F389922

General Info

Members Datasets Scaffolds Average Seq Length
290 244 155 273

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0007932|Ga0466967_0007932_4458_5273
Length 264
Sequence MRSIVLLGLLALATSAHAASSEQHYLDLRDRYIAKFAKAKESDETSRQHDAALNELARVLRGLIGPVTIKGLPAEGKSNVDTLFRDDIGFGHLDGLGFATDGDKQQLLKHWLREHGKDGMPQEVDAAFRSDRFYYQAIQDAAFAKYAELPITKPVSVSAAVAVLGVRGNGDLKGPPHEIDVVAIQGEKVYFLAVTEAVKTAEIPACEKIWKQMMARKMPEDAMAREDQAMTAYTKCFAKEAPSQSWFAAATRKAQSQLEQLPLR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
13 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
16 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
17 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
18 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
19 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
20 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
21 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
22 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
23 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
24 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
25 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
26 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
27 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
28 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
29 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
30 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
31 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
32 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
33 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
34 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
35 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
36 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
37 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
38 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
39 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
40 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
41 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
42 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
43 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
44 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
45 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
46 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
47 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
48 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
49 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
50 2922368715
51 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
52 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
53 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
54 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
55 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
56 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
57 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
58 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
59 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
60 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
61 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
62 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
63 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
64 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
65 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
66 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
67 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
68 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
69 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
70 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
71 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
72 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
73 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
74 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
75 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
76 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
77 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
78 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
79 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
80 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
81 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
82 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
83 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
84 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
85 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
86 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
87 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
88 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
89 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
90 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
91 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
92 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
93 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
94 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
95 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
96 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
97 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
98 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
99 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
100 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
101 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
102 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
103 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
104 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
105 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
106 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
107 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
108 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
109 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
110 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
111 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
112 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
113 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
114 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
115 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
116 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
219 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
220 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
221 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
222 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
223 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
224 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
225 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
226 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
227 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
228 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
229 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
230 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
231 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
232 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
233 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
234 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
235 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
236 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
237 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
238 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
239 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
240 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
241 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
242 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
243 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
244 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.63
Metatranscriptomes 0
Isolates 46.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.76
Nodule 37.59
Rhizoplane 1.72
Rhizosphere 23.1
Stem 0
Stem Tuber 0
Unclassified 14.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000430 3300003215 Bacteria 27183
2 JGI25153J46596_10000458 3300003215 Bacteria 26109
3 JGI25153J46596_10034173 3300003215 Bacteria 1666
4 rootH2_10048625 3300003320 Bacteria 2963
5 JGI25160J50197_1000506 3300003354 Bacteria 23179
6 Ga0055543_1016542 3300004625 Bacteria 1402
7 Ga0065165_1000435 3300005262 Bacteria 65756
8 Ga0065165_1005208 3300005262 Bacteria 7478
9 Ga0065165_1009375 3300005262 Bacteria 4400
10 Ga0068867_100598510 3300005459 Bacteria 961
11 Ga0070665_100060431 3300005548 Bacteria 3798
12 Ga0070665_100681101 3300005548 Bacteria 1041
13 Ga0068857_100405061 3300005577 Bacteria 1270
14 Ga0068854_100126659 3300005578 Bacteria 1946
15 Ga0068856_100397554 3300005614 Bacteria 1398
16 Ga0068852_100003079 3300005616 Bacteria 11608
17 Ga0068852_100112201 3300005616 Bacteria 2480
18 Ga0068861_100562032 3300005719 Bacteria 1041
19 Ga0068858_100282131 3300005842 Bacteria 1582
20 Ga0075365_10033115 3300006038 Bacteria 3327
21 Ga0075365_10098736 3300006038 Bacteria 1998
22 Ga0075365_10193050 3300006038 Bacteria 1425
23 Ga0075364_10197375 3300006051 Bacteria 1364
24 Ga0075369_10118981 3300006186 Bacteria 1195
25 Ga0075369_10140082 3300006186 Bacteria 1102
26 Ga0075370_10150189 3300006353 Bacteria 1365
27 Ga0105240_10002091 3300009093 Bacteria 32664
28 Ga0105245_10052051 3300009098 Bacteria 3671
29 Ga0105241_10007422 3300009174 Bacteria 8070
30 Ga0105241_10189568 3300009174 Bacteria 1711
31 Ga0105237_10001252 3300009545 Bacteria 33910
32 Ga0105237_10528565 3300009545 Bacteria 1186
33 Ga0105239_10012384 3300010375 Bacteria 9497
34 Ga0105239_10029945 3300010375 Bacteria 5987
35 Ga0105239_10534753 3300010375 Bacteria 1334
36 Ga0105239_10676479 3300010375 Bacteria 1179
37 Ga0163162_10348016 3300013306 Bacteria 1615
38 Ga0209563_101627 3300025230 Bacteria 5796
39 Ga0209677_106555 3300025253 Bacteria 2727
40 Ga0209148_1000274 3300025254 Bacteria 81201
41 Ga0209233_1024152 3300025261 Bacteria 1525
42 Ga0209455_1012727 3300025272 Bacteria 1995
43 Ga0209673_1016004 3300025273 Bacteria 2822
44 Ga0209564_1006601 3300025295 Bacteria 6213
45 Ga0209758_1000021 3300025297 Bacteria 697691
46 Ga0209758_1000211 3300025297 Bacteria 127721
47 Ga0209758_1002291 3300025297 Bacteria 19796
48 Ga0209758_1003094 3300025297 Bacteria 15758
49 Ga0209256_1003447 3300025299 Bacteria 11078
50 Ga0209256_1014828 3300025299 Bacteria 2770
51 Ga0207426_1000143 3300025302 Bacteria 192948
52 Ga0207426_1001149 3300025302 Bacteria 23849
53 Ga0207426_1038630 3300025302 Bacteria 1502
54 Ga0209051_1070236 3300025303 Bacteria 1057
55 Ga0209257_1000883 3300025304 Bacteria 42345
56 Ga0209257_1004984 3300025304 Bacteria 9705
57 Ga0209257_1033340 3300025304 Bacteria 1620
58 Ga0207647_10001924 3300025904 Bacteria 15879
59 Ga0207654_10074893 3300025911 Bacteria 2021
60 Ga0207654_10110791 3300025911 Bacteria 1708
61 Ga0207654_10135992 3300025911 Bacteria 1561
62 Ga0207695_10000015 3300025913 Bacteria 803205
63 Ga0207671_10005048 3300025914 Bacteria 12327
64 Ga0207671_10222686 3300025914 Bacteria 1478
65 Ga0207657_10250571 3300025919 Bacteria 1412
66 Ga0207657_10421958 3300025919 Bacteria 1048
67 Ga0207644_10136860 3300025931 Bacteria 1882
68 Ga0207658_10588568 3300025986 Bacteria 999
69 Ga0207678_10020261 3300026067 Bacteria 5836
70 Ga0207702_10243009 3300026078 Bacteria 1687
71 Ga0207702_10339398 3300026078 Bacteria 1435
72 Ga0207698_10064393 3300026142 Bacteria 2873
73 Ga0268266_10096161 3300028379 Bacteria 2602
74 Ga0307510_10007907 3300033180 Bacteria 12664
75 Ga0307510_10248743 3300033180 Bacteria 1267
76 Ga0307510_10271844 3300033180 Bacteria 1170
77 Ga0395905_0004820 3300037471 Bacteria 13919
78 Ga0395905_0078991 3300037471 Bacteria 3083
79 Ga0466972_0000188 3300044658 Bacteria 47766
80 Ga0466972_0138915 3300044658 Bacteria 1143
81 Ga0466965_0032044 3300044683 Bacteria 2567
82 Ga0466960_0017610 3300044901 Bacteria 3118
83 Ga0466959_0097591 3300045049 Bacteria 2106
84 Ga0466967_0007932 3300045976 Bacteria 7723
85 Ga0495592_0151011 3300046454 Bacteria 1607
86 Ga0495629_0002886 3300046459 Bacteria 13130
87 Ga0495638_0002662 3300046460 Bacteria 14381
88 Ga0495651_0010856 3300046462 Bacteria 7004
89 Ga0495664_0252167 3300046477 Bacteria 1067
90 Ga0495648_0091005 3300046524 Bacteria 1708
91 Ga0495652_0098654 3300046529 Bacteria 2374
92 Ga0495640_0017481 3300046533 Bacteria 5345
93 Ga0495640_0020351 3300046533 Bacteria 4886
94 Ga0495645_0372558 3300046543 Bacteria 915
95 Ga0495622_0080969 3300046557 Bacteria 1494
96 Ga0495667_0018851 3300046559 Bacteria 4660
97 Ga0495634_0295246 3300046642 Bacteria 981
98 Ga0495635_0021637 3300046663 Bacteria 4483
99 Ga0495623_0020681 3300046679 Bacteria 4254
100 Ga0495624_0208645 3300046690 Bacteria 1185
101 Ga0495600_0004580 3300046809 Bacteria 8292
102 Ga0495604_0006635 3300047317 Bacteria 9172
103 Ga0495604_0036857 3300047317 Bacteria 3854
104 Ga0495602_0022693 3300048088 Bacteria 6138
105 Ga0495602_0266619 3300048088 Bacteria 1268
106 Ga0496105_0035869 3300048908 Bacteria 4084
107 Ga0496108_0048872 3300048911 Bacteria 3538
108 Ga0496113_0120970 3300048916 Bacteria 2047
109 Ga0496113_0240959 3300048916 Bacteria 1443
110 Ga0496114_0660671 3300048917 Bacteria 919
111 Ga0496117_0110950 3300048920 Bacteria 1709
112 Ga0496117_0114110 3300048920 Bacteria 1676
113 Ga0496118_0042430 3300048921 Bacteria 3589
114 Ga0496118_0069615 3300048921 Bacteria 2547
115 Ga0496118_0119424 3300048921 Bacteria 1724
116 Ga0496119_0013728 3300048922 Bacteria 6419
117 Ga0496119_0089398 3300048922 Bacteria 1754
118 Ga0496121_0023327 3300048924 Bacteria 5964
119 Ga0496121_0035596 3300048924 Bacteria 4457
120 Ga0496121_0039324 3300048924 Bacteria 4171
121 Ga0496124_0090041 3300048927 Bacteria 2504
122 Ga0496124_0112195 3300048927 Bacteria 2193
123 Ga0496125_0269383 3300048928 Bacteria 1062
124 Ga0496126_0018515 3300048929 Bacteria 6896
125 nmdc:mga00v17_78310_c1 3300050491 Bacteria 2059
126 nmdc:mga0yw44_147451_c1 3300050492 Bacteria 1533
127 nmdc:mga0yw44_288586_c1 3300050492 Bacteria 1098
128 nmdc:mga0k408_11796_c1 3300050493 Bacteria 4768
129 nmdc:mga06z11_193835_c1 3300050494 Bacteria 1177
130 nmdc:mga07m45_102734_c1 3300050496 Bacteria 1642
131 nmdc:mga07m45_211783_c1 3300050496 Bacteria 1127
132 Ga0500578_0108784 3300053086 Bacteria 1749
133 Ga0500578_0125345 3300053086 Bacteria 1613
134 Ga0500643_000085 3300053087 Bacteria 98026
135 Ga0500644_0055354 3300053088 Bacteria 1377
136 Ga0500647_0077338 3300053091 Bacteria 1596
137 Ga0500651_0074442 3300053093 Bacteria 2110
138 Ga0500566_0042807 3300053094 Bacteria 2611
139 Ga0500640_100822 3300053095 Bacteria 1193
140 Ga0500555_016674 3300053103 Bacteria 2117
141 Ga0500556_0063029 3300053104 Bacteria 1369
142 Ga0500557_000002 3300053105 Bacteria 234207
143 Ga0500595_005511 3300053119 Bacteria 5521
144 Ga0500595_047040 3300053119 Bacteria 1354
145 Ga0500608_093615 3300053122 Bacteria 1401
146 Ga0500642_0000442 3300053130 Bacteria 13325
147 Ga0500655_016019 3300053133 Bacteria 1378
148 Ga0500658_0008183 3300053134 Bacteria 3864
149 Ga0500588_0078957 3300053146 Bacteria 1097
150 Ga0500590_125777 3300053148 Bacteria 1194
151 Ga0500616_0017483 3300053153 Bacteria 4067
152 Ga0500636_0000103 3300053177 Bacteria 43319
153 Ga0500625_005791 3300053729 Bacteria 5203
154 Ga0500599_016776 3300053736 Bacteria 1013
155 Ga0500601_000173 3300053737 Bacteria 13368

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0269383 Ga0496125_0269383_264_1040 258
2 3300046460 Ga0495638_0002662 Ga0495638_0002662_11102_11890 262
3 3300053133 Ga0500655_016019 Ga0500655_016019_502_1290 262
4 3300045976 Ga0466967_0007932 Ga0466967_0007932_4458_5273 264
5 3300003320 rootH2_10048625 rootH2_100486252 265
6 3300046543 Ga0495645_0372558 Ga0495645_0372558_10_810 266
7 3300048921 Ga0496118_0042430 Ga0496118_0042430_2330_3130 266
8 3300050492 nmdc:mga0yw44_147451_c1 nmdc:mga0yw44_147451_c1_453_1253 266
9 iso_pu_bacteria 2513237094 2513641999 267
10 iso_pu_bacteria 2513237102 2513703680 267
11 iso_pu_bacteria 2517093001 2517101579 267
12 iso_pu_bacteria 2528768022 2528849726 267
13 iso_pu_bacteria 2791355196 2793065887 267
14 iso_pu_bacteria 2824617872 2824623359 267
15 iso_pu_bacteria 2824626560 2824632287 267
16 iso_pu_bacteria 2824635225 2824639017 267
17 iso_pu_bacteria 2824644064 2824648161 267
18 iso_pu_bacteria 2824661429 2824665643 267
19 iso_pu_bacteria 2824704595 2824708787 267
20 iso_pu_bacteria 2824714736 2824718775 267
21 iso_pu_bacteria 2824723954 2824725803 267
22 iso_pu_bacteria 2824753945 2824757166 267
23 iso_pu_bacteria 2824763712 2824766764 267
24 iso_pu_bacteria 2841957949 2841958352 267
25 iso_pu_bacteria 2842038055 2842039385 267
26 iso_pu_bacteria 2842045827 2842047669 267
27 iso_pu_bacteria 2844315083 2844318786 267
28 iso_pu_bacteria 2857509624 2857513961 267
29 iso_pu_bacteria 2874620515 2874627436 267
30 iso_pu_bacteria 2874628541 2874629813 267
31 iso_pu_bacteria 2879099564 2879103865 267
32 iso_pu_bacteria 2881364244 2881371731 267
33 iso_pu_bacteria 2903727486 2903728910 267
34 iso_pu_bacteria 2904666416 2904671046 267
35 iso_pu_bacteria 2904711408 2904720883 267
36 iso_pu_bacteria 2906602504 2906604386 267
37 iso_pu_bacteria 2922368715 2922373973 267
38 iso_pu_bacteria 2932784394 2932788514 267
39 iso_pu_bacteria 2932794094 2932798569 267
40 iso_pu_bacteria 2932801729 2932803122 267
41 iso_pu_bacteria 2932809354 2932816342 267
42 iso_pu_bacteria 2932818245 2932821512 267
43 iso_pu_bacteria 2932828146 2932831597 267
44 iso_pu_bacteria 2935616580 2935622357 267
45 iso_pu_bacteria 2935638405 2935645215 267
46 iso_pu_bacteria 2935665750 2935671757 267
47 iso_pu_bacteria 2935675223 2935678840 267
48 iso_pu_bacteria 2935684952 2935688838 267
49 iso_pu_bacteria 2935694250 2935696213 267
50 iso_pu_bacteria 2935703347 2935706958 267
51 iso_pu_bacteria 2935713505 2935715857 267
52 iso_pu_bacteria 2935722832 2935725579 267
53 iso_pu_bacteria 2935732158 2935738142 267
54 iso_pu_bacteria 2935741537 2935747517 267
55 iso_pu_bacteria 2935750917 2935753908 267
56 iso_pu_bacteria 2935760218 2935762913 267
57 iso_pu_bacteria 2935801545 2935807694 267
58 iso_pu_bacteria 2935810662 2935817038 267
59 iso_pu_bacteria 2935827899 2935834682 267
60 iso_pu_bacteria 2935837841 2935840364 267
61 iso_pu_bacteria 2935855204 2935860575 267
62 iso_pu_bacteria 2935864058 2935865387 267
63 iso_pu_bacteria 2935873716 2935877983 267
64 iso_pu_bacteria 2935883170 2935885461 267
65 iso_pu_bacteria 2935992306 2935996068 267
66 iso_pu_bacteria 2936002035 2936006202 267
67 iso_pu_bacteria 2936037263 2936043417 267
68 iso_pu_bacteria 2940556831 2940560716 267
69 iso_pu_bacteria 2941531003 2941537680 267
70 iso_pu_bacteria 2941538514 2941541505 267
71 iso_pu_bacteria 3005594810 3005598935 267
72 iso_pu_bacteria 3005710791 3005714514 267
73 iso_pu_bacteria 3005718088 3005722031 267
74 iso_pu_bacteria 8016511872 8016513675 267
75 iso_pu_bacteria 8017057580 8017062771 267
76 iso_pu_bacteria 8019576017 8019582206 267
77 iso_pu_bacteria 8019586578 8019589897 267
78 iso_pu_bacteria 8019597564 8019601372 267
79 iso_pu_bacteria 8019608314 8019617181 267
80 iso_pu_bacteria 8019648815 8019658046 267
81 iso_pu_bacteria 8056967851 8056973150 267
82 3300053122 Ga0500608_093615 Ga0500608_093615_468_1277 269
83 3300044658 Ga0466972_0000188 Ga0466972_0000188_28541_29353 270
84 3300044683 Ga0466965_0032044 Ga0466965_0032044_860_1672 270
85 3300003215 JGI25153J46596_10000458 JGI25153J46596_1000045825 271
86 3300003354 JGI25160J50197_1000506 JGI25160J50197_10005063 271
87 3300005262 Ga0065165_1005208 Ga0065165_10052085 271
88 3300005262 Ga0065165_1009375 Ga0065165_10093753 271
89 3300005459 Ga0068867_100598510 Ga0068867_1005985101 271
90 3300005548 Ga0070665_100060431 Ga0070665_1000604312 271
91 3300005548 Ga0070665_100681101 Ga0070665_1006811011 271
92 3300005577 Ga0068857_100405061 Ga0068857_1004050612 271
93 3300005578 Ga0068854_100126659 Ga0068854_1001266592 271
94 3300005614 Ga0068856_100397554 Ga0068856_1003975541 271
95 3300005616 Ga0068852_100003079 Ga0068852_1000030797 271
96 3300005616 Ga0068852_100112201 Ga0068852_1001122012 271
97 3300006038 Ga0075365_10098736 Ga0075365_100987362 271
98 3300006038 Ga0075365_10193050 Ga0075365_101930502 271
99 3300006051 Ga0075364_10197375 Ga0075364_101973751 271
100 3300006186 Ga0075369_10118981 Ga0075369_101189811 271
101 3300006186 Ga0075369_10140082 Ga0075369_101400821 271
102 3300006353 Ga0075370_10150189 Ga0075370_101501892 271
103 3300009093 Ga0105240_10002091 Ga0105240_1000209129 271
104 3300009098 Ga0105245_10052051 Ga0105245_100520512 271
105 3300009174 Ga0105241_10007422 Ga0105241_100074224 271
106 3300009174 Ga0105241_10189568 Ga0105241_101895682 271
107 3300009545 Ga0105237_10001252 Ga0105237_1000125219 271
108 3300009545 Ga0105237_10528565 Ga0105237_105285651 271
109 3300010375 Ga0105239_10012384 Ga0105239_100123843 271
110 3300010375 Ga0105239_10029945 Ga0105239_100299455 271
111 3300010375 Ga0105239_10534753 Ga0105239_105347531 271
112 3300010375 Ga0105239_10676479 Ga0105239_106764791 271
113 3300013306 Ga0163162_10348016 Ga0163162_103480162 271
114 3300025254 Ga0209148_1000274 Ga0209148_100027421 271
115 3300025272 Ga0209455_1012727 Ga0209455_10127272 271
116 3300025273 Ga0209673_1016004 Ga0209673_10160042 271
117 3300025295 Ga0209564_1006601 Ga0209564_10066016 271
118 3300025297 Ga0209758_1000021 Ga0209758_1000021366 271
119 3300025297 Ga0209758_1003094 Ga0209758_10030948 271
120 3300025299 Ga0209256_1003447 Ga0209256_10034476 271
121 3300025299 Ga0209256_1014828 Ga0209256_10148282 271
122 3300025302 Ga0207426_1000143 Ga0207426_1000143144 271
123 3300025302 Ga0207426_1001149 Ga0207426_10011492 271
124 3300025302 Ga0207426_1038630 Ga0207426_10386302 271
125 3300025303 Ga0209051_1070236 Ga0209051_10702361 271
126 3300025304 Ga0209257_1000883 Ga0209257_100088320 271
127 3300025304 Ga0209257_1033340 Ga0209257_10333402 271
128 3300025911 Ga0207654_10074893 Ga0207654_100748932 271
129 3300025911 Ga0207654_10110791 Ga0207654_101107912 271
130 3300025913 Ga0207695_10000015 Ga0207695_10000015431 271
131 3300025914 Ga0207671_10005048 Ga0207671_100050482 271
132 3300025914 Ga0207671_10222686 Ga0207671_102226862 271
133 3300025931 Ga0207644_10136860 Ga0207644_101368602 271
134 3300025986 Ga0207658_10588568 Ga0207658_105885682 271
135 3300026067 Ga0207678_10020261 Ga0207678_100202613 271
136 3300026078 Ga0207702_10243009 Ga0207702_102430092 271
137 3300026142 Ga0207698_10064393 Ga0207698_100643932 271
138 3300028379 Ga0268266_10096161 Ga0268266_100961614 271
139 3300033180 Ga0307510_10007907 Ga0307510_1000790711 271
140 3300033180 Ga0307510_10248743 Ga0307510_102487432 271
141 3300033180 Ga0307510_10271844 Ga0307510_102718441 271
142 3300037471 Ga0395905_0004820 Ga0395905_0004820_13035_13850 271
143 3300037471 Ga0395905_0078991 Ga0395905_0078991_2122_2937 271
144 3300044658 Ga0466972_0138915 Ga0466972_0138915_70_885 271
145 3300044901 Ga0466960_0017610 Ga0466960_0017610_214_1029 271
146 3300045049 Ga0466959_0097591 Ga0466959_0097591_410_1225 271
147 3300046454 Ga0495592_0151011 Ga0495592_0151011_511_1326 271
148 3300046459 Ga0495629_0002886 Ga0495629_0002886_7886_8812 271
149 3300046462 Ga0495651_0010856 Ga0495651_0010856_4889_5812 271
150 3300046477 Ga0495664_0252167 Ga0495664_0252167_230_1045 271
151 3300046524 Ga0495648_0091005 Ga0495648_0091005_192_1007 271
152 3300046529 Ga0495652_0098654 Ga0495652_0098654_1317_2243 271
153 3300046533 Ga0495640_0017481 Ga0495640_0017481_619_1542 271
154 3300046533 Ga0495640_0020351 Ga0495640_0020351_3876_4802 271
155 3300046557 Ga0495622_0080969 Ga0495622_0080969_360_1175 271
156 3300046559 Ga0495667_0018851 Ga0495667_0018851_3707_4630 271
157 3300046642 Ga0495634_0295246 Ga0495634_0295246_38_961 271
158 3300046663 Ga0495635_0021637 Ga0495635_0021637_631_1557 271
159 3300046679 Ga0495623_0020681 Ga0495623_0020681_1903_2826 271
160 3300046690 Ga0495624_0208645 Ga0495624_0208645_135_1061 271
161 3300046809 Ga0495600_0004580 Ga0495600_0004580_3258_4184 271
162 3300047317 Ga0495604_0006635 Ga0495604_0006635_3671_4594 271
163 3300047317 Ga0495604_0036857 Ga0495604_0036857_2594_3520 271
164 3300048088 Ga0495602_0022693 Ga0495602_0022693_4364_5287 271
165 3300048088 Ga0495602_0266619 Ga0495602_0266619_234_1160 271
166 3300048911 Ga0496108_0048872 Ga0496108_0048872_953_1768 271
167 3300048916 Ga0496113_0240959 Ga0496113_0240959_400_1215 271
168 3300048920 Ga0496117_0110950 Ga0496117_0110950_217_1032 271
169 3300048921 Ga0496118_0069615 Ga0496118_0069615_62_988 271
170 3300048921 Ga0496118_0119424 Ga0496118_0119424_803_1618 271
171 3300048922 Ga0496119_0013728 Ga0496119_0013728_3061_3987 271
172 3300048924 Ga0496121_0039324 Ga0496121_0039324_649_1464 271
173 3300048927 Ga0496124_0090041 Ga0496124_0090041_697_1623 271
174 3300048929 Ga0496126_0018515 Ga0496126_0018515_3088_4014 271
175 3300050492 nmdc:mga0yw44_288586_c1 nmdc:mga0yw44_288586_c1_27_842 271
176 3300050493 nmdc:mga0k408_11796_c1 nmdc:mga0k408_11796_c1_738_1553 271
177 3300050494 nmdc:mga06z11_193835_c1 nmdc:mga06z11_193835_c1_35_850 271
178 3300050496 nmdc:mga07m45_102734_c1 nmdc:mga07m45_102734_c1_558_1373 271
179 3300050496 nmdc:mga07m45_211783_c1 nmdc:mga07m45_211783_c1_242_1057 271
180 3300053086 Ga0500578_0108784 Ga0500578_0108784_691_1506 271
181 3300053086 Ga0500578_0125345 Ga0500578_0125345_613_1539 271
182 3300053087 Ga0500643_000085 Ga0500643_000085_44927_45742 271
183 3300053088 Ga0500644_0055354 Ga0500644_0055354_130_945 271
184 3300053093 Ga0500651_0074442 Ga0500651_0074442_527_1342 271
185 3300053094 Ga0500566_0042807 Ga0500566_0042807_1221_2036 271
186 3300053095 Ga0500640_100822 Ga0500640_100822_190_1005 271
187 3300053103 Ga0500555_016674 Ga0500555_016674_1234_2049 271
188 3300053104 Ga0500556_0063029 Ga0500556_0063029_469_1284 271
189 3300053119 Ga0500595_005511 Ga0500595_005511_1248_2174 271
190 3300053119 Ga0500595_047040 Ga0500595_047040_310_1125 271
191 3300053134 Ga0500658_0008183 Ga0500658_0008183_980_1795 271
192 3300053146 Ga0500588_0078957 Ga0500588_0078957_217_1032 271
193 3300053148 Ga0500590_125777 Ga0500590_125777_54_980 271
194 3300053153 Ga0500616_0017483 Ga0500616_0017483_2516_3331 271
195 3300053177 Ga0500636_0000103 Ga0500636_0000103_19807_20622 271
196 3300053736 Ga0500599_016776 Ga0500599_016776_140_955 271
197 3300053737 Ga0500601_000173 Ga0500601_000173_4055_4870 271
198 iso_pu_bacteria 2507262055 2507508991 271
199 iso_pu_bacteria 2508501009 2508543055 271
200 iso_pu_bacteria 2508501042 2508691216 271
201 iso_pu_bacteria 2511231028 2511394466 271
202 iso_pu_bacteria 2513237095 2513650213 271
203 iso_pu_bacteria 2513237139 2513872461 271
204 iso_pu_bacteria 2515154112 2515626411 271
205 iso_pu_bacteria 2802429603 2805917952 271
206 iso_pu_bacteria 2816332527 2818241263 271
207 iso_pu_bacteria 2824696289 2824698877 271
208 iso_pu_bacteria 2847939898 2847946229 271
209 iso_pu_bacteria 2849076700 2849079616 271
210 iso_pu_bacteria 2874590934 2874592680 271
211 iso_pu_bacteria 2874645413 2874648283 271
212 iso_pu_bacteria 2876771140 2876772893 271
213 iso_pu_bacteria 2876818435 2876820221 271
214 iso_pu_bacteria 2879074833 2879076724 271
215 iso_pu_bacteria 2879127579 2879131665 271
216 iso_pu_bacteria 2879142872 2879148042 271
217 iso_pu_bacteria 2888378607 2888383739 271
218 iso_pu_bacteria 2888388044 2888394143 271
219 iso_pu_bacteria 2929615660 2929617689 271
220 iso_pu_bacteria 2929624759 2929627394 271
221 iso_pu_bacteria 2933577622 2933579645 271
222 iso_pu_bacteria 2935608549 2935612161 271
223 iso_pu_bacteria 2935648319 2935649738 271
224 iso_pu_bacteria 2935656913 2935658747 271
225 iso_pu_bacteria 2935769743 2935774996 271
226 iso_pu_bacteria 2935785616 2935791759 271
227 iso_pu_bacteria 2935793552 2935800009 271
228 iso_pu_bacteria 2935819856 2935821631 271
229 iso_pu_bacteria 2935847175 2935847232 271
230 iso_pu_bacteria 2935908558 2935914664 271
231 iso_pu_bacteria 2935916978 2935924869 271
232 iso_pu_bacteria 2935926038 2935932258 271
233 iso_pu_bacteria 2935934488 2935940856 271
234 iso_pu_bacteria 2935942939 2935948929 271
235 iso_pu_bacteria 2935951376 2935957487 271
236 iso_pu_bacteria 2935967501 2935973934 271
237 iso_pu_bacteria 2935975950 2935977318 271
238 iso_pu_bacteria 2936011229 2936012780 271
239 iso_pu_bacteria 2936019824 2936021344 271
240 iso_pu_bacteria 2936028420 2936030073 271
241 iso_pu_bacteria 2936046547 2936047538 271
242 iso_pu_bacteria 2936055302 2936057304 271
243 iso_pu_bacteria 8016530956 8016535231 271
244 iso_pu_bacteria 8016539877 8016548441 271
245 iso_pu_bacteria 8016557553 8016562068 271
246 iso_pu_bacteria 8016566248 8016573573 271
247 iso_pu_bacteria 8016575299 8016577699 271
248 iso_pu_bacteria 8016583857 8016592256 271
249 iso_pu_bacteria 8016595262 8016599890 271
250 iso_pu_bacteria 8016630954 8016640710 271
251 iso_pu_bacteria 8019530166 8019534982 271
252 iso_pu_bacteria 8019619141 8019627710 271
253 iso_pu_bacteria 8019629233 8019634797 271
254 iso_pu_bacteria 8019638758 8019644905 271
255 iso_pu_bacteria 8019668869 8019672306 271
256 iso_pu_bacteria 8019678201 8019683901 271
257 iso_pu_bacteria 8019687851 8019689643 271
258 iso_pu_bacteria 8055742211 8055746696 271
259 3300003215 JGI25153J46596_10000430 JGI25153J46596_1000043015 275
260 3300003215 JGI25153J46596_10034173 JGI25153J46596_100341731 275
261 3300004625 Ga0055543_1016542 Ga0055543_10165422 275
262 3300005262 Ga0065165_1000435 Ga0065165_100043511 275
263 3300005719 Ga0068861_100562032 Ga0068861_1005620321 275
264 3300005842 Ga0068858_100282131 Ga0068858_1002821312 275
265 3300006038 Ga0075365_10033115 Ga0075365_100331152 275
266 3300025230 Ga0209563_101627 Ga0209563_1016272 275
267 3300025253 Ga0209677_106555 Ga0209677_1065551 275
268 3300025261 Ga0209233_1024152 Ga0209233_10241522 275
269 3300025297 Ga0209758_1000211 Ga0209758_100021170 275
270 3300025297 Ga0209758_1002291 Ga0209758_10022919 275
271 3300025304 Ga0209257_1004984 Ga0209257_10049847 275
272 3300025904 Ga0207647_10001924 Ga0207647_100019246 275
273 3300025911 Ga0207654_10135992 Ga0207654_101359922 275
274 3300025919 Ga0207657_10250571 Ga0207657_102505711 275
275 3300025919 Ga0207657_10421958 Ga0207657_104219582 275
276 3300026078 Ga0207702_10339398 Ga0207702_103393982 275
277 3300048908 Ga0496105_0035869 Ga0496105_0035869_213_1040 275
278 3300048916 Ga0496113_0120970 Ga0496113_0120970_1129_1956 275
279 3300048917 Ga0496114_0660671 Ga0496114_0660671_65_892 275
280 3300048920 Ga0496117_0114110 Ga0496117_0114110_662_1489 275
281 3300048922 Ga0496119_0089398 Ga0496119_0089398_701_1528 275
282 3300048924 Ga0496121_0023327 Ga0496121_0023327_4691_5518 275
283 3300048924 Ga0496121_0035596 Ga0496121_0035596_1764_2591 275
284 3300048927 Ga0496124_0112195 Ga0496124_0112195_459_1286 275
285 3300050491 nmdc:mga00v17_78310_c1 nmdc:mga00v17_78310_c1_120_947 275
286 3300053091 Ga0500647_0077338 Ga0500647_0077338_754_1581 275
287 3300053105 Ga0500557_000002 Ga0500557_000002_62238_63065 275
288 3300053130 Ga0500642_0000442 Ga0500642_0000442_10534_11361 275
289 3300053729 Ga0500625_005791 Ga0500625_005791_4056_4883 275
290 iso_pu_bacteria 2935959822 2935959993 275

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ita-assembly3.cif.gz_C crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in acyl-enzyme complex with ampicillin 0.754 185 204
6nzd-assembly1.cif.gz_D cryo-em structure of the lysosomal folliculin complex (flcn-fnip2-raga-ragc-ragulator) 0.7388 184 202
5cxw-assembly1.cif.gz_A structure of the pona1 protein from mycobacterium tuberculosis in complex with penicillin v 0.7054 166 202
7yh1-assembly2.cif.gz_C roadblock from candidatus prometheoarchaeum syntrophicum strain mk-d1 0.7019 184 206
1cf0-assembly1.cif.gz_A human platelet profilin complexed with an l-pro10-iodotyrosine peptide 0.7019 167 206
ID Description Score Start End Superfamily
af_Q9VJ18_1_97_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7905 184 203 3.30.450.30
af_Q4D2K4_12_131_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.758 184 202 3.30.450.30
af_Q57759_3_97_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7209 184 202 3.30.450.30
af_D3ZX21_1026_1126_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.7188 165 203 3.30.310.10
5cxwA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7054 166 202 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A160UI26-F1-model_v4 deleted 0.9542 13 275
AF-A0A529W9E0-F1-model_v4 Uncharacterized protein 0.9276 13 202
AF-A0A160UI26-F1-model_v4 deleted 0.9268 13 275
AF-A0A0S6UWH8-F1-model_v4 Uncharacterized protein 0.9231 60 275
AF-A0A0S6UWH8-F1-model_v4 Uncharacterized protein 0.9149 60 275

Feature Viewer

pLDDT pTM Quality
87.79 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map