F389945

General Info

Members Datasets Scaffolds Average Seq Length
290 174 580 140

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0218221|Ga0495664_0218221_420_914
Length 164
Sequence MRMAIAACLFDLAGLNYGKEDTTMAVMFTGPFASLFNLQQTLDASRASSWLESGPSGSGSYPPVNVFRKGDDLVVLIELAGIKKSDLEIQVKDNTLRIAGRKAVDYSEKASLHRRERLSGEFDRAVTFPIQIDADRVKAEYRNGMLALSLPRAERDKPKSITIS

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 6.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.45
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 44.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0218221 3300046477 Bacteria 1155
2 Ga0070683_100706239 3300005329 Unclassified 966
3 Ga0070670_100541662 3300005331 Unclassified 1038
4 Ga0068869_100596027 3300005334 Unclassified 933
5 Ga0070666_10088436 3300005335 Unclassified 2125
6 Ga0070682_100149139 3300005337 Bacteria 1603
7 Ga0070682_100605746 3300005337 Unclassified 866
8 Ga0068868_100841006 3300005338 Unclassified 831
9 Ga0070660_100908972 3300005339 Unclassified 742
10 Ga0070691_10434407 3300005341 Bacteria 747
11 Ga0070692_10397834 3300005345 Unclassified 869
12 Ga0070668_100005359 3300005347 Bacteria 9522
13 Ga0070668_100072920 3300005347 Bacteria 2676
14 Ga0070668_100482912 3300005347 Unclassified 1070
15 Ga0070668_100842254 3300005347 Unclassified 817
16 Ga0070668_100874860 3300005347 Bacteria 802
17 Ga0070669_100051675 3300005353 Unclassified 3005
18 Ga0070671_100305895 3300005355 Unclassified 1354
19 Ga0070671_100348388 3300005355 Unclassified 1264
20 Ga0070674_100708620 3300005356 Unclassified 861
21 Ga0070688_101244472 3300005365 Unclassified 599
22 Ga0070667_100013860 3300005367 Bacteria 6664
23 Ga0070667_100016456 3300005367 Bacteria 6120
24 Ga0070667_100337017 3300005367 Bacteria 1363
25 Ga0070667_100359072 3300005367 Bacteria 1320
26 Ga0070709_10314342 3300005434 Unclassified 1148
27 Ga0070714_100069400 3300005435 Unclassified 3043
28 Ga0070714_100636807 3300005435 Bacteria 1026
29 Ga0070714_100992683 3300005435 Unclassified 817
30 Ga0070714_101084050 3300005435 Unclassified 780
31 Ga0070713_100843831 3300005436 Unclassified 879
32 Ga0070713_101673881 3300005436 Unclassified 618
33 Ga0070710_10137860 3300005437 Bacteria 1493
34 Ga0070710_10922042 3300005437 Unclassified 632
35 Ga0070711_100156472 3300005439 Bacteria 1724
36 Ga0070711_101191766 3300005439 Unclassified 658
37 Ga0070694_100646863 3300005444 Bacteria 855
38 Ga0070663_101769636 3300005455 Unclassified 553
39 Ga0070681_10313324 3300005458 Unclassified 1478
40 Ga0068867_100476644 3300005459 Bacteria 1068
41 Ga0070698_100473499 3300005471 Bacteria 1189
42 Ga0070699_100382266 3300005518 Bacteria 1271
43 Ga0070699_102081401 3300005518 Unclassified 518
44 Ga0070697_100401685 3300005536 Unclassified 1189
45 Ga0070664_101807536 3300005564 Unclassified 580
46 Ga0068856_100430978 3300005614 Bacteria 1339
47 Ga0068856_100670289 3300005614 Unclassified 1058
48 Ga0070702_100391917 3300005615 Bacteria 991
49 Ga0068852_100778917 3300005616 Bacteria 970
50 Ga0068859_100506280 3300005617 Unclassified 1303
51 Ga0068859_101465753 3300005617 Bacteria 753
52 Ga0068866_10660658 3300005718 Unclassified 713
53 Ga0068861_100047599 3300005719 Bacteria 3238
54 Ga0068861_100332396 3300005719 Unclassified 1327
55 Ga0068861_100861201 3300005719 Bacteria 855
56 Ga0068863_100642544 3300005841 Unclassified 1052
57 Ga0068858_101088982 3300005842 Unclassified 784
58 Ga0068860_100188371 3300005843 Bacteria 1996
59 Ga0068860_100392605 3300005843 Unclassified 1371
60 Ga0068860_100902316 3300005843 Unclassified 900
61 Ga0068862_100011389 3300005844 Bacteria 7340
62 Ga0068862_100050673 3300005844 Unclassified 3549
63 Ga0070717_10130612 3300006028 Bacteria 2160
64 Ga0070717_10915307 3300006028 Unclassified 798
65 Ga0070716_100110117 3300006173 Bacteria 1705
66 Ga0070716_100223519 3300006173 Bacteria 1266
67 Ga0070716_100729336 3300006173 Bacteria 760
68 Ga0070712_100500365 3300006175 Unclassified 1018
69 Ga0070712_100821325 3300006175 Bacteria 798
70 Ga0070712_101311779 3300006175 Bacteria 631
71 Ga0075436_100287091 3300006914 Unclassified 1177
72 Ga0097620_100506231 3300006931 Unclassified 1303
73 Ga0097620_101465370 3300006931 Bacteria 753
74 Ga0105240_10001980 3300009093 Bacteria 33836
75 Ga0105240_11480458 3300009093 Unclassified 712
76 Ga0105247_10990570 3300009101 Unclassified 656
77 Ga0105243_11985787 3300009148 Unclassified 616
78 Ga0105241_10227797 3300009174 Bacteria 1570
79 Ga0105241_10265238 3300009174 Bacteria 1461
80 Ga0105242_10888746 3300009176 Bacteria 890
81 Ga0105237_11111173 3300009545 Unclassified 797
82 Ga0105238_10351306 3300009551 Unclassified 1463
83 Ga0105239_10329114 3300010375 Bacteria 1723
84 Ga0105239_10873192 3300010375 Unclassified 1032
85 Ga0105246_10141243 3300011119 Unclassified 1811
86 Ga0105246_10164110 3300011119 Bacteria 1695
87 Ga0157371_10139729 3300013102 Bacteria 1725
88 Ga0157369_10384475 3300013105 Unclassified 1456
89 Ga0157369_12626685 3300013105 Unclassified 508
90 Ga0157374_10259015 3300013296 Bacteria 1713
91 Ga0163162_10283246 3300013306 Unclassified 1789
92 Ga0163162_10302692 3300013306 Bacteria 1731
93 Ga0157372_10831438 3300013307 Bacteria 1072
94 Ga0157375_10406503 3300013308 Bacteria 1528
95 Ga0157375_11137882 3300013308 Bacteria 914
96 Ga0163163_10451855 3300014325 Unclassified 1345
97 Ga0163163_10485263 3300014325 Bacteria 1297
98 Ga0163163_12895111 3300014325 Unclassified 535
99 Ga0157379_10259585 3300014968 Bacteria 1578
100 Ga0157379_11477444 3300014968 Unclassified 661
101 Ga0157379_12600560 3300014968 Bacteria 507
102 Ga0157376_11415931 3300014969 Unclassified 727
103 Ga0163161_10244916 3300017792 Unclassified 1395
104 Ga0163161_11632117 3300017792 Unclassified 569
105 Ga0197907_11413567 3300020069 Bacteria 1302
106 Ga0206351_10127016 3300020077 Bacteria 1492
107 Ga0206351_10633339 3300020077 Bacteria 865
108 Ga0206351_10855276 3300020077 Bacteria 801
109 Ga0206350_10373466 3300020080 Unclassified 736
110 Ga0206350_10573599 3300020080 Bacteria 1336
111 Ga0206350_11523439 3300020080 Bacteria 856
112 Ga0213872_10063050 3300021361 Bacteria 1675
113 Ga0213875_10018150 3300021388 Bacteria 3394
114 Ga0213875_10131910 3300021388 Unclassified 1168
115 Ga0224712_10044571 3300022467 Bacteria 1692
116 Ga0224712_10047118 3300022467 Unclassified 1657
117 Ga0224712_10064168 3300022467 Bacteria 1472
118 Ga0224712_10093656 3300022467 Bacteria 1263
119 Ga0224712_10096607 3300022467 Unclassified 1246
120 Ga0224712_10104015 3300022467 Bacteria 1209
121 Ga0224712_10131040 3300022467 Unclassified 1095
122 Ga0224712_10131261 3300022467 Unclassified 1094
123 Ga0224712_10179183 3300022467 Unclassified 954
124 Ga0224712_10257054 3300022467 Unclassified 808
125 Ga0224712_10274954 3300022467 Unclassified 783
126 Ga0224712_10524713 3300022467 Unclassified 574
127 Ga0207692_10080014 3300025898 Bacteria 1745
128 Ga0207692_10409513 3300025898 Unclassified 847
129 Ga0207688_10096360 3300025901 Bacteria 1704
130 Ga0207688_10419571 3300025901 Unclassified 831
131 Ga0207680_10088553 3300025903 Unclassified 1963
132 Ga0207647_10133516 3300025904 Bacteria 1457
133 Ga0207685_10174100 3300025905 Bacteria 993
134 Ga0207699_10295843 3300025906 Bacteria 1129
135 Ga0207699_10381588 3300025906 Unclassified 1000
136 Ga0207695_10002458 3300025913 Bacteria 27373
137 Ga0207693_10007633 3300025915 Bacteria 8879
138 Ga0207693_10029127 3300025915 Bacteria 4363
139 Ga0207663_10101174 3300025916 Bacteria 1936
140 Ga0207663_10213429 3300025916 Bacteria 1400
141 Ga0207681_10038412 3300025923 Bacteria 3172
142 Ga0207650_10246090 3300025925 Unclassified 1446
143 Ga0207650_10285212 3300025925 Bacteria 1345
144 Ga0207700_10675729 3300025928 Bacteria 921
145 Ga0207664_10051980 3300025929 Bacteria 3238
146 Ga0207664_10283046 3300025929 Unclassified 1455
147 Ga0207664_10809190 3300025929 Unclassified 843
148 Ga0207644_10242737 3300025931 Unclassified 1435
149 Ga0207644_10594314 3300025931 Bacteria 919
150 Ga0207644_10648560 3300025931 Unclassified 879
151 Ga0207690_10951596 3300025932 Unclassified 713
152 Ga0207690_11691705 3300025932 Unclassified 529
153 Ga0207706_10737180 3300025933 Unclassified 840
154 Ga0207669_10756924 3300025937 Unclassified 803
155 Ga0207665_10077855 3300025939 Unclassified 2277
156 Ga0207665_10212898 3300025939 Bacteria 1413
157 Ga0207691_10914067 3300025940 Unclassified 734
158 Ga0207689_10314358 3300025942 Unclassified 1299
159 Ga0207689_10481751 3300025942 Unclassified 1039
160 Ga0207661_10194551 3300025944 Bacteria 1780
161 Ga0207679_10357896 3300025945 Bacteria 1274
162 Ga0207679_10726566 3300025945 Unclassified 902
163 Ga0207679_11593953 3300025945 Bacteria 598
164 Ga0207712_10030086 3300025961 Bacteria 3648
165 Ga0207668_10011075 3300025972 Bacteria 5469
166 Ga0207668_10031670 3300025972 Unclassified 3486
167 Ga0207668_10320681 3300025972 Unclassified 1286
168 Ga0207668_10836161 3300025972 Unclassified 817
169 Ga0207658_10024294 3300025986 Bacteria 4239
170 Ga0207658_10032502 3300025986 Unclassified 3714
171 Ga0207658_11126095 3300025986 Unclassified 717
172 Ga0207677_10417630 3300026023 Unclassified 1142
173 Ga0207677_11355668 3300026023 Unclassified 654
174 Ga0207703_10135863 3300026035 Unclassified 2129
175 Ga0207703_11060151 3300026035 Unclassified 778
176 Ga0207639_10335820 3300026041 Bacteria 1346
177 Ga0207639_11609017 3300026041 Unclassified 609
178 Ga0207702_10267313 3300026078 Unclassified 1612
179 Ga0207702_10481781 3300026078 Unclassified 1207
180 Ga0207702_10630611 3300026078 Bacteria 1053
181 Ga0207641_10399368 3300026088 Bacteria 1320
182 Ga0207674_10627721 3300026116 Unclassified 1038
183 Ga0207675_100081467 3300026118 Bacteria 3034
184 Ga0207675_101337675 3300026118 Unclassified 737
185 Ga0207675_101653607 3300026118 Bacteria 660
186 Ga0268265_10013161 3300028380 Bacteria 5621
187 Ga0268265_10080341 3300028380 Bacteria 2571
188 Ga0268265_10710871 3300028380 Unclassified 972
189 Ga0268265_10748588 3300028380 Unclassified 948
190 Ga0268264_10185675 3300028381 Bacteria 1892
191 Ga0268264_11572197 3300028381 Unclassified 668
192 Ga0265331_10005641 3300031250 Bacteria 7522
193 Ga0265313_10000021 3300031595 Bacteria 144949
194 Ga0265314_10063214 3300031711 Unclassified 2512
195 Ga0265342_10015456 3300031712 Bacteria 5019
196 Ga0373934_0048030 3300035086 Bacteria 1689
197 Ga0373944_0054536 3300035089 Bacteria 1268
198 Ga0373923_0114044 3300035111 Bacteria 1202
199 Ga0373936_0222771 3300035113 Unclassified 837
200 Ga0373953_0068561 3300035117 Bacteria 1460
201 Ga0373956_0111891 3300035119 Unclassified 1271
202 Ga0373957_0021192 3300035120 Bacteria 2304
203 Ga0373960_0350578 3300035121 Unclassified 560
204 Ga0373960_0417166 3300035121 Bacteria 520
205 Ga0373943_0185209 3300035170 Unclassified 1146
206 Ga0373946_0015164 3300035171 Bacteria 2918
207 Ga0373955_0182632 3300035172 Bacteria 1245
208 Ga0316574_0767904 3300035398 Unclassified 588
209 Ga0373931_0537601 3300035691 Bacteria 758
210 Ga0373931_0664616 3300035691 Unclassified 686
211 Ga0373935_0024984 3300035692 Bacteria 3681
212 Ga0373935_0156877 3300035692 Bacteria 1549
213 Ga0373935_1003721 3300035692 Unclassified 620
214 Ga0373927_0061572 3300035695 Bacteria 2428
215 Ga0373927_0219563 3300035695 Bacteria 1249
216 Ga0373927_0602964 3300035695 Bacteria 726
217 Ga0373933_1047287 3300035724 Unclassified 537
218 Ga0373947_0022343 3300035725 Bacteria 3668
219 Ga0373947_0062486 3300035725 Bacteria 2266
220 Ga0373947_0213230 3300035725 Bacteria 1267
221 Ga0373937_0002674 3300036401 Bacteria 14858
222 Ga0373937_0168362 3300036401 Bacteria 2055
223 Ga0373925_0176071 3300037068 Bacteria 1691
224 Ga0373925_0365661 3300037068 Bacteria 1173
225 Ga0373925_1060520 3300037068 Unclassified 667
226 Ga0436364_0339458 3300037853 Bacteria 1598
227 Ga0436364_1433799 3300037853 Bacteria 15900
228 Ga0436364_1515455 3300037853 Unclassified 919
229 Ga0436365_0776798 3300039437 Bacteria 1097
230 Ga0436365_1244721 3300039437 Bacteria 2628
231 Ga0436365_1841319 3300039437 Unclassified 1379
232 Ga0436360_0257472 3300039438 Bacteria 863
233 Ga0436360_0731790 3300039438 Bacteria 2274
234 Ga0436361_0142465 3300039447 Bacteria 703
235 Ga0436361_0209095 3300039447 Unclassified 744
236 Ga0436361_0380410 3300039447 Bacteria 2768
237 Ga0436361_1122798 3300039447 Bacteria 14323
238 Ga0436363_0165171 3300039450 Bacteria 1567
239 Ga0466963_0519285 3300044694 Bacteria 841
240 Ga0466960_1011909 3300044901 Unclassified 511
241 Ga0495592_0048744 3300046454 Bacteria 3150
242 Ga0495629_0675156 3300046459 Bacteria 687
243 Ga0495662_0056150 3300046476 Bacteria 1902
244 Ga0495664_0034359 3300046477 Bacteria 2982
245 Ga0495608_0037399 3300046511 Bacteria 3264
246 Ga0495608_0131062 3300046511 Bacteria 1604
247 Ga0495618_0131077 3300046514 Bacteria 1604
248 Ga0495628_0140780 3300046516 Bacteria 1841
249 Ga0495640_0248226 3300046533 Bacteria 1115
250 Ga0495640_0340698 3300046533 Unclassified 926
251 Ga0495587_0104525 3300046536 Bacteria 1630
252 Ga0495645_0009918 3300046543 Bacteria 6665
253 Ga0495667_0045194 3300046559 Bacteria 2916
254 Ga0495668_0262278 3300046616 Unclassified 946
255 Ga0495599_0010961 3300046678 Bacteria 5561
256 Ga0495623_0033648 3300046679 Bacteria 3289
257 Ga0495646_0033605 3300046680 Bacteria 3189
258 Ga0495646_0394839 3300046680 Bacteria 720
259 Ga0495658_0281943 3300046683 Bacteria 1049
260 Ga0495613_0226005 3300046689 Bacteria 1313
261 Ga0495600_0359893 3300046809 Bacteria 910
262 Ga0495581_0726829 3300047315 Unclassified 572
263 Ga0495680_0204043 3300047322 Unclassified 1417
264 Ga0495675_0150601 3300047444 Bacteria 1437
265 Ga0495684_0065281 3300047471 Bacteria 2767
266 Ga0495602_0000974 3300048088 Bacteria 27710
267 Ga0496101_0362384 3300048904 Bacteria 1140
268 Ga0496101_1138925 3300048904 Unclassified 612
269 Ga0496102_0882706 3300048905 Bacteria 816
270 Ga0496104_0163200 3300048907 Bacteria 2137
271 Ga0496104_1106247 3300048907 Bacteria 696
272 Ga0496105_0081047 3300048908 Bacteria 2681
273 Ga0496108_0133822 3300048911 Bacteria 2131
274 Ga0496108_0626191 3300048911 Unclassified 936
275 Ga0496109_0221611 3300048912 Bacteria 1779
276 Ga0496111_0291206 3300048914 Unclassified 1211
277 Ga0501069_0098202 3300049585 Bacteria 1661
278 Ga0501070_0018711 3300049586 Bacteria 5811
279 Ga0501073_0354705 3300049589 Bacteria 1013
280 Ga0501074_0228083 3300049590 Bacteria 1326
281 nmdc:mga08y16_753805_c1 3300050511 Unclassified 969
282 nmdc:mga0rr50_1602081_c1 3300050513 Unclassified 549
283 nmdc:mga08x19_269832_c1 3300050514 Unclassified 1177
284 Ga0495601_0001552 3300053077 Bacteria 12697
285 Ga0495601_0178855 3300053077 Unclassified 1387
286 Ga0495612_0002212 3300053078 Bacteria 8002
287 Ga0495612_0206396 3300053078 Bacteria 868
288 Ga0495595_0008323 3300053084 Bacteria 4258
289 Ga0495619_0059029 3300053085 Bacteria 2548
290 Ga0587111_0162406 3300060346 Unclassified 608
291 Ga0495664_0218221
292 Ga0070683_100706239
293 Ga0070670_100541662
294 Ga0068869_100596027
295 Ga0070666_10088436
296 Ga0070682_100149139
297 Ga0070682_100605746
298 Ga0068868_100841006
299 Ga0070660_100908972
300 Ga0070691_10434407
301 Ga0070692_10397834
302 Ga0070668_100005359
303 Ga0070668_100072920
304 Ga0070668_100482912
305 Ga0070668_100842254
306 Ga0070668_100874860
307 Ga0070669_100051675
308 Ga0070671_100305895
309 Ga0070671_100348388
310 Ga0070674_100708620
311 Ga0070688_101244472
312 Ga0070667_100013860
313 Ga0070667_100016456
314 Ga0070667_100337017
315 Ga0070667_100359072
316 Ga0070709_10314342
317 Ga0070714_100069400
318 Ga0070714_100636807
319 Ga0070714_100992683
320 Ga0070714_101084050
321 Ga0070713_100843831
322 Ga0070713_101673881
323 Ga0070710_10137860
324 Ga0070710_10922042
325 Ga0070711_100156472
326 Ga0070711_101191766
327 Ga0070694_100646863
328 Ga0070663_101769636
329 Ga0070681_10313324
330 Ga0068867_100476644
331 Ga0070698_100473499
332 Ga0070699_100382266
333 Ga0070699_102081401
334 Ga0070697_100401685
335 Ga0070664_101807536
336 Ga0068856_100430978
337 Ga0068856_100670289
338 Ga0070702_100391917
339 Ga0068852_100778917
340 Ga0068859_100506280
341 Ga0068859_101465753
342 Ga0068866_10660658
343 Ga0068861_100047599
344 Ga0068861_100332396
345 Ga0068861_100861201
346 Ga0068863_100642544
347 Ga0068858_101088982
348 Ga0068860_100188371
349 Ga0068860_100392605
350 Ga0068860_100902316
351 Ga0068862_100011389
352 Ga0068862_100050673
353 Ga0070717_10130612
354 Ga0070717_10915307
355 Ga0070716_100110117
356 Ga0070716_100223519
357 Ga0070716_100729336
358 Ga0070712_100500365
359 Ga0070712_100821325
360 Ga0070712_101311779
361 Ga0075436_100287091
362 Ga0097620_100506231
363 Ga0097620_101465370
364 Ga0105240_10001980
365 Ga0105240_11480458
366 Ga0105247_10990570
367 Ga0105243_11985787
368 Ga0105241_10227797
369 Ga0105241_10265238
370 Ga0105242_10888746
371 Ga0105237_11111173
372 Ga0105238_10351306
373 Ga0105239_10329114
374 Ga0105239_10873192
375 Ga0105246_10141243
376 Ga0105246_10164110
377 Ga0157371_10139729
378 Ga0157369_10384475
379 Ga0157369_12626685
380 Ga0157374_10259015
381 Ga0163162_10283246
382 Ga0163162_10302692
383 Ga0157372_10831438
384 Ga0157375_10406503
385 Ga0157375_11137882
386 Ga0163163_10451855
387 Ga0163163_10485263
388 Ga0163163_12895111
389 Ga0157379_10259585
390 Ga0157379_11477444
391 Ga0157379_12600560
392 Ga0157376_11415931
393 Ga0163161_10244916
394 Ga0163161_11632117
395 Ga0197907_11413567
396 Ga0206351_10127016
397 Ga0206351_10633339
398 Ga0206351_10855276
399 Ga0206350_10373466
400 Ga0206350_10573599
401 Ga0206350_11523439
402 Ga0213872_10063050
403 Ga0213875_10018150
404 Ga0213875_10131910
405 Ga0224712_10044571
406 Ga0224712_10047118
407 Ga0224712_10064168
408 Ga0224712_10093656
409 Ga0224712_10096607
410 Ga0224712_10104015
411 Ga0224712_10131040
412 Ga0224712_10131261
413 Ga0224712_10179183
414 Ga0224712_10257054
415 Ga0224712_10274954
416 Ga0224712_10524713
417 Ga0207692_10080014
418 Ga0207692_10409513
419 Ga0207688_10096360
420 Ga0207688_10419571
421 Ga0207680_10088553
422 Ga0207647_10133516
423 Ga0207685_10174100
424 Ga0207699_10295843
425 Ga0207699_10381588
426 Ga0207695_10002458
427 Ga0207693_10007633
428 Ga0207693_10029127
429 Ga0207663_10101174
430 Ga0207663_10213429
431 Ga0207681_10038412
432 Ga0207650_10246090
433 Ga0207650_10285212
434 Ga0207700_10675729
435 Ga0207664_10051980
436 Ga0207664_10283046
437 Ga0207664_10809190
438 Ga0207644_10242737
439 Ga0207644_10594314
440 Ga0207644_10648560
441 Ga0207690_10951596
442 Ga0207690_11691705
443 Ga0207706_10737180
444 Ga0207669_10756924
445 Ga0207665_10077855
446 Ga0207665_10212898
447 Ga0207691_10914067
448 Ga0207689_10314358
449 Ga0207689_10481751
450 Ga0207661_10194551
451 Ga0207679_10357896
452 Ga0207679_10726566
453 Ga0207679_11593953
454 Ga0207712_10030086
455 Ga0207668_10011075
456 Ga0207668_10031670
457 Ga0207668_10320681
458 Ga0207668_10836161
459 Ga0207658_10024294
460 Ga0207658_10032502
461 Ga0207658_11126095
462 Ga0207677_10417630
463 Ga0207677_11355668
464 Ga0207703_10135863
465 Ga0207703_11060151
466 Ga0207639_10335820
467 Ga0207639_11609017
468 Ga0207702_10267313
469 Ga0207702_10481781
470 Ga0207702_10630611
471 Ga0207641_10399368
472 Ga0207674_10627721
473 Ga0207675_100081467
474 Ga0207675_101337675
475 Ga0207675_101653607
476 Ga0268265_10013161
477 Ga0268265_10080341
478 Ga0268265_10710871
479 Ga0268265_10748588
480 Ga0268264_10185675
481 Ga0268264_11572197
482 Ga0265331_10005641
483 Ga0265313_10000021
484 Ga0265314_10063214
485 Ga0265342_10015456
486 Ga0373934_0048030
487 Ga0373944_0054536
488 Ga0373923_0114044
489 Ga0373936_0222771
490 Ga0373953_0068561
491 Ga0373956_0111891
492 Ga0373957_0021192
493 Ga0373960_0350578
494 Ga0373960_0417166
495 Ga0373943_0185209
496 Ga0373946_0015164
497 Ga0373955_0182632
498 Ga0316574_0767904
499 Ga0373931_0537601
500 Ga0373931_0664616
501 Ga0373935_0024984
502 Ga0373935_0156877
503 Ga0373935_1003721
504 Ga0373927_0061572
505 Ga0373927_0219563
506 Ga0373927_0602964
507 Ga0373933_1047287
508 Ga0373947_0022343
509 Ga0373947_0062486
510 Ga0373947_0213230
511 Ga0373937_0002674
512 Ga0373937_0168362
513 Ga0373925_0176071
514 Ga0373925_0365661
515 Ga0373925_1060520
516 Ga0436364_0339458
517 Ga0436364_1433799
518 Ga0436364_1515455
519 Ga0436365_0776798
520 Ga0436365_1244721
521 Ga0436365_1841319
522 Ga0436360_0257472
523 Ga0436360_0731790
524 Ga0436361_0142465
525 Ga0436361_0209095
526 Ga0436361_0380410
527 Ga0436361_1122798
528 Ga0436363_0165171
529 Ga0466963_0519285
530 Ga0466960_1011909
531 Ga0495592_0048744
532 Ga0495629_0675156
533 Ga0495662_0056150
534 Ga0495664_0034359
535 Ga0495608_0037399
536 Ga0495608_0131062
537 Ga0495618_0131077
538 Ga0495628_0140780
539 Ga0495640_0248226
540 Ga0495640_0340698
541 Ga0495587_0104525
542 Ga0495645_0009918
543 Ga0495667_0045194
544 Ga0495668_0262278
545 Ga0495599_0010961
546 Ga0495623_0033648
547 Ga0495646_0033605
548 Ga0495646_0394839
549 Ga0495658_0281943
550 Ga0495613_0226005
551 Ga0495600_0359893
552 Ga0495581_0726829
553 Ga0495680_0204043
554 Ga0495675_0150601
555 Ga0495684_0065281
556 Ga0495602_0000974
557 Ga0496101_0362384
558 Ga0496101_1138925
559 Ga0496102_0882706
560 Ga0496104_0163200
561 Ga0496104_1106247
562 Ga0496105_0081047
563 Ga0496108_0133822
564 Ga0496108_0626191
565 Ga0496109_0221611
566 Ga0496111_0291206
567 Ga0501069_0098202
568 Ga0501070_0018711
569 Ga0501073_0354705
570 Ga0501074_0228083
571 nmdc:mga08y16_753805_c1
572 nmdc:mga0rr50_1602081_c1
573 nmdc:mga08x19_269832_c1
574 Ga0495601_0001552
575 Ga0495601_0178855
576 Ga0495612_0002212
577 Ga0495612_0206396
578 Ga0495595_0008323
579 Ga0495619_0059029
580 Ga0587111_0162406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

65

164

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8792 38 129
2cg9-assembly1.cif.gz_Y crystal structure of an hsp90-sba1 closed chaperone complex 0.8477 35 129
7krj-assembly1.cif.gz_C the gr-maturation complex: glucocorticoid receptor in complex with hsp90 and co-chaperone p23 0.8472 40 130
7l7i-assembly1.cif.gz_E cryo-em structure of hsp90:fkbp51:p23 closed-state complex 0.8331 40 130
3guf-assembly1.cif.gz_B crystal structure of the hspa from xanthomonas axonopodis 0.8309 38 128
ID Description Score Start End Superfamily
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8792 38 129 2.60.40.790
af_I1JA98_161_252_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8757 36 129 2.60.40.790
af_A0A144A1J3_25_143_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8581 48 128 2.60.40.790
af_A4I9J1_8_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8557 38 127 2.60.40.790
af_A0A0R4ID80_6_85_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8554 40 128 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A1F9LJQ2-F1-model_v4 Heat-shock protein Hsp20 0.8832 37 140
AF-A0A3D1TUL1-F1-model_v4 SHSP domain-containing protein 0.8759 38 140
AF-A0A1F9LJQ2-F1-model_v4 Heat-shock protein Hsp20 0.8751 37 140
AF-A0A347ZVN1-F1-model_v4 HSP20 family protein 0.8724 36 140
AF-A0A7K1FN79-F1-model_v4 Hsp20 family protein 0.8714 39 140

Map