Ga0495676_0014714 3300047321 Bacteria 6990
213 Ga0495676_0338051 3300047321 Bacteria 1008
214 Ga0495680_0018204 3300047322 Bacteria 5972
215 Ga0495683_0126900 3300047323 Bacteria 1206
216 Ga0495687_002211 3300047443 Bacteria 16074
217 Ga0495687_028459 3300047443 Bacteria 2599
218 Ga0495687_220434 3300047443 Bacteria 587
219 Ga0495675_0347306 3300047444 Bacteria 873
220 Ga0495681_0180795 3300047470 Bacteria 867
221 Ga0495684_0035826 3300047471 Bacteria 3805
222 Ga0495593_0023539 3300047673 Bacteria 3423
223 Ga0495602_0587062 3300048088 Bacteria 768
224 Ga0495602_1064216 3300048088 Bacteria 531
225 Ga0495626_0096377 3300048091 Bacteria 1295
226 Ga0496102_0133294 3300048905 Bacteria 2327
227 Ga0496107_1290384 3300048910 Bacteria 523
228 Ga0496108_0509319 3300048911 Bacteria 1051
229 Ga0496108_0709732 3300048911 Bacteria 872
230 Ga0496109_0156568 3300048912 Bacteria 2134
231 Ga0496109_0477815 3300048912 Bacteria 1177
232 Ga0496109_0550500 3300048912 Bacteria 1088
233 Ga0496109_1564370 3300048912 Bacteria 594
234 Ga0496110_0067942 3300048913 Bacteria 3154
235 Ga0496110_0235368 3300048913 Bacteria 1666
236 Ga0496110_1696504 3300048913 Bacteria 542
237 Ga0496111_0088059 3300048914 Bacteria 2273
238 Ga0496111_0900479 3300048914 Bacteria 637
239 Ga0496114_0011480 3300048917 Bacteria 7079
240 Ga0495678_025250 3300049459 Bacteria 2555
241 Ga0495682_0083294 3300049460 Bacteria 1150
242 Ga0501031_0004869 3300049568 Bacteria 8730
243 Ga0501032_0001918 3300049569 Bacteria 16383
244 Ga0501033_0007789 3300049570 Bacteria 8297
245 Ga0501033_0010021 3300049570 Bacteria 7278
246 Ga0501034_0003454 3300049571 Bacteria 18005
247 Ga0501034_0512930 3300049571 Bacteria 1111
248 Ga0501036_0001601 3300049572 Bacteria 17477
249 Ga0501037_0003430 3300049573 Bacteria 11520
250 Ga0501038_0003366 3300049574 Bacteria 14911
251 Ga0501039_0000552 3300049575 Bacteria 27121
252 Ga0501043_0004743 3300049579 Bacteria 11026
253 Ga0501046_0006337 3300049580 Bacteria 10486
254 Ga0501047_0011506 3300049581 Bacteria 8374
255 Ga0501048_0022727 3300049582 Bacteria 4584
256 Ga0501068_0009821 3300049584 Bacteria 5361
257 Ga0501068_1125032 3300049584 Bacteria 520
258 Ga0501070_0016656 3300049586 Bacteria 6173
259 Ga0501073_0052898 3300049589 Bacteria 2843
260 Ga0501074_0041212 3300049590 Bacteria 3343
261 Ga0501079_0003180 3300049741 Bacteria 12027
262 Ga0501080_0003277 3300049742 Bacteria 14297
263 Ga0501035_0007724 3300049822 Bacteria 10044
264 Ga0501035_0199241 3300049822 Bacteria 1718
265 Ga0501044_0003594 3300049823 Bacteria 17447
266 Ga0501045_0008861 3300049824 Bacteria 7024
267 nmdc:mga03683_3719_c2 3300050489 Bacteria 1550
268 nmdc:mga03683_50540_c1 3300050489 Bacteria 1733
269 nmdc:mga03n38_43379_c1 3300050490 Bacteria 1971
270 nmdc:mga00v17_11044_c1 3300050491 Bacteria 4952
271 nmdc:mga00v17_12196_c1 3300050491 Bacteria 4739
272 nmdc:mga00v17_289712_c1 3300050491 Bacteria 1063
273 nmdc:mga0yw44_1163_c1 3300050492 Bacteria 10222
274 nmdc:mga0yw44_806789_c1 3300050492 Bacteria 637
275 nmdc:mga0yw44_8751_c1 3300050492 Bacteria 5064
276 nmdc:mga0k408_699048_c1 3300050493 Bacteria 594
277 nmdc:mga06z11_56796_c1 3300050494 Bacteria 2026
278 nmdc:mga0qj67_1135206_c1 3300050509 Bacteria 610
279 nmdc:mga08y16_557161_c1 3300050511 Bacteria 1159
280 nmdc:mga0rr50_1627729_c1 3300050513 Bacteria 545
281 nmdc:mga0sz30_573091_c1 3300050516 Bacteria 510
282 Ga0495619_0035592 3300053085 Bacteria 3239
283 Ga0500600_0276330 3300053149 Bacteria 735
284 Ga0501082_0114998 3300060353 Bacteria 2330
285 Ga0501082_0143004 3300060353 Bacteria 2076
286 Ga0466962_0086173 3300061719 Bacteria 1504
287 2616696351 2616644814 Bacteria 11555299
288 2852639100 2852635781 Bacteria 8251373
289 2862179701 2862178590 Bacteria 8583590
290 8054162654 8054160619 Bacteria 7783213
291 Ga0495581_0049067
292 rootH1_10008929
293 rootH2_10030276
294 rootH1_10112942
295 Ga0070683_100670256
296 Ga0068869_100627990
297 Ga0070680_100041892
298 Ga0068868_100320468
299 Ga0070674_101358682
300 Ga0070673_102007451
301 Ga0070659_101042696
302 Ga0070709_10167895
303 Ga0070714_100033632
304 Ga0070678_100714668
305 Ga0070679_100463933
306 Ga0068853_100022742
307 Ga0070665_101145431
308 Ga0070704_101425368
309 Ga0068857_100458513
310 Ga0068854_100465840
311 Ga0070702_100208038
312 Ga0068852_100542016
313 Ga0068863_100032325
314 Ga0068860_100011962
315 Ga0075365_10001889
316 Ga0075365_10521253
317 Ga0075368_10018826
318 Ga0075363_100194240
319 Ga0075364_10002270
320 Ga0075364_10288491
321 Ga0075362_10004814
322 Ga0075362_10264562
323 Ga0075369_10203989
324 Ga0075428_100923566
325 Ga0075430_100158681
326 Ga0105251_10006186
327 Ga0105240_12006274
328 Ga0111539_10968889
329 Ga0105245_10035045
330 Ga0105245_10390209
331 Ga0105245_10412670
332 Ga0105243_10508339
333 Ga0105243_11239323
334 Ga0105242_10069968
335 Ga0105238_10731248
336 Ga0105238_11127994
337 Ga0105246_10579300
338 Ga0157371_10413807
339 Ga0157370_10778117
340 Ga0157369_10083391
341 Ga0157369_10421798
342 Ga0163162_11582333
343 Ga0157372_11643742
344 Ga0157375_10449274
345 Ga0157375_11211556
346 Ga0163163_10015167
347 Ga0163163_11471575
348 Ga0157380_13173166
349 Ga0157377_10834634
350 Ga0197907_10526131
351 Ga0206351_10045337
352 Ga0206350_10227038
353 Ga0206350_10721755
354 Ga0206354_11601127
355 Ga0206353_10855082
356 Ga0213876_10134608
357 Ga0224712_10019881
358 Ga0224712_10113213
359 Ga0224712_10398117
360 Ga0207656_10111908
361 Ga0207642_10594041
362 Ga0207688_10259073
363 Ga0207647_10067891
364 Ga0207699_10362008
365 Ga0207707_10553417
366 Ga0207660_10280558
367 Ga0207662_10115412
368 Ga0207652_10097135
369 Ga0207652_10217120
370 Ga0207652_10365629
371 Ga0207687_10958411
372 Ga0207687_11091936
373 Ga0207664_11022888
374 Ga0207690_10713255
375 Ga0207686_10289698
376 Ga0207709_10158603
377 Ga0207669_10437231
378 Ga0207669_10523930
379 Ga0207691_10573230
380 Ga0207689_10813030
381 Ga0207661_11222443
382 Ga0207640_10346588
383 Ga0207708_11305545
384 Ga0207641_10068961
385 Ga0207641_10440449
386 Ga0207648_11054124
387 Ga0207674_10279853
388 Ga0207683_10135847
389 Ga0268264_10008444
390 Ga0307515_10534188
391 Ga0307512_10043256
392 Ga0265327_10008842
393 Ga0307513_10000844
394 Ga0307513_10372255
395 Ga0307509_10009368
396 Ga0307509_10026738
397 Ga0307514_10118808
398 Ga0307516_10056166
399 Ga0307518_10030517
400 Ga0307416_101306542
401 Ga0307510_10026252
402 Ga0373961_0085144
403 Ga0395900_1547398
404 Ga0395898_0209963
405 Ga0436365_0213660
406 Ga0436365_0762633
407 Ga0436365_1710752
408 Ga0436363_0915880
409 Ga0436362_0429308
410 Ga0439436_0042671
411 Ga0451789_0459602
412 Ga0451800_0616245
413 Ga0451837_1306142
414 Ga0451839_1558567
415 Ga0451845_0218004
416 Ga0451853_1091282
417 Ga0439432_115226
418 Ga0439457_004057
419 Ga0466969_0014621
420 Ga0466972_0002943
421 Ga0466972_0019956
422 Ga0466965_0034045
423 Ga0466965_0133319
424 Ga0466966_0004457
425 Ga0466966_0518676
426 Ga0466961_0047508
427 Ga0466961_0140169
428 Ga0466961_0623796
429 Ga0466964_0092699
430 Ga0466964_0347451
431 Ga0466964_0582514
432 Ga0466971_0715088
433 Ga0466968_0085862
434 Ga0466970_0141631
435 Ga0466970_0174493
436 Ga0466970_0344707
437 Ga0466957_0064033
438 Ga0466960_0030593
439 Ga0466959_0196311
440 Ga0466959_0457081
441 Ga0466959_0554889
442 Ga0466967_0097716
443 Ga0466967_0179390
444 Ga0495603_0006499
445 Ga0495603_0043282
446 Ga0495603_0619056
447 Ga0495590_0174707
448 Ga0495629_0015840
449 Ga0495629_0024927
450 Ga0495651_0083704
451 Ga0495653_0023967
452 Ga0495580_0157644
453 Ga0495605_0021180
454 Ga0495639_0003174
455 Ga0495585_0092681
456 Ga0495594_0063865
457 Ga0495583_0054477
458 Ga0495606_0066616
459 Ga0495608_0178946
460 Ga0495610_0142471
461 Ga0495616_0098590
462 Ga0495618_0082960
463 Ga0495618_0343546
464 Ga0495620_0003368
465 Ga0495628_0023495
466 Ga0495630_0069837
467 Ga0495630_0261259
468 Ga0495631_0017202
469 Ga0495632_0225279
470 Ga0495637_0065119
471 Ga0495643_0002749
472 Ga0495666_0022402
473 Ga0495652_0079577
474 Ga0495640_0020118
475 Ga0495640_0236135
476 Ga0495609_0009556
477 Ga0495597_0247415
478 Ga0495622_0265653
479 Ga0495667_0044519
480 Ga0495668_0208652
481 Ga0495634_0897657
482 Ga0495611_0034353
483 Ga0495625_0100769
484 Ga0495635_0139732
485 Ga0495635_0465853
486 Ga0495635_0707597
487 Ga0495661_0121896
488 Ga0495588_0068111
489 Ga0495657_0016468
490 Ga0495657_0089444
491 Ga0495623_0044733
492 Ga0495646_0089037
493 Ga0495613_0081562
494 Ga0495613_0104897
495 Ga0495671_0083241
496 Ga0495589_0034855
497 Ga0495600_0743699
498 Ga0495604_0104802
499 Ga0495636_0017844
500 Ga0495636_0063679
501 Ga0495674_0048413
502 Ga0495676_0014714
503 Ga0495676_0338051
504 Ga0495680_0018204
505 Ga0495683_0126900
506 Ga0495687_002211
507 Ga0495687_028459
508 Ga0495687_220434
509 Ga0495675_0347306
510 Ga0495681_0180795
511 Ga0495684_0035826
512 Ga0495593_0023539
513 Ga0495602_0587062
514 Ga0495602_1064216
515 Ga0495626_0096377
516 Ga0496102_0133294
517 Ga0496107_1290384
518 Ga0496108_0509319
519 Ga0496108_0709732
520 Ga0496109_0156568
521 Ga0496109_0477815
522 Ga0496109_0550500
523 Ga0496109_1564370
524 Ga0496110_0067942
525 Ga0496110_0235368
526 Ga0496110_1696504
527 Ga0496111_0088059
528 Ga0496111_0900479
529 Ga0496114_0011480
530 Ga0495678_025250
531 Ga0495682_0083294
532 Ga0501031_0004869
533 Ga0501032_0001918
534 Ga0501033_0007789
535 Ga0501033_0010021
536 Ga0501034_0003454
537 Ga0501034_0512930
538 Ga0501036_0001601
539 Ga0501037_0003430
540 Ga0501038_0003366
541 Ga0501039_0000552
542 Ga0501043_0004743
543 Ga0501046_0006337
544 Ga0501047_0011506
545 Ga0501048_0022727
546 Ga0501068_0009821
547 Ga0501068_1125032
548 Ga0501070_0016656
549 Ga0501073_0052898
550 Ga0501074_0041212
551 Ga0501079_0003180
552 Ga0501080_0003277
553 Ga0501035_0007724
554 Ga0501035_0199241
555 Ga0501044_0003594
556 Ga0501045_0008861
557 nmdc:mga03683_3719_c2
558 nmdc:mga03683_50540_c1
559 nmdc:mga03n38_43379_c1
560 nmdc:mga00v17_11044_c1
561 nmdc:mga00v17_12196_c1
562 nmdc:mga00v17_289712_c1
563 nmdc:mga0yw44_1163_c1
564 nmdc:mga0yw44_806789_c1
565 nmdc:mga0yw44_8751_c1
566 nmdc:mga0k408_699048_c1
567 nmdc:mga06z11_56796_c1
568 nmdc:mga0qj67_1135206_c1
569 nmdc:mga08y16_557161_c1
570 nmdc:mga0rr50_1627729_c1
571 nmdc:mga0sz30_573091_c1
572 Ga0495619_0035592
573 Ga0500600_0276330
574 Ga0501082_0114998
575 Ga0501082_0143004
576 Ga0466962_0086173
577 2616696351
578 2852639100
579 2862179701
580 8054162654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

38

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9816 4 146
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.9748 4 146
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9743 38 145
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.957 38 145
4y9i-assembly1.cif.gz_A structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 0.9555 39 144
ID Description Score Start End Superfamily
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9813 5 146 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.961 5 146 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9608 14 145 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9556 39 144 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9378 33 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7I7LMA0-F1-model_v4 deleted 1.002 36 147
AF-A0A024JYH7-F1-model_v4 Deazaflavin-dependent nitroreductase family protein 1.002 38 147 GO:0005886
GO:0016491
GO:0070967
AF-A0A6H3J4R1-F1-model_v4 deleted 1.001 1 147
AF-A0A4R8VWK5-F1-model_v4 deleted 1.001 1 147
AF-A0A853EXD3-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 1 1 147 GO:0005886
GO:0016491
GO:0070967

Map