F389922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 244 | 155 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0007932|Ga0466967_0007932_4458_5273 |
| Length | 264 |
| Sequence | MRSIVLLGLLALATSAHAASSEQHYLDLRDRYIAKFAKAKESDETSRQHDAALNELARVLRGLIGPVTIKGLPAEGKSNVDTLFRDDIGFGHLDGLGFATDGDKQQLLKHWLREHGKDGMPQEVDAAFRSDRFYYQAIQDAAFAKYAELPITKPVSVSAAVAVLGVRGNGDLKGPPHEIDVVAIQGEKVYFLAVTEAVKTAEIPACEKIWKQMMARKMPEDAMAREDQAMTAYTKCFAKEAPSQSWFAAATRKAQSQLEQLPLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 13 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 14 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 15 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 16 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 17 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 18 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 19 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 20 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 21 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 22 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 23 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 24 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 25 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 26 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 27 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 28 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 29 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 30 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 31 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 32 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 33 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 34 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 35 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 36 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 37 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 38 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 39 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 40 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 41 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 42 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 43 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 44 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 45 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 46 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 47 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 48 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 49 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 50 | 2922368715 | |||
| 51 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 52 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 53 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 54 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 55 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 56 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 57 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 58 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 59 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 60 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 61 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 62 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 63 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 64 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 65 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 66 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 67 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 68 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 69 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 70 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 71 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 72 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 73 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 74 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 75 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 76 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 77 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 78 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 79 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 80 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 81 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 82 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 83 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 84 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 85 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 86 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 87 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 88 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 89 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 90 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 91 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 92 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 93 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 94 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 95 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 96 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 97 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 98 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 99 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 100 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 101 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 102 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 103 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 104 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 105 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 106 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 107 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 108 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 109 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 110 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 111 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 112 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 113 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 114 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 115 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 116 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 117 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 120 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 121 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 125 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 126 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 161 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 200 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 201 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 203 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 204 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 206 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 207 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 208 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 209 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 210 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 211 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 212 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 213 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 215 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 219 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 220 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 221 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 222 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 223 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 224 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 225 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 226 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 227 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 228 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 229 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 230 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 231 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 232 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 233 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 234 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 235 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 236 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 237 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 238 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 239 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 240 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 241 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 242 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 243 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 244 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.63 |
| Metatranscriptomes | 0 |
| Isolates | 46.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.76 |
| Nodule | 37.59 |
| Rhizoplane | 1.72 |
| Rhizosphere | 23.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000430 | 3300003215 | Bacteria | 27183 |
| 2 | JGI25153J46596_10000458 | 3300003215 | Bacteria | 26109 |
| 3 | JGI25153J46596_10034173 | 3300003215 | Bacteria | 1666 |
| 4 | rootH2_10048625 | 3300003320 | Bacteria | 2963 |
| 5 | JGI25160J50197_1000506 | 3300003354 | Bacteria | 23179 |
| 6 | Ga0055543_1016542 | 3300004625 | Bacteria | 1402 |
| 7 | Ga0065165_1000435 | 3300005262 | Bacteria | 65756 |
| 8 | Ga0065165_1005208 | 3300005262 | Bacteria | 7478 |
| 9 | Ga0065165_1009375 | 3300005262 | Bacteria | 4400 |
| 10 | Ga0068867_100598510 | 3300005459 | Bacteria | 961 |
| 11 | Ga0070665_100060431 | 3300005548 | Bacteria | 3798 |
| 12 | Ga0070665_100681101 | 3300005548 | Bacteria | 1041 |
| 13 | Ga0068857_100405061 | 3300005577 | Bacteria | 1270 |
| 14 | Ga0068854_100126659 | 3300005578 | Bacteria | 1946 |
| 15 | Ga0068856_100397554 | 3300005614 | Bacteria | 1398 |
| 16 | Ga0068852_100003079 | 3300005616 | Bacteria | 11608 |
| 17 | Ga0068852_100112201 | 3300005616 | Bacteria | 2480 |
| 18 | Ga0068861_100562032 | 3300005719 | Bacteria | 1041 |
| 19 | Ga0068858_100282131 | 3300005842 | Bacteria | 1582 |
| 20 | Ga0075365_10033115 | 3300006038 | Bacteria | 3327 |
| 21 | Ga0075365_10098736 | 3300006038 | Bacteria | 1998 |
| 22 | Ga0075365_10193050 | 3300006038 | Bacteria | 1425 |
| 23 | Ga0075364_10197375 | 3300006051 | Bacteria | 1364 |
| 24 | Ga0075369_10118981 | 3300006186 | Bacteria | 1195 |
| 25 | Ga0075369_10140082 | 3300006186 | Bacteria | 1102 |
| 26 | Ga0075370_10150189 | 3300006353 | Bacteria | 1365 |
| 27 | Ga0105240_10002091 | 3300009093 | Bacteria | 32664 |
| 28 | Ga0105245_10052051 | 3300009098 | Bacteria | 3671 |
| 29 | Ga0105241_10007422 | 3300009174 | Bacteria | 8070 |
| 30 | Ga0105241_10189568 | 3300009174 | Bacteria | 1711 |
| 31 | Ga0105237_10001252 | 3300009545 | Bacteria | 33910 |
| 32 | Ga0105237_10528565 | 3300009545 | Bacteria | 1186 |
| 33 | Ga0105239_10012384 | 3300010375 | Bacteria | 9497 |
| 34 | Ga0105239_10029945 | 3300010375 | Bacteria | 5987 |
| 35 | Ga0105239_10534753 | 3300010375 | Bacteria | 1334 |
| 36 | Ga0105239_10676479 | 3300010375 | Bacteria | 1179 |
| 37 | Ga0163162_10348016 | 3300013306 | Bacteria | 1615 |
| 38 | Ga0209563_101627 | 3300025230 | Bacteria | 5796 |
| 39 | Ga0209677_106555 | 3300025253 | Bacteria | 2727 |
| 40 | Ga0209148_1000274 | 3300025254 | Bacteria | 81201 |
| 41 | Ga0209233_1024152 | 3300025261 | Bacteria | 1525 |
| 42 | Ga0209455_1012727 | 3300025272 | Bacteria | 1995 |
| 43 | Ga0209673_1016004 | 3300025273 | Bacteria | 2822 |
| 44 | Ga0209564_1006601 | 3300025295 | Bacteria | 6213 |
| 45 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 46 | Ga0209758_1000211 | 3300025297 | Bacteria | 127721 |
| 47 | Ga0209758_1002291 | 3300025297 | Bacteria | 19796 |
| 48 | Ga0209758_1003094 | 3300025297 | Bacteria | 15758 |
| 49 | Ga0209256_1003447 | 3300025299 | Bacteria | 11078 |
| 50 | Ga0209256_1014828 | 3300025299 | Bacteria | 2770 |
| 51 | Ga0207426_1000143 | 3300025302 | Bacteria | 192948 |
| 52 | Ga0207426_1001149 | 3300025302 | Bacteria | 23849 |
| 53 | Ga0207426_1038630 | 3300025302 | Bacteria | 1502 |
| 54 | Ga0209051_1070236 | 3300025303 | Bacteria | 1057 |
| 55 | Ga0209257_1000883 | 3300025304 | Bacteria | 42345 |
| 56 | Ga0209257_1004984 | 3300025304 | Bacteria | 9705 |
| 57 | Ga0209257_1033340 | 3300025304 | Bacteria | 1620 |
| 58 | Ga0207647_10001924 | 3300025904 | Bacteria | 15879 |
| 59 | Ga0207654_10074893 | 3300025911 | Bacteria | 2021 |
| 60 | Ga0207654_10110791 | 3300025911 | Bacteria | 1708 |
| 61 | Ga0207654_10135992 | 3300025911 | Bacteria | 1561 |
| 62 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 63 | Ga0207671_10005048 | 3300025914 | Bacteria | 12327 |
| 64 | Ga0207671_10222686 | 3300025914 | Bacteria | 1478 |
| 65 | Ga0207657_10250571 | 3300025919 | Bacteria | 1412 |
| 66 | Ga0207657_10421958 | 3300025919 | Bacteria | 1048 |
| 67 | Ga0207644_10136860 | 3300025931 | Bacteria | 1882 |
| 68 | Ga0207658_10588568 | 3300025986 | Bacteria | 999 |
| 69 | Ga0207678_10020261 | 3300026067 | Bacteria | 5836 |
| 70 | Ga0207702_10243009 | 3300026078 | Bacteria | 1687 |
| 71 | Ga0207702_10339398 | 3300026078 | Bacteria | 1435 |
| 72 | Ga0207698_10064393 | 3300026142 | Bacteria | 2873 |
| 73 | Ga0268266_10096161 | 3300028379 | Bacteria | 2602 |
| 74 | Ga0307510_10007907 | 3300033180 | Bacteria | 12664 |
| 75 | Ga0307510_10248743 | 3300033180 | Bacteria | 1267 |
| 76 | Ga0307510_10271844 | 3300033180 | Bacteria | 1170 |
| 77 | Ga0395905_0004820 | 3300037471 | Bacteria | 13919 |
| 78 | Ga0395905_0078991 | 3300037471 | Bacteria | 3083 |
| 79 | Ga0466972_0000188 | 3300044658 | Bacteria | 47766 |
| 80 | Ga0466972_0138915 | 3300044658 | Bacteria | 1143 |
| 81 | Ga0466965_0032044 | 3300044683 | Bacteria | 2567 |
| 82 | Ga0466960_0017610 | 3300044901 | Bacteria | 3118 |
| 83 | Ga0466959_0097591 | 3300045049 | Bacteria | 2106 |
| 84 | Ga0466967_0007932 | 3300045976 | Bacteria | 7723 |
| 85 | Ga0495592_0151011 | 3300046454 | Bacteria | 1607 |
| 86 | Ga0495629_0002886 | 3300046459 | Bacteria | 13130 |
| 87 | Ga0495638_0002662 | 3300046460 | Bacteria | 14381 |
| 88 | Ga0495651_0010856 | 3300046462 | Bacteria | 7004 |
| 89 | Ga0495664_0252167 | 3300046477 | Bacteria | 1067 |
| 90 | Ga0495648_0091005 | 3300046524 | Bacteria | 1708 |
| 91 | Ga0495652_0098654 | 3300046529 | Bacteria | 2374 |
| 92 | Ga0495640_0017481 | 3300046533 | Bacteria | 5345 |
| 93 | Ga0495640_0020351 | 3300046533 | Bacteria | 4886 |
| 94 | Ga0495645_0372558 | 3300046543 | Bacteria | 915 |
| 95 | Ga0495622_0080969 | 3300046557 | Bacteria | 1494 |
| 96 | Ga0495667_0018851 | 3300046559 | Bacteria | 4660 |
| 97 | Ga0495634_0295246 | 3300046642 | Bacteria | 981 |
| 98 | Ga0495635_0021637 | 3300046663 | Bacteria | 4483 |
| 99 | Ga0495623_0020681 | 3300046679 | Bacteria | 4254 |
| 100 | Ga0495624_0208645 | 3300046690 | Bacteria | 1185 |
| 101 | Ga0495600_0004580 | 3300046809 | Bacteria | 8292 |
| 102 | Ga0495604_0006635 | 3300047317 | Bacteria | 9172 |
| 103 | Ga0495604_0036857 | 3300047317 | Bacteria | 3854 |
| 104 | Ga0495602_0022693 | 3300048088 | Bacteria | 6138 |
| 105 | Ga0495602_0266619 | 3300048088 | Bacteria | 1268 |
| 106 | Ga0496105_0035869 | 3300048908 | Bacteria | 4084 |
| 107 | Ga0496108_0048872 | 3300048911 | Bacteria | 3538 |
| 108 | Ga0496113_0120970 | 3300048916 | Bacteria | 2047 |
| 109 | Ga0496113_0240959 | 3300048916 | Bacteria | 1443 |
| 110 | Ga0496114_0660671 | 3300048917 | Bacteria | 919 |
| 111 | Ga0496117_0110950 | 3300048920 | Bacteria | 1709 |
| 112 | Ga0496117_0114110 | 3300048920 | Bacteria | 1676 |
| 113 | Ga0496118_0042430 | 3300048921 | Bacteria | 3589 |
| 114 | Ga0496118_0069615 | 3300048921 | Bacteria | 2547 |
| 115 | Ga0496118_0119424 | 3300048921 | Bacteria | 1724 |
| 116 | Ga0496119_0013728 | 3300048922 | Bacteria | 6419 |
| 117 | Ga0496119_0089398 | 3300048922 | Bacteria | 1754 |
| 118 | Ga0496121_0023327 | 3300048924 | Bacteria | 5964 |
| 119 | Ga0496121_0035596 | 3300048924 | Bacteria | 4457 |
| 120 | Ga0496121_0039324 | 3300048924 | Bacteria | 4171 |
| 121 | Ga0496124_0090041 | 3300048927 | Bacteria | 2504 |
| 122 | Ga0496124_0112195 | 3300048927 | Bacteria | 2193 |
| 123 | Ga0496125_0269383 | 3300048928 | Bacteria | 1062 |
| 124 | Ga0496126_0018515 | 3300048929 | Bacteria | 6896 |
| 125 | nmdc:mga00v17_78310_c1 | 3300050491 | Bacteria | 2059 |
| 126 | nmdc:mga0yw44_147451_c1 | 3300050492 | Bacteria | 1533 |
| 127 | nmdc:mga0yw44_288586_c1 | 3300050492 | Bacteria | 1098 |
| 128 | nmdc:mga0k408_11796_c1 | 3300050493 | Bacteria | 4768 |
| 129 | nmdc:mga06z11_193835_c1 | 3300050494 | Bacteria | 1177 |
| 130 | nmdc:mga07m45_102734_c1 | 3300050496 | Bacteria | 1642 |
| 131 | nmdc:mga07m45_211783_c1 | 3300050496 | Bacteria | 1127 |
| 132 | Ga0500578_0108784 | 3300053086 | Bacteria | 1749 |
| 133 | Ga0500578_0125345 | 3300053086 | Bacteria | 1613 |
| 134 | Ga0500643_000085 | 3300053087 | Bacteria | 98026 |
| 135 | Ga0500644_0055354 | 3300053088 | Bacteria | 1377 |
| 136 | Ga0500647_0077338 | 3300053091 | Bacteria | 1596 |
| 137 | Ga0500651_0074442 | 3300053093 | Bacteria | 2110 |
| 138 | Ga0500566_0042807 | 3300053094 | Bacteria | 2611 |
| 139 | Ga0500640_100822 | 3300053095 | Bacteria | 1193 |
| 140 | Ga0500555_016674 | 3300053103 | Bacteria | 2117 |
| 141 | Ga0500556_0063029 | 3300053104 | Bacteria | 1369 |
| 142 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 143 | Ga0500595_005511 | 3300053119 | Bacteria | 5521 |
| 144 | Ga0500595_047040 | 3300053119 | Bacteria | 1354 |
| 145 | Ga0500608_093615 | 3300053122 | Bacteria | 1401 |
| 146 | Ga0500642_0000442 | 3300053130 | Bacteria | 13325 |
| 147 | Ga0500655_016019 | 3300053133 | Bacteria | 1378 |
| 148 | Ga0500658_0008183 | 3300053134 | Bacteria | 3864 |
| 149 | Ga0500588_0078957 | 3300053146 | Bacteria | 1097 |
| 150 | Ga0500590_125777 | 3300053148 | Bacteria | 1194 |
| 151 | Ga0500616_0017483 | 3300053153 | Bacteria | 4067 |
| 152 | Ga0500636_0000103 | 3300053177 | Bacteria | 43319 |
| 153 | Ga0500625_005791 | 3300053729 | Bacteria | 5203 |
| 154 | Ga0500599_016776 | 3300053736 | Bacteria | 1013 |
| 155 | Ga0500601_000173 | 3300053737 | Bacteria | 13368 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0269383 | Ga0496125_0269383_264_1040 | 258 |
| 2 | 3300046460 | Ga0495638_0002662 | Ga0495638_0002662_11102_11890 | 262 |
| 3 | 3300053133 | Ga0500655_016019 | Ga0500655_016019_502_1290 | 262 |
| 4 | 3300045976 | Ga0466967_0007932 | Ga0466967_0007932_4458_5273 | 264 |
| 5 | 3300003320 | rootH2_10048625 | rootH2_100486252 | 265 |
| 6 | 3300046543 | Ga0495645_0372558 | Ga0495645_0372558_10_810 | 266 |
| 7 | 3300048921 | Ga0496118_0042430 | Ga0496118_0042430_2330_3130 | 266 |
| 8 | 3300050492 | nmdc:mga0yw44_147451_c1 | nmdc:mga0yw44_147451_c1_453_1253 | 266 |
| 9 | iso_pu_bacteria | 2513237094 | 2513641999 | 267 |
| 10 | iso_pu_bacteria | 2513237102 | 2513703680 | 267 |
| 11 | iso_pu_bacteria | 2517093001 | 2517101579 | 267 |
| 12 | iso_pu_bacteria | 2528768022 | 2528849726 | 267 |
| 13 | iso_pu_bacteria | 2791355196 | 2793065887 | 267 |
| 14 | iso_pu_bacteria | 2824617872 | 2824623359 | 267 |
| 15 | iso_pu_bacteria | 2824626560 | 2824632287 | 267 |
| 16 | iso_pu_bacteria | 2824635225 | 2824639017 | 267 |
| 17 | iso_pu_bacteria | 2824644064 | 2824648161 | 267 |
| 18 | iso_pu_bacteria | 2824661429 | 2824665643 | 267 |
| 19 | iso_pu_bacteria | 2824704595 | 2824708787 | 267 |
| 20 | iso_pu_bacteria | 2824714736 | 2824718775 | 267 |
| 21 | iso_pu_bacteria | 2824723954 | 2824725803 | 267 |
| 22 | iso_pu_bacteria | 2824753945 | 2824757166 | 267 |
| 23 | iso_pu_bacteria | 2824763712 | 2824766764 | 267 |
| 24 | iso_pu_bacteria | 2841957949 | 2841958352 | 267 |
| 25 | iso_pu_bacteria | 2842038055 | 2842039385 | 267 |
| 26 | iso_pu_bacteria | 2842045827 | 2842047669 | 267 |
| 27 | iso_pu_bacteria | 2844315083 | 2844318786 | 267 |
| 28 | iso_pu_bacteria | 2857509624 | 2857513961 | 267 |
| 29 | iso_pu_bacteria | 2874620515 | 2874627436 | 267 |
| 30 | iso_pu_bacteria | 2874628541 | 2874629813 | 267 |
| 31 | iso_pu_bacteria | 2879099564 | 2879103865 | 267 |
| 32 | iso_pu_bacteria | 2881364244 | 2881371731 | 267 |
| 33 | iso_pu_bacteria | 2903727486 | 2903728910 | 267 |
| 34 | iso_pu_bacteria | 2904666416 | 2904671046 | 267 |
| 35 | iso_pu_bacteria | 2904711408 | 2904720883 | 267 |
| 36 | iso_pu_bacteria | 2906602504 | 2906604386 | 267 |
| 37 | iso_pu_bacteria | 2922368715 | 2922373973 | 267 |
| 38 | iso_pu_bacteria | 2932784394 | 2932788514 | 267 |
| 39 | iso_pu_bacteria | 2932794094 | 2932798569 | 267 |
| 40 | iso_pu_bacteria | 2932801729 | 2932803122 | 267 |
| 41 | iso_pu_bacteria | 2932809354 | 2932816342 | 267 |
| 42 | iso_pu_bacteria | 2932818245 | 2932821512 | 267 |
| 43 | iso_pu_bacteria | 2932828146 | 2932831597 | 267 |
| 44 | iso_pu_bacteria | 2935616580 | 2935622357 | 267 |
| 45 | iso_pu_bacteria | 2935638405 | 2935645215 | 267 |
| 46 | iso_pu_bacteria | 2935665750 | 2935671757 | 267 |
| 47 | iso_pu_bacteria | 2935675223 | 2935678840 | 267 |
| 48 | iso_pu_bacteria | 2935684952 | 2935688838 | 267 |
| 49 | iso_pu_bacteria | 2935694250 | 2935696213 | 267 |
| 50 | iso_pu_bacteria | 2935703347 | 2935706958 | 267 |
| 51 | iso_pu_bacteria | 2935713505 | 2935715857 | 267 |
| 52 | iso_pu_bacteria | 2935722832 | 2935725579 | 267 |
| 53 | iso_pu_bacteria | 2935732158 | 2935738142 | 267 |
| 54 | iso_pu_bacteria | 2935741537 | 2935747517 | 267 |
| 55 | iso_pu_bacteria | 2935750917 | 2935753908 | 267 |
| 56 | iso_pu_bacteria | 2935760218 | 2935762913 | 267 |
| 57 | iso_pu_bacteria | 2935801545 | 2935807694 | 267 |
| 58 | iso_pu_bacteria | 2935810662 | 2935817038 | 267 |
| 59 | iso_pu_bacteria | 2935827899 | 2935834682 | 267 |
| 60 | iso_pu_bacteria | 2935837841 | 2935840364 | 267 |
| 61 | iso_pu_bacteria | 2935855204 | 2935860575 | 267 |
| 62 | iso_pu_bacteria | 2935864058 | 2935865387 | 267 |
| 63 | iso_pu_bacteria | 2935873716 | 2935877983 | 267 |
| 64 | iso_pu_bacteria | 2935883170 | 2935885461 | 267 |
| 65 | iso_pu_bacteria | 2935992306 | 2935996068 | 267 |
| 66 | iso_pu_bacteria | 2936002035 | 2936006202 | 267 |
| 67 | iso_pu_bacteria | 2936037263 | 2936043417 | 267 |
| 68 | iso_pu_bacteria | 2940556831 | 2940560716 | 267 |
| 69 | iso_pu_bacteria | 2941531003 | 2941537680 | 267 |
| 70 | iso_pu_bacteria | 2941538514 | 2941541505 | 267 |
| 71 | iso_pu_bacteria | 3005594810 | 3005598935 | 267 |
| 72 | iso_pu_bacteria | 3005710791 | 3005714514 | 267 |
| 73 | iso_pu_bacteria | 3005718088 | 3005722031 | 267 |
| 74 | iso_pu_bacteria | 8016511872 | 8016513675 | 267 |
| 75 | iso_pu_bacteria | 8017057580 | 8017062771 | 267 |
| 76 | iso_pu_bacteria | 8019576017 | 8019582206 | 267 |
| 77 | iso_pu_bacteria | 8019586578 | 8019589897 | 267 |
| 78 | iso_pu_bacteria | 8019597564 | 8019601372 | 267 |
| 79 | iso_pu_bacteria | 8019608314 | 8019617181 | 267 |
| 80 | iso_pu_bacteria | 8019648815 | 8019658046 | 267 |
| 81 | iso_pu_bacteria | 8056967851 | 8056973150 | 267 |
| 82 | 3300053122 | Ga0500608_093615 | Ga0500608_093615_468_1277 | 269 |
| 83 | 3300044658 | Ga0466972_0000188 | Ga0466972_0000188_28541_29353 | 270 |
| 84 | 3300044683 | Ga0466965_0032044 | Ga0466965_0032044_860_1672 | 270 |
| 85 | 3300003215 | JGI25153J46596_10000458 | JGI25153J46596_1000045825 | 271 |
| 86 | 3300003354 | JGI25160J50197_1000506 | JGI25160J50197_10005063 | 271 |
| 87 | 3300005262 | Ga0065165_1005208 | Ga0065165_10052085 | 271 |
| 88 | 3300005262 | Ga0065165_1009375 | Ga0065165_10093753 | 271 |
| 89 | 3300005459 | Ga0068867_100598510 | Ga0068867_1005985101 | 271 |
| 90 | 3300005548 | Ga0070665_100060431 | Ga0070665_1000604312 | 271 |
| 91 | 3300005548 | Ga0070665_100681101 | Ga0070665_1006811011 | 271 |
| 92 | 3300005577 | Ga0068857_100405061 | Ga0068857_1004050612 | 271 |
| 93 | 3300005578 | Ga0068854_100126659 | Ga0068854_1001266592 | 271 |
| 94 | 3300005614 | Ga0068856_100397554 | Ga0068856_1003975541 | 271 |
| 95 | 3300005616 | Ga0068852_100003079 | Ga0068852_1000030797 | 271 |
| 96 | 3300005616 | Ga0068852_100112201 | Ga0068852_1001122012 | 271 |
| 97 | 3300006038 | Ga0075365_10098736 | Ga0075365_100987362 | 271 |
| 98 | 3300006038 | Ga0075365_10193050 | Ga0075365_101930502 | 271 |
| 99 | 3300006051 | Ga0075364_10197375 | Ga0075364_101973751 | 271 |
| 100 | 3300006186 | Ga0075369_10118981 | Ga0075369_101189811 | 271 |
| 101 | 3300006186 | Ga0075369_10140082 | Ga0075369_101400821 | 271 |
| 102 | 3300006353 | Ga0075370_10150189 | Ga0075370_101501892 | 271 |
| 103 | 3300009093 | Ga0105240_10002091 | Ga0105240_1000209129 | 271 |
| 104 | 3300009098 | Ga0105245_10052051 | Ga0105245_100520512 | 271 |
| 105 | 3300009174 | Ga0105241_10007422 | Ga0105241_100074224 | 271 |
| 106 | 3300009174 | Ga0105241_10189568 | Ga0105241_101895682 | 271 |
| 107 | 3300009545 | Ga0105237_10001252 | Ga0105237_1000125219 | 271 |
| 108 | 3300009545 | Ga0105237_10528565 | Ga0105237_105285651 | 271 |
| 109 | 3300010375 | Ga0105239_10012384 | Ga0105239_100123843 | 271 |
| 110 | 3300010375 | Ga0105239_10029945 | Ga0105239_100299455 | 271 |
| 111 | 3300010375 | Ga0105239_10534753 | Ga0105239_105347531 | 271 |
| 112 | 3300010375 | Ga0105239_10676479 | Ga0105239_106764791 | 271 |
| 113 | 3300013306 | Ga0163162_10348016 | Ga0163162_103480162 | 271 |
| 114 | 3300025254 | Ga0209148_1000274 | Ga0209148_100027421 | 271 |
| 115 | 3300025272 | Ga0209455_1012727 | Ga0209455_10127272 | 271 |
| 116 | 3300025273 | Ga0209673_1016004 | Ga0209673_10160042 | 271 |
| 117 | 3300025295 | Ga0209564_1006601 | Ga0209564_10066016 | 271 |
| 118 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021366 | 271 |
| 119 | 3300025297 | Ga0209758_1003094 | Ga0209758_10030948 | 271 |
| 120 | 3300025299 | Ga0209256_1003447 | Ga0209256_10034476 | 271 |
| 121 | 3300025299 | Ga0209256_1014828 | Ga0209256_10148282 | 271 |
| 122 | 3300025302 | Ga0207426_1000143 | Ga0207426_1000143144 | 271 |
| 123 | 3300025302 | Ga0207426_1001149 | Ga0207426_10011492 | 271 |
| 124 | 3300025302 | Ga0207426_1038630 | Ga0207426_10386302 | 271 |
| 125 | 3300025303 | Ga0209051_1070236 | Ga0209051_10702361 | 271 |
| 126 | 3300025304 | Ga0209257_1000883 | Ga0209257_100088320 | 271 |
| 127 | 3300025304 | Ga0209257_1033340 | Ga0209257_10333402 | 271 |
| 128 | 3300025911 | Ga0207654_10074893 | Ga0207654_100748932 | 271 |
| 129 | 3300025911 | Ga0207654_10110791 | Ga0207654_101107912 | 271 |
| 130 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015431 | 271 |
| 131 | 3300025914 | Ga0207671_10005048 | Ga0207671_100050482 | 271 |
| 132 | 3300025914 | Ga0207671_10222686 | Ga0207671_102226862 | 271 |
| 133 | 3300025931 | Ga0207644_10136860 | Ga0207644_101368602 | 271 |
| 134 | 3300025986 | Ga0207658_10588568 | Ga0207658_105885682 | 271 |
| 135 | 3300026067 | Ga0207678_10020261 | Ga0207678_100202613 | 271 |
| 136 | 3300026078 | Ga0207702_10243009 | Ga0207702_102430092 | 271 |
| 137 | 3300026142 | Ga0207698_10064393 | Ga0207698_100643932 | 271 |
| 138 | 3300028379 | Ga0268266_10096161 | Ga0268266_100961614 | 271 |
| 139 | 3300033180 | Ga0307510_10007907 | Ga0307510_1000790711 | 271 |
| 140 | 3300033180 | Ga0307510_10248743 | Ga0307510_102487432 | 271 |
| 141 | 3300033180 | Ga0307510_10271844 | Ga0307510_102718441 | 271 |
| 142 | 3300037471 | Ga0395905_0004820 | Ga0395905_0004820_13035_13850 | 271 |
| 143 | 3300037471 | Ga0395905_0078991 | Ga0395905_0078991_2122_2937 | 271 |
| 144 | 3300044658 | Ga0466972_0138915 | Ga0466972_0138915_70_885 | 271 |
| 145 | 3300044901 | Ga0466960_0017610 | Ga0466960_0017610_214_1029 | 271 |
| 146 | 3300045049 | Ga0466959_0097591 | Ga0466959_0097591_410_1225 | 271 |
| 147 | 3300046454 | Ga0495592_0151011 | Ga0495592_0151011_511_1326 | 271 |
| 148 | 3300046459 | Ga0495629_0002886 | Ga0495629_0002886_7886_8812 | 271 |
| 149 | 3300046462 | Ga0495651_0010856 | Ga0495651_0010856_4889_5812 | 271 |
| 150 | 3300046477 | Ga0495664_0252167 | Ga0495664_0252167_230_1045 | 271 |
| 151 | 3300046524 | Ga0495648_0091005 | Ga0495648_0091005_192_1007 | 271 |
| 152 | 3300046529 | Ga0495652_0098654 | Ga0495652_0098654_1317_2243 | 271 |
| 153 | 3300046533 | Ga0495640_0017481 | Ga0495640_0017481_619_1542 | 271 |
| 154 | 3300046533 | Ga0495640_0020351 | Ga0495640_0020351_3876_4802 | 271 |
| 155 | 3300046557 | Ga0495622_0080969 | Ga0495622_0080969_360_1175 | 271 |
| 156 | 3300046559 | Ga0495667_0018851 | Ga0495667_0018851_3707_4630 | 271 |
| 157 | 3300046642 | Ga0495634_0295246 | Ga0495634_0295246_38_961 | 271 |
| 158 | 3300046663 | Ga0495635_0021637 | Ga0495635_0021637_631_1557 | 271 |
| 159 | 3300046679 | Ga0495623_0020681 | Ga0495623_0020681_1903_2826 | 271 |
| 160 | 3300046690 | Ga0495624_0208645 | Ga0495624_0208645_135_1061 | 271 |
| 161 | 3300046809 | Ga0495600_0004580 | Ga0495600_0004580_3258_4184 | 271 |
| 162 | 3300047317 | Ga0495604_0006635 | Ga0495604_0006635_3671_4594 | 271 |
| 163 | 3300047317 | Ga0495604_0036857 | Ga0495604_0036857_2594_3520 | 271 |
| 164 | 3300048088 | Ga0495602_0022693 | Ga0495602_0022693_4364_5287 | 271 |
| 165 | 3300048088 | Ga0495602_0266619 | Ga0495602_0266619_234_1160 | 271 |
| 166 | 3300048911 | Ga0496108_0048872 | Ga0496108_0048872_953_1768 | 271 |
| 167 | 3300048916 | Ga0496113_0240959 | Ga0496113_0240959_400_1215 | 271 |
| 168 | 3300048920 | Ga0496117_0110950 | Ga0496117_0110950_217_1032 | 271 |
| 169 | 3300048921 | Ga0496118_0069615 | Ga0496118_0069615_62_988 | 271 |
| 170 | 3300048921 | Ga0496118_0119424 | Ga0496118_0119424_803_1618 | 271 |
| 171 | 3300048922 | Ga0496119_0013728 | Ga0496119_0013728_3061_3987 | 271 |
| 172 | 3300048924 | Ga0496121_0039324 | Ga0496121_0039324_649_1464 | 271 |
| 173 | 3300048927 | Ga0496124_0090041 | Ga0496124_0090041_697_1623 | 271 |
| 174 | 3300048929 | Ga0496126_0018515 | Ga0496126_0018515_3088_4014 | 271 |
| 175 | 3300050492 | nmdc:mga0yw44_288586_c1 | nmdc:mga0yw44_288586_c1_27_842 | 271 |
| 176 | 3300050493 | nmdc:mga0k408_11796_c1 | nmdc:mga0k408_11796_c1_738_1553 | 271 |
| 177 | 3300050494 | nmdc:mga06z11_193835_c1 | nmdc:mga06z11_193835_c1_35_850 | 271 |
| 178 | 3300050496 | nmdc:mga07m45_102734_c1 | nmdc:mga07m45_102734_c1_558_1373 | 271 |
| 179 | 3300050496 | nmdc:mga07m45_211783_c1 | nmdc:mga07m45_211783_c1_242_1057 | 271 |
| 180 | 3300053086 | Ga0500578_0108784 | Ga0500578_0108784_691_1506 | 271 |
| 181 | 3300053086 | Ga0500578_0125345 | Ga0500578_0125345_613_1539 | 271 |
| 182 | 3300053087 | Ga0500643_000085 | Ga0500643_000085_44927_45742 | 271 |
| 183 | 3300053088 | Ga0500644_0055354 | Ga0500644_0055354_130_945 | 271 |
| 184 | 3300053093 | Ga0500651_0074442 | Ga0500651_0074442_527_1342 | 271 |
| 185 | 3300053094 | Ga0500566_0042807 | Ga0500566_0042807_1221_2036 | 271 |
| 186 | 3300053095 | Ga0500640_100822 | Ga0500640_100822_190_1005 | 271 |
| 187 | 3300053103 | Ga0500555_016674 | Ga0500555_016674_1234_2049 | 271 |
| 188 | 3300053104 | Ga0500556_0063029 | Ga0500556_0063029_469_1284 | 271 |
| 189 | 3300053119 | Ga0500595_005511 | Ga0500595_005511_1248_2174 | 271 |
| 190 | 3300053119 | Ga0500595_047040 | Ga0500595_047040_310_1125 | 271 |
| 191 | 3300053134 | Ga0500658_0008183 | Ga0500658_0008183_980_1795 | 271 |
| 192 | 3300053146 | Ga0500588_0078957 | Ga0500588_0078957_217_1032 | 271 |
| 193 | 3300053148 | Ga0500590_125777 | Ga0500590_125777_54_980 | 271 |
| 194 | 3300053153 | Ga0500616_0017483 | Ga0500616_0017483_2516_3331 | 271 |
| 195 | 3300053177 | Ga0500636_0000103 | Ga0500636_0000103_19807_20622 | 271 |
| 196 | 3300053736 | Ga0500599_016776 | Ga0500599_016776_140_955 | 271 |
| 197 | 3300053737 | Ga0500601_000173 | Ga0500601_000173_4055_4870 | 271 |
| 198 | iso_pu_bacteria | 2507262055 | 2507508991 | 271 |
| 199 | iso_pu_bacteria | 2508501009 | 2508543055 | 271 |
| 200 | iso_pu_bacteria | 2508501042 | 2508691216 | 271 |
| 201 | iso_pu_bacteria | 2511231028 | 2511394466 | 271 |
| 202 | iso_pu_bacteria | 2513237095 | 2513650213 | 271 |
| 203 | iso_pu_bacteria | 2513237139 | 2513872461 | 271 |
| 204 | iso_pu_bacteria | 2515154112 | 2515626411 | 271 |
| 205 | iso_pu_bacteria | 2802429603 | 2805917952 | 271 |
| 206 | iso_pu_bacteria | 2816332527 | 2818241263 | 271 |
| 207 | iso_pu_bacteria | 2824696289 | 2824698877 | 271 |
| 208 | iso_pu_bacteria | 2847939898 | 2847946229 | 271 |
| 209 | iso_pu_bacteria | 2849076700 | 2849079616 | 271 |
| 210 | iso_pu_bacteria | 2874590934 | 2874592680 | 271 |
| 211 | iso_pu_bacteria | 2874645413 | 2874648283 | 271 |
| 212 | iso_pu_bacteria | 2876771140 | 2876772893 | 271 |
| 213 | iso_pu_bacteria | 2876818435 | 2876820221 | 271 |
| 214 | iso_pu_bacteria | 2879074833 | 2879076724 | 271 |
| 215 | iso_pu_bacteria | 2879127579 | 2879131665 | 271 |
| 216 | iso_pu_bacteria | 2879142872 | 2879148042 | 271 |
| 217 | iso_pu_bacteria | 2888378607 | 2888383739 | 271 |
| 218 | iso_pu_bacteria | 2888388044 | 2888394143 | 271 |
| 219 | iso_pu_bacteria | 2929615660 | 2929617689 | 271 |
| 220 | iso_pu_bacteria | 2929624759 | 2929627394 | 271 |
| 221 | iso_pu_bacteria | 2933577622 | 2933579645 | 271 |
| 222 | iso_pu_bacteria | 2935608549 | 2935612161 | 271 |
| 223 | iso_pu_bacteria | 2935648319 | 2935649738 | 271 |
| 224 | iso_pu_bacteria | 2935656913 | 2935658747 | 271 |
| 225 | iso_pu_bacteria | 2935769743 | 2935774996 | 271 |
| 226 | iso_pu_bacteria | 2935785616 | 2935791759 | 271 |
| 227 | iso_pu_bacteria | 2935793552 | 2935800009 | 271 |
| 228 | iso_pu_bacteria | 2935819856 | 2935821631 | 271 |
| 229 | iso_pu_bacteria | 2935847175 | 2935847232 | 271 |
| 230 | iso_pu_bacteria | 2935908558 | 2935914664 | 271 |
| 231 | iso_pu_bacteria | 2935916978 | 2935924869 | 271 |
| 232 | iso_pu_bacteria | 2935926038 | 2935932258 | 271 |
| 233 | iso_pu_bacteria | 2935934488 | 2935940856 | 271 |
| 234 | iso_pu_bacteria | 2935942939 | 2935948929 | 271 |
| 235 | iso_pu_bacteria | 2935951376 | 2935957487 | 271 |
| 236 | iso_pu_bacteria | 2935967501 | 2935973934 | 271 |
| 237 | iso_pu_bacteria | 2935975950 | 2935977318 | 271 |
| 238 | iso_pu_bacteria | 2936011229 | 2936012780 | 271 |
| 239 | iso_pu_bacteria | 2936019824 | 2936021344 | 271 |
| 240 | iso_pu_bacteria | 2936028420 | 2936030073 | 271 |
| 241 | iso_pu_bacteria | 2936046547 | 2936047538 | 271 |
| 242 | iso_pu_bacteria | 2936055302 | 2936057304 | 271 |
| 243 | iso_pu_bacteria | 8016530956 | 8016535231 | 271 |
| 244 | iso_pu_bacteria | 8016539877 | 8016548441 | 271 |
| 245 | iso_pu_bacteria | 8016557553 | 8016562068 | 271 |
| 246 | iso_pu_bacteria | 8016566248 | 8016573573 | 271 |
| 247 | iso_pu_bacteria | 8016575299 | 8016577699 | 271 |
| 248 | iso_pu_bacteria | 8016583857 | 8016592256 | 271 |
| 249 | iso_pu_bacteria | 8016595262 | 8016599890 | 271 |
| 250 | iso_pu_bacteria | 8016630954 | 8016640710 | 271 |
| 251 | iso_pu_bacteria | 8019530166 | 8019534982 | 271 |
| 252 | iso_pu_bacteria | 8019619141 | 8019627710 | 271 |
| 253 | iso_pu_bacteria | 8019629233 | 8019634797 | 271 |
| 254 | iso_pu_bacteria | 8019638758 | 8019644905 | 271 |
| 255 | iso_pu_bacteria | 8019668869 | 8019672306 | 271 |
| 256 | iso_pu_bacteria | 8019678201 | 8019683901 | 271 |
| 257 | iso_pu_bacteria | 8019687851 | 8019689643 | 271 |
| 258 | iso_pu_bacteria | 8055742211 | 8055746696 | 271 |
| 259 | 3300003215 | JGI25153J46596_10000430 | JGI25153J46596_1000043015 | 275 |
| 260 | 3300003215 | JGI25153J46596_10034173 | JGI25153J46596_100341731 | 275 |
| 261 | 3300004625 | Ga0055543_1016542 | Ga0055543_10165422 | 275 |
| 262 | 3300005262 | Ga0065165_1000435 | Ga0065165_100043511 | 275 |
| 263 | 3300005719 | Ga0068861_100562032 | Ga0068861_1005620321 | 275 |
| 264 | 3300005842 | Ga0068858_100282131 | Ga0068858_1002821312 | 275 |
| 265 | 3300006038 | Ga0075365_10033115 | Ga0075365_100331152 | 275 |
| 266 | 3300025230 | Ga0209563_101627 | Ga0209563_1016272 | 275 |
| 267 | 3300025253 | Ga0209677_106555 | Ga0209677_1065551 | 275 |
| 268 | 3300025261 | Ga0209233_1024152 | Ga0209233_10241522 | 275 |
| 269 | 3300025297 | Ga0209758_1000211 | Ga0209758_100021170 | 275 |
| 270 | 3300025297 | Ga0209758_1002291 | Ga0209758_10022919 | 275 |
| 271 | 3300025304 | Ga0209257_1004984 | Ga0209257_10049847 | 275 |
| 272 | 3300025904 | Ga0207647_10001924 | Ga0207647_100019246 | 275 |
| 273 | 3300025911 | Ga0207654_10135992 | Ga0207654_101359922 | 275 |
| 274 | 3300025919 | Ga0207657_10250571 | Ga0207657_102505711 | 275 |
| 275 | 3300025919 | Ga0207657_10421958 | Ga0207657_104219582 | 275 |
| 276 | 3300026078 | Ga0207702_10339398 | Ga0207702_103393982 | 275 |
| 277 | 3300048908 | Ga0496105_0035869 | Ga0496105_0035869_213_1040 | 275 |
| 278 | 3300048916 | Ga0496113_0120970 | Ga0496113_0120970_1129_1956 | 275 |
| 279 | 3300048917 | Ga0496114_0660671 | Ga0496114_0660671_65_892 | 275 |
| 280 | 3300048920 | Ga0496117_0114110 | Ga0496117_0114110_662_1489 | 275 |
| 281 | 3300048922 | Ga0496119_0089398 | Ga0496119_0089398_701_1528 | 275 |
| 282 | 3300048924 | Ga0496121_0023327 | Ga0496121_0023327_4691_5518 | 275 |
| 283 | 3300048924 | Ga0496121_0035596 | Ga0496121_0035596_1764_2591 | 275 |
| 284 | 3300048927 | Ga0496124_0112195 | Ga0496124_0112195_459_1286 | 275 |
| 285 | 3300050491 | nmdc:mga00v17_78310_c1 | nmdc:mga00v17_78310_c1_120_947 | 275 |
| 286 | 3300053091 | Ga0500647_0077338 | Ga0500647_0077338_754_1581 | 275 |
| 287 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_62238_63065 | 275 |
| 288 | 3300053130 | Ga0500642_0000442 | Ga0500642_0000442_10534_11361 | 275 |
| 289 | 3300053729 | Ga0500625_005791 | Ga0500625_005791_4056_4883 | 275 |
| 290 | iso_pu_bacteria | 2935959822 | 2935959993 | 275 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ita-assembly3.cif.gz_C | crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in acyl-enzyme complex with ampicillin | 0.754 | 185 | 204 |
| 6nzd-assembly1.cif.gz_D | cryo-em structure of the lysosomal folliculin complex (flcn-fnip2-raga-ragc-ragulator) | 0.7388 | 184 | 202 |
| 5cxw-assembly1.cif.gz_A | structure of the pona1 protein from mycobacterium tuberculosis in complex with penicillin v | 0.7054 | 166 | 202 |
| 7yh1-assembly2.cif.gz_C | roadblock from candidatus prometheoarchaeum syntrophicum strain mk-d1 | 0.7019 | 184 | 206 |
| 1cf0-assembly1.cif.gz_A | human platelet profilin complexed with an l-pro10-iodotyrosine peptide | 0.7019 | 167 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VJ18_1_97_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.7905 | 184 | 203 | 3.30.450.30 |
| af_Q4D2K4_12_131_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.758 | 184 | 202 | 3.30.450.30 |
| af_Q57759_3_97_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.7209 | 184 | 202 | 3.30.450.30 |
| af_D3ZX21_1026_1126_3.30.310.10 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein | 0.7188 | 165 | 203 | 3.30.310.10 |
| 5cxwA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.7054 | 166 | 202 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A160UI26-F1-model_v4 | deleted | 0.9542 | 13 | 275 |
|
| AF-A0A529W9E0-F1-model_v4 | Uncharacterized protein | 0.9276 | 13 | 202 |
|
| AF-A0A160UI26-F1-model_v4 | deleted | 0.9268 | 13 | 275 |
|
| AF-A0A0S6UWH8-F1-model_v4 | Uncharacterized protein | 0.9231 | 60 | 275 |
|
| AF-A0A0S6UWH8-F1-model_v4 | Uncharacterized protein | 0.9149 | 60 | 275 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar