F389816

General Info

Members Datasets Scaffolds Average Seq Length
290 161 290 159

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10254746|Ga0207674_102547463
Length 183
Sequence MPHDAIRDHLVRVLDWEEAHVGFDKAIDGIPADKRGMKAPGFEYSAWQLLEHMRLAQDDILDFCTNPNYVHNLKWPDDYWPSATPPSDAAWNESVASFVRAREKVKAVARDVKDLTAPVPTGTATQTYLRAILLVADHTAYHVGQLVFVAKHFAGPNWKSLSIPKGQSKQHVVGAFKQGFVPR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.03
Rhizosphere 98.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10017653 3300005290 Bacteria 1604
2 Ga0065712_10222040 3300005290 Bacteria 1029
3 Ga0065715_10020365 3300005293 Bacteria 2526
4 Ga0065707_10085282 3300005295 Bacteria 6288
5 Ga0065707_10355448 3300005295 Bacteria 912
6 Ga0065707_10903745 3300005295 Bacteria 566
7 Ga0070676_10475247 3300005328 Bacteria 883
8 Ga0070690_100118294 3300005330 Unclassified 1776
9 Ga0070670_100128025 3300005331 Bacteria 2191
10 Ga0070670_100740925 3300005331 Bacteria 885
11 Ga0070670_101578230 3300005331 Unclassified 603
12 Ga0068869_100071342 3300005334 Bacteria 2572
13 Ga0070666_10451138 3300005335 Unclassified 929
14 Ga0070666_10805016 3300005335 Unclassified 692
15 Ga0070682_100215854 3300005337 Bacteria 1362
16 Ga0068868_101314804 3300005338 Unclassified 672
17 Ga0070689_100086100 3300005340 Bacteria 2471
18 Ga0070689_100473840 3300005340 Bacteria 1068
19 Ga0070689_100607565 3300005340 Unclassified 948
20 Ga0070691_10632932 3300005341 Bacteria 635
21 Ga0070668_100052717 3300005347 Bacteria 3136
22 Ga0070668_100125781 3300005347 Bacteria 2053
23 Ga0070669_100225516 3300005353 Bacteria 1483
24 Ga0070675_100013444 3300005354 Bacteria 6434
25 Ga0070675_100029407 3300005354 Bacteria 4432
26 Ga0070675_100107354 3300005354 Unclassified 2357
27 Ga0070675_100135308 3300005354 Bacteria 2103
28 Ga0070671_100068799 3300005355 Bacteria 2953
29 Ga0070674_100122665 3300005356 Unclassified 1926
30 Ga0070674_100322607 3300005356 Bacteria 1239
31 Ga0070674_101219757 3300005356 Unclassified 668
32 Ga0070673_100132015 3300005364 Bacteria 2097
33 Ga0070673_100795462 3300005364 Bacteria 873
34 Ga0070688_100025577 3300005365 Bacteria 3496
35 Ga0070688_100427063 3300005365 Bacteria 986
36 Ga0070705_100053529 3300005440 Unclassified 2363
37 Ga0070694_100221937 3300005444 Bacteria 1418
38 Ga0070694_100894855 3300005444 Unclassified 732
39 Ga0070708_100710333 3300005445 Bacteria 946
40 Ga0070678_100113686 3300005456 Bacteria 2123
41 Ga0070678_100127577 3300005456 Bacteria 2016
42 Ga0070678_100199610 3300005456 Bacteria 1650
43 Ga0070685_10040597 3300005466 Bacteria 2649
44 Ga0070706_100486528 3300005467 Unclassified 1148
45 Ga0070706_100898684 3300005467 Unclassified 818
46 Ga0070707_100227127 3300005468 Unclassified 1818
47 Ga0070698_100426151 3300005471 Unclassified 1261
48 Ga0070699_100003006 3300005518 Bacteria 14986
49 Ga0070684_101846564 3300005535 Unclassified 570
50 Ga0070697_100103126 3300005536 Bacteria 2371
51 Ga0070672_100028569 3300005543 Bacteria 4173
52 Ga0070672_100326489 3300005543 Bacteria 1305
53 Ga0070672_100377357 3300005543 Bacteria 1212
54 Ga0070672_100387663 3300005543 Bacteria 1196
55 Ga0070672_100606205 3300005543 Unclassified 954
56 Ga0070686_100091676 3300005544 Bacteria 2034
57 Ga0070686_100350710 3300005544 Bacteria 1109
58 Ga0070695_100704926 3300005545 Bacteria 801
59 Ga0070695_101294515 3300005545 Unclassified 602
60 Ga0070665_100131781 3300005548 Bacteria 2502
61 Ga0070704_100092059 3300005549 Unclassified 2263
62 Ga0070704_100473643 3300005549 Bacteria 1082
63 Ga0068855_100310968 3300005563 Bacteria 1743
64 Ga0070664_100127068 3300005564 Bacteria 2237
65 Ga0070664_101223973 3300005564 Unclassified 708
66 Ga0068857_100055811 3300005577 Bacteria 3505
67 Ga0068854_101484817 3300005578 Bacteria 615
68 Ga0068859_100128766 3300005617 Unclassified 2602
69 Ga0068859_100653475 3300005617 Bacteria 1143
70 Ga0068859_101788095 3300005617 Unclassified 679
71 Ga0068864_100047813 3300005618 Bacteria 3676
72 Ga0068864_100163523 3300005618 Bacteria 2024
73 Ga0068870_10132635 3300005840 Bacteria 1449
74 Ga0068863_100135455 3300005841 Bacteria 2353
75 Ga0068858_100619170 3300005842 Bacteria 1051
76 Ga0068860_100633937 3300005843 Bacteria 1076
77 Ga0068860_100790722 3300005843 Unclassified 962
78 Ga0068860_100971750 3300005843 Bacteria 867
79 Ga0068860_101205656 3300005843 Unclassified 777
80 Ga0068871_100449633 3300006358 Bacteria 1154
81 Ga0075428_100095026 3300006844 Bacteria 3249
82 Ga0075428_100444998 3300006844 Unclassified 1388
83 Ga0075430_100029161 3300006846 Bacteria 4684
84 Ga0075430_100285510 3300006846 Unclassified 1365
85 Ga0075430_100452595 3300006846 Bacteria 1059
86 Ga0075431_100129754 3300006847 Unclassified 2600
87 Ga0075433_10000202 3300006852 Bacteria 33478
88 Ga0075433_10005660 3300006852 Bacteria 9818
89 Ga0075433_10420892 3300006852 Bacteria 1178
90 Ga0075434_100017450 3300006871 Bacteria 6917
91 Ga0075434_100054139 3300006871 Bacteria 3986
92 Ga0075434_100755583 3300006871 Bacteria 989
93 Ga0075434_100983390 3300006871 Bacteria 858
94 Ga0075434_101722575 3300006871 Unclassified 634
95 Ga0075429_100151664 3300006880 Bacteria 2029
96 Ga0075429_100227112 3300006880 Bacteria 1635
97 Ga0075429_100256912 3300006880 Bacteria 1530
98 Ga0075429_100549831 3300006880 Unclassified 1012
99 Ga0097620_100128764 3300006931 Unclassified 2602
100 Ga0097620_100653503 3300006931 Bacteria 1143
101 Ga0097620_101788183 3300006931 Unclassified 679
102 Ga0075435_100021849 3300007076 Bacteria 4930
103 Ga0111539_10005953 3300009094 Bacteria 15750
104 Ga0111539_10020945 3300009094 Bacteria 8050
105 Ga0111539_10029785 3300009094 Bacteria 6643
106 Ga0111539_10088635 3300009094 Bacteria 3635
107 Ga0111539_10856245 3300009094 Unclassified 1058
108 Ga0111539_11490844 3300009094 Bacteria 784
109 Ga0114129_10018633 3300009147 Bacteria 9882
110 Ga0114129_10019353 3300009147 Bacteria 9696
111 Ga0114129_10054962 3300009147 Bacteria 5581
112 Ga0114129_10074863 3300009147 Bacteria 4715
113 Ga0114129_10131909 3300009147 Bacteria 3430
114 Ga0114129_10355065 3300009147 Unclassified 1941
115 Ga0114129_10765508 3300009147 Bacteria 1235
116 Ga0114129_12096848 3300009147 Bacteria 682
117 Ga0105248_10199314 3300009177 Unclassified 2255
118 Ga0105248_10208460 3300009177 Bacteria 2202
119 Ga0105249_10195478 3300009553 Bacteria 1977
120 Ga0105249_11518947 3300009553 Bacteria 742
121 Ga0157375_10510929 3300013308 Bacteria 1365
122 Ga0157375_10538483 3300013308 Unclassified 1330
123 Ga0163163_10301392 3300014325 Unclassified 1655
124 Ga0163163_11178323 3300014325 Unclassified 829
125 Ga0157380_10026550 3300014326 Bacteria 4397
126 Ga0157380_10785187 3300014326 Unclassified 968
127 Ga0157377_10586326 3300014745 Bacteria 793
128 Ga0157377_10605708 3300014745 Unclassified 782
129 Ga0157377_10969027 3300014745 Unclassified 641
130 Ga0157376_10124144 3300014969 Bacteria 2293
131 Ga0207682_10171818 3300025893 Bacteria 986
132 Ga0207688_10045696 3300025901 Bacteria 2444
133 Ga0207680_10356624 3300025903 Bacteria 1028
134 Ga0207645_10262318 3300025907 Bacteria 1145
135 Ga0207684_10764141 3300025910 Unclassified 818
136 Ga0207684_10776370 3300025910 Unclassified 811
137 Ga0207693_10034107 3300025915 Bacteria 4014
138 Ga0207660_10546173 3300025917 Bacteria 942
139 Ga0207662_10186140 3300025918 Unclassified 1338
140 Ga0207681_10158164 3300025923 Bacteria 1705
141 Ga0207681_10646025 3300025923 Unclassified 877
142 Ga0207650_10051857 3300025925 Bacteria 3037
143 Ga0207650_10583874 3300025925 Bacteria 939
144 Ga0207650_11241840 3300025925 Unclassified 634
145 Ga0207659_10010668 3300025926 Bacteria 5778
146 Ga0207659_10019268 3300025926 Bacteria 4487
147 Ga0207659_10934651 3300025926 Bacteria 746
148 Ga0207709_10330422 3300025935 Bacteria 1144
149 Ga0207670_10024397 3300025936 Bacteria 3779
150 Ga0207670_10726468 3300025936 Unclassified 823
151 Ga0207669_10736213 3300025937 Bacteria 813
152 Ga0207669_10784855 3300025937 Bacteria 789
153 Ga0207704_11277859 3300025938 Unclassified 627
154 Ga0207691_10015709 3300025940 Bacteria 7196
155 Ga0207691_10027112 3300025940 Bacteria 5375
156 Ga0207691_10168619 3300025940 Bacteria 1918
157 Ga0207711_10371189 3300025941 Bacteria 1327
158 Ga0207689_10658108 3300025942 Bacteria 883
159 Ga0207679_10232564 3300025945 Bacteria 1557
160 Ga0207667_10565619 3300025949 Bacteria 1149
161 Ga0207651_10008870 3300025960 Bacteria 5461
162 Ga0207651_10033984 3300025960 Bacteria 3296
163 Ga0207651_10222688 3300025960 Bacteria 1526
164 Ga0207712_11480899 3300025961 Unclassified 608
165 Ga0207640_11345422 3300025981 Unclassified 639
166 Ga0207703_10126702 3300026035 Bacteria 2199
167 Ga0207703_10562901 3300026035 Bacteria 1076
168 Ga0207708_10489199 3300026075 Bacteria 1030
169 Ga0207641_10203377 3300026088 Bacteria 1827
170 Ga0207641_10489783 3300026088 Unclassified 1193
171 Ga0207676_10107455 3300026095 Bacteria 2327
172 Ga0207674_10254746 3300026116 Unclassified 1702
173 Ga0207683_10750329 3300026121 Bacteria 905
174 Ga0209970_1006942 3300027614 Bacteria 1857
175 Ga0207428_10007873 3300027907 Bacteria 9690
176 Ga0268266_10074845 3300028379 Bacteria 2941
177 Ga0268265_10115558 3300028380 Unclassified 2200
178 Ga0268265_10434667 3300028380 Bacteria 1222
179 Ga0268264_10594427 3300028381 Bacteria 1090
180 Ga0268264_11081802 3300028381 Unclassified 810
181 Ga0268264_11315838 3300028381 Unclassified 733
182 Ga0307408_101491951 3300031548 Bacteria 639
183 Ga0307405_10110215 3300031731 Bacteria 1863
184 Ga0307410_10968026 3300031852 Bacteria 732
185 Ga0307406_10126113 3300031901 Unclassified 1789
186 Ga0307407_10001819 3300031903 Bacteria 8003
187 Ga0307412_10337313 3300031911 Unclassified 1205
188 Ga0307412_10594220 3300031911 Bacteria 936
189 Ga0307409_100119530 3300031995 Bacteria 2228
190 Ga0307416_100004319 3300032002 Bacteria 8540
191 Ga0307416_100832062 3300032002 Bacteria 1020
192 Ga0307415_100002223 3300032126 Bacteria 9614
193 Ga0373923_0068420 3300035111 Bacteria 1520
194 Ga0373924_0006983 3300035410 Bacteria 4064
195 Ga0373937_0002065 3300036401 Bacteria 16794
196 Ga0439461_0058758 3300041410 Bacteria 869
197 Ga0439461_0127381 3300041410 Unclassified 641
198 Ga0439433_0041573 3300041999 Unclassified 1071
199 Ga0450898_140301 3300042134 Unclassified 525
200 Ga0439446_0073497 3300042156 Bacteria 1049
201 Ga0439435_0106497 3300042436 Bacteria 866
202 Ga0450916_020541 3300042530 Unclassified 903
203 Ga0451576_0559119 3300045051 Bacteria 1202
204 Ga0495603_0034145 3300046455 Bacteria 3060
205 Ga0495582_0792812 3300046473 Unclassified 548
206 Ga0495594_0205933 3300046499 Bacteria 1121
207 Ga0495628_0199321 3300046516 Bacteria 1509
208 Ga0495586_0175033 3300046535 Unclassified 1213
209 Ga0495598_0207525 3300046537 Unclassified 710
210 Ga0495621_0146255 3300046539 Unclassified 927
211 Ga0495645_0553805 3300046543 Unclassified 712
212 Ga0495656_0059050 3300046615 Bacteria 1667
213 Ga0495659_0042344 3300046664 Unclassified 1630
214 Ga0495659_0140327 3300046664 Bacteria 964
215 Ga0495657_0317428 3300046675 Unclassified 926
216 Ga0495623_0160589 3300046679 Unclassified 1321
217 Ga0495647_0082038 3300046681 Bacteria 1309
218 Ga0495675_0277018 3300047444 Unclassified 1001
219 Ga0496108_0398542 3300048911 Bacteria 1202
220 Ga0496110_0503341 3300048913 Bacteria 1103
221 Ga0496113_0260925 3300048916 Bacteria 1384
222 Ga0501031_0077857 3300049568 Bacteria 2160
223 Ga0501036_0330112 3300049572 Bacteria 1274
224 Ga0501038_0317392 3300049574 Unclassified 1220
225 Ga0501039_0328902 3300049575 Unclassified 1201
226 Ga0501039_0537994 3300049575 Bacteria 917
227 Ga0501039_0706667 3300049575 Unclassified 788
228 Ga0501040_0144999 3300049576 Unclassified 1673
229 Ga0501040_0610433 3300049576 Unclassified 788
230 Ga0501042_0301776 3300049578 Bacteria 1157
231 Ga0501046_0665813 3300049580 Unclassified 735
232 Ga0501071_0016531 3300049587 Bacteria 5076
233 Ga0501071_0094423 3300049587 Bacteria 2200
234 Ga0501071_0580161 3300049587 Bacteria 862
235 Ga0501072_0293541 3300049588 Bacteria 1292
236 Ga0501072_0560459 3300049588 Bacteria 902
237 Ga0501074_0567847 3300049590 Bacteria 803
238 Ga0501075_0875101 3300049591 Unclassified 683
239 Ga0501075_0923218 3300049591 Bacteria 663
240 Ga0501076_0252608 3300049592 Bacteria 1443
241 Ga0501076_0787131 3300049592 Unclassified 785
242 Ga0501076_0855374 3300049592 Bacteria 750
243 Ga0501077_0214761 3300049593 Unclassified 1222
244 Ga0501079_0468719 3300049741 Unclassified 989
245 Ga0501035_0515468 3300049822 Bacteria 983
246 Ga0501045_0055240 3300049824 Bacteria 2904
247 Ga0501045_0530380 3300049824 Bacteria 874
248 Ga0501045_0902464 3300049824 Unclassified 649
249 nmdc:mga05p37_1029547_c1 3300050507 Bacteria 871
250 nmdc:mga05p37_128772_c1 3300050507 Bacteria 3107
251 nmdc:mga05p37_129618_c1 3300050507 Bacteria 3095
252 nmdc:mga05p37_1619361_c1 3300050507 Unclassified 637
253 nmdc:mga05p37_326148_c1 3300050507 Bacteria 1815
254 nmdc:mga05p37_80663_c1 3300050507 Bacteria 4008
255 nmdc:mga09592_173570_c1 3300050508 Unclassified 1864
256 nmdc:mga09592_241559_c1 3300050508 Unclassified 1565
257 nmdc:mga09592_803768_c1 3300050508 Bacteria 795
258 nmdc:mga0qj67_17069_c1 3300050509 Bacteria 5515
259 nmdc:mga0qj67_262032_c1 3300050509 Bacteria 1402
260 nmdc:mga0qj67_462286_c1 3300050509 Bacteria 1022
261 nmdc:mga0qj67_641010_c1 3300050509 Unclassified 848
262 nmdc:mga06r32_1229671_c1 3300050510 Unclassified 695
263 nmdc:mga06r32_722332_c1 3300050510 Bacteria 961
264 nmdc:mga08y16_1023611_c1 3300050511 Unclassified 805
265 nmdc:mga08y16_10473_c1 3300050511 Bacteria 9727
266 nmdc:mga08y16_1273078_c1 3300050511 Unclassified 703
267 nmdc:mga08y16_206959_c1 3300050511 Unclassified 2032
268 nmdc:mga08y16_90828_c1 3300050511 Bacteria 3183
269 nmdc:mga0n895_1262030_c1 3300050512 Bacteria 711
270 nmdc:mga0n895_1486980_c1 3300050512 Unclassified 644
271 nmdc:mga0n895_353995_c1 3300050512 Bacteria 1487
272 nmdc:mga0n895_515621_c1 3300050512 Bacteria 1203
273 nmdc:mga0n895_65604_c1 3300050512 Bacteria 3594
274 nmdc:mga0n895_777918_c1 3300050512 Unclassified 949
275 nmdc:mga0rr50_100870_c1 3300050513 Bacteria 2268
276 nmdc:mga08x19_63954_c1 3300050514 Bacteria 2388
277 nmdc:mga0a205_1129949_c1 3300050515 Unclassified 631
278 nmdc:mga0a205_23716_c1 3300050515 Bacteria 5821
279 nmdc:mga0a205_304740_c1 3300050515 Bacteria 1465
280 nmdc:mga0a205_42969_c1 3300050515 Bacteria 3904
281 nmdc:mga0a205_729196_c1 3300050515 Unclassified 840
282 nmdc:mga0a205_76_c1 3300050515 Bacteria 54611
283 Ga0501084_0123092 3300054114 Unclassified 2181
284 Ga0501084_0375772 3300054114 Unclassified 1201
285 Ga0501084_0674350 3300054114 Unclassified 872
286 Ga0501082_0158062 3300060353 Bacteria 1969
287 Ga0501082_0206986 3300060353 Bacteria 1707
288 Ga0501082_0355183 3300060353 Unclassified 1278
289 Ga0501082_0461810 3300060353 Bacteria 1110
290 Ga0530510_0304826 3300061734 Unclassified 1192

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100052717 Ga0070668_1000527174 129
2 3300005356 Ga0070674_100122665 Ga0070674_1001226652 142
3 3300031911 Ga0307412_10337313 Ga0307412_103373132 144
4 3300050514 nmdc:mga08x19_63954_c1 nmdc:mga08x19_63954_c1_874_1353 146
5 3300005445 Ga0070708_100710333 Ga0070708_1007103331 147
6 3300005843 Ga0068860_100633937 Ga0068860_1006339371 147
7 3300009147 Ga0114129_10765508 Ga0114129_107655082 147
8 3300005456 Ga0070678_100127577 Ga0070678_1001275772 155
9 3300005543 Ga0070672_100377357 Ga0070672_1003773572 155
10 3300005295 Ga0065707_10355448 Ga0065707_103554482 156
11 3300005295 Ga0065707_10903745 Ga0065707_109037451 156
12 3300005843 Ga0068860_101205656 Ga0068860_1012056561 156
13 3300009094 Ga0111539_10029785 Ga0111539_100297858 156
14 3300028381 Ga0268264_11081802 Ga0268264_110818022 156
15 3300046455 Ga0495603_0034145 Ga0495603_0034145_2252_2728 156
16 3300046473 Ga0495582_0792812 Ga0495582_0792812_34_510 156
17 3300046499 Ga0495594_0205933 Ga0495594_0205933_326_802 156
18 3300046681 Ga0495647_0082038 Ga0495647_0082038_126_602 156
19 3300050511 nmdc:mga08y16_90828_c1 nmdc:mga08y16_90828_c1_1584_2066 156
20 3300005290 Ga0065712_10017653 Ga0065712_100176531 157
21 3300005290 Ga0065712_10222040 Ga0065712_102220401 157
22 3300005293 Ga0065715_10020365 Ga0065715_100203652 157
23 3300005295 Ga0065707_10085282 Ga0065707_100852825 157
24 3300005328 Ga0070676_10475247 Ga0070676_104752472 157
25 3300005330 Ga0070690_100118294 Ga0070690_1001182942 157
26 3300005331 Ga0070670_100128025 Ga0070670_1001280253 157
27 3300005331 Ga0070670_100740925 Ga0070670_1007409252 157
28 3300005331 Ga0070670_101578230 Ga0070670_1015782301 157
29 3300005334 Ga0068869_100071342 Ga0068869_1000713423 157
30 3300005335 Ga0070666_10451138 Ga0070666_104511382 157
31 3300005335 Ga0070666_10805016 Ga0070666_108050161 157
32 3300005337 Ga0070682_100215854 Ga0070682_1002158542 157
33 3300005338 Ga0068868_101314804 Ga0068868_1013148041 157
34 3300005340 Ga0070689_100086100 Ga0070689_1000861002 157
35 3300005340 Ga0070689_100473840 Ga0070689_1004738401 157
36 3300005340 Ga0070689_100607565 Ga0070689_1006075651 157
37 3300005341 Ga0070691_10632932 Ga0070691_106329321 157
38 3300005347 Ga0070668_100125781 Ga0070668_1001257813 157
39 3300005353 Ga0070669_100225516 Ga0070669_1002255161 157
40 3300005354 Ga0070675_100013444 Ga0070675_1000134443 157
41 3300005354 Ga0070675_100029407 Ga0070675_1000294071 157
42 3300005354 Ga0070675_100107354 Ga0070675_1001073542 157
43 3300005354 Ga0070675_100135308 Ga0070675_1001353082 157
44 3300005355 Ga0070671_100068799 Ga0070671_1000687994 157
45 3300005356 Ga0070674_100322607 Ga0070674_1003226072 157
46 3300005356 Ga0070674_101219757 Ga0070674_1012197571 157
47 3300005364 Ga0070673_100132015 Ga0070673_1001320151 157
48 3300005364 Ga0070673_100795462 Ga0070673_1007954622 157
49 3300005365 Ga0070688_100025577 Ga0070688_1000255775 157
50 3300005365 Ga0070688_100427063 Ga0070688_1004270631 157
51 3300005440 Ga0070705_100053529 Ga0070705_1000535291 157
52 3300005444 Ga0070694_100221937 Ga0070694_1002219372 157
53 3300005444 Ga0070694_100894855 Ga0070694_1008948552 157
54 3300005456 Ga0070678_100113686 Ga0070678_1001136863 157
55 3300005456 Ga0070678_100199610 Ga0070678_1001996103 157
56 3300005466 Ga0070685_10040597 Ga0070685_100405975 157
57 3300005467 Ga0070706_100486528 Ga0070706_1004865282 157
58 3300005467 Ga0070706_100898684 Ga0070706_1008986842 157
59 3300005468 Ga0070707_100227127 Ga0070707_1002271272 157
60 3300005471 Ga0070698_100426151 Ga0070698_1004261512 157
61 3300005518 Ga0070699_100003006 Ga0070699_10000300617 157
62 3300005535 Ga0070684_101846564 Ga0070684_1018465641 157
63 3300005536 Ga0070697_100103126 Ga0070697_1001031262 157
64 3300005543 Ga0070672_100028569 Ga0070672_1000285697 157
65 3300005543 Ga0070672_100326489 Ga0070672_1003264892 157
66 3300005543 Ga0070672_100387663 Ga0070672_1003876631 157
67 3300005543 Ga0070672_100606205 Ga0070672_1006062052 157
68 3300005544 Ga0070686_100091676 Ga0070686_1000916762 157
69 3300005544 Ga0070686_100350710 Ga0070686_1003507101 157
70 3300005545 Ga0070695_100704926 Ga0070695_1007049262 157
71 3300005545 Ga0070695_101294515 Ga0070695_1012945151 157
72 3300005548 Ga0070665_100131781 Ga0070665_1001317812 157
73 3300005549 Ga0070704_100092059 Ga0070704_1000920595 157
74 3300005549 Ga0070704_100473643 Ga0070704_1004736432 157
75 3300005563 Ga0068855_100310968 Ga0068855_1003109684 157
76 3300005564 Ga0070664_100127068 Ga0070664_1001270682 157
77 3300005564 Ga0070664_101223973 Ga0070664_1012239732 157
78 3300005577 Ga0068857_100055811 Ga0068857_1000558116 157
79 3300005578 Ga0068854_101484817 Ga0068854_1014848172 157
80 3300005617 Ga0068859_100128766 Ga0068859_1001287664 157
81 3300005617 Ga0068859_100653475 Ga0068859_1006534752 157
82 3300005617 Ga0068859_101788095 Ga0068859_1017880951 157
83 3300005618 Ga0068864_100047813 Ga0068864_1000478132 157
84 3300005618 Ga0068864_100163523 Ga0068864_1001635231 157
85 3300005840 Ga0068870_10132635 Ga0068870_101326352 157
86 3300005841 Ga0068863_100135455 Ga0068863_1001354553 157
87 3300005842 Ga0068858_100619170 Ga0068858_1006191701 157
88 3300005843 Ga0068860_100790722 Ga0068860_1007907221 157
89 3300005843 Ga0068860_100971750 Ga0068860_1009717502 157
90 3300006358 Ga0068871_100449633 Ga0068871_1004496332 157
91 3300006844 Ga0075428_100095026 Ga0075428_1000950262 157
92 3300006844 Ga0075428_100444998 Ga0075428_1004449982 157
93 3300006846 Ga0075430_100029161 Ga0075430_1000291615 157
94 3300006846 Ga0075430_100285510 Ga0075430_1002855102 157
95 3300006846 Ga0075430_100452595 Ga0075430_1004525952 157
96 3300006847 Ga0075431_100129754 Ga0075431_1001297543 157
97 3300006852 Ga0075433_10000202 Ga0075433_100002023 157
98 3300006852 Ga0075433_10005660 Ga0075433_100056606 157
99 3300006852 Ga0075433_10420892 Ga0075433_104208922 157
100 3300006871 Ga0075434_100017450 Ga0075434_1000174502 157
101 3300006871 Ga0075434_100054139 Ga0075434_1000541392 157
102 3300006871 Ga0075434_100755583 Ga0075434_1007555832 157
103 3300006871 Ga0075434_100983390 Ga0075434_1009833902 157
104 3300006871 Ga0075434_101722575 Ga0075434_1017225751 157
105 3300006880 Ga0075429_100151664 Ga0075429_1001516642 157
106 3300006880 Ga0075429_100227112 Ga0075429_1002271123 157
107 3300006880 Ga0075429_100256912 Ga0075429_1002569123 157
108 3300006880 Ga0075429_100549831 Ga0075429_1005498312 157
109 3300006931 Ga0097620_100128764 Ga0097620_1001287644 157
110 3300006931 Ga0097620_100653503 Ga0097620_1006535032 157
111 3300006931 Ga0097620_101788183 Ga0097620_1017881831 157
112 3300007076 Ga0075435_100021849 Ga0075435_1000218493 157
113 3300009094 Ga0111539_10005953 Ga0111539_100059533 157
114 3300009094 Ga0111539_10020945 Ga0111539_100209456 157
115 3300009094 Ga0111539_10088635 Ga0111539_100886353 157
116 3300009094 Ga0111539_10856245 Ga0111539_108562451 157
117 3300009094 Ga0111539_11490844 Ga0111539_114908441 157
118 3300009147 Ga0114129_10018633 Ga0114129_100186332 157
119 3300009147 Ga0114129_10019353 Ga0114129_1001935311 157
120 3300009147 Ga0114129_10054962 Ga0114129_100549623 157
121 3300009147 Ga0114129_10074863 Ga0114129_100748631 157
122 3300009147 Ga0114129_10131909 Ga0114129_101319092 157
123 3300009147 Ga0114129_10355065 Ga0114129_103550654 157
124 3300009147 Ga0114129_12096848 Ga0114129_120968482 157
125 3300009177 Ga0105248_10199314 Ga0105248_101993142 157
126 3300009177 Ga0105248_10208460 Ga0105248_102084603 157
127 3300009553 Ga0105249_10195478 Ga0105249_101954782 157
128 3300009553 Ga0105249_11518947 Ga0105249_115189471 157
129 3300013308 Ga0157375_10510929 Ga0157375_105109293 157
130 3300013308 Ga0157375_10538483 Ga0157375_105384832 157
131 3300014325 Ga0163163_10301392 Ga0163163_103013924 157
132 3300014325 Ga0163163_11178323 Ga0163163_111783231 157
133 3300014326 Ga0157380_10026550 Ga0157380_100265502 157
134 3300014326 Ga0157380_10785187 Ga0157380_107851872 157
135 3300014745 Ga0157377_10586326 Ga0157377_105863262 157
136 3300014745 Ga0157377_10605708 Ga0157377_106057082 157
137 3300014745 Ga0157377_10969027 Ga0157377_109690271 157
138 3300014969 Ga0157376_10124144 Ga0157376_101241444 157
139 3300025893 Ga0207682_10171818 Ga0207682_101718182 157
140 3300025901 Ga0207688_10045696 Ga0207688_100456963 157
141 3300025903 Ga0207680_10356624 Ga0207680_103566241 157
142 3300025907 Ga0207645_10262318 Ga0207645_102623182 157
143 3300025910 Ga0207684_10764141 Ga0207684_107641412 157
144 3300025910 Ga0207684_10776370 Ga0207684_107763701 157
145 3300025915 Ga0207693_10034107 Ga0207693_100341073 157
146 3300025917 Ga0207660_10546173 Ga0207660_105461731 157
147 3300025918 Ga0207662_10186140 Ga0207662_101861402 157
148 3300025923 Ga0207681_10158164 Ga0207681_101581643 157
149 3300025923 Ga0207681_10646025 Ga0207681_106460252 157
150 3300025925 Ga0207650_10051857 Ga0207650_100518574 157
151 3300025925 Ga0207650_10583874 Ga0207650_105838742 157
152 3300025925 Ga0207650_11241840 Ga0207650_112418401 157
153 3300025926 Ga0207659_10010668 Ga0207659_100106685 157
154 3300025926 Ga0207659_10019268 Ga0207659_100192687 157
155 3300025926 Ga0207659_10934651 Ga0207659_109346512 157
156 3300025935 Ga0207709_10330422 Ga0207709_103304222 157
157 3300025936 Ga0207670_10024397 Ga0207670_100243974 157
158 3300025936 Ga0207670_10726468 Ga0207670_107264682 157
159 3300025937 Ga0207669_10736213 Ga0207669_107362131 157
160 3300025937 Ga0207669_10784855 Ga0207669_107848551 157
161 3300025938 Ga0207704_11277859 Ga0207704_112778591 157
162 3300025940 Ga0207691_10015709 Ga0207691_100157093 157
163 3300025940 Ga0207691_10027112 Ga0207691_100271126 157
164 3300025940 Ga0207691_10168619 Ga0207691_101686191 157
165 3300025941 Ga0207711_10371189 Ga0207711_103711892 157
166 3300025942 Ga0207689_10658108 Ga0207689_106581082 157
167 3300025945 Ga0207679_10232564 Ga0207679_102325641 157
168 3300025949 Ga0207667_10565619 Ga0207667_105656192 157
169 3300025960 Ga0207651_10008870 Ga0207651_100088704 157
170 3300025960 Ga0207651_10033984 Ga0207651_100339842 157
171 3300025960 Ga0207651_10222688 Ga0207651_102226881 157
172 3300025961 Ga0207712_11480899 Ga0207712_114808991 157
173 3300025981 Ga0207640_11345422 Ga0207640_113454221 157
174 3300026035 Ga0207703_10126702 Ga0207703_101267023 157
175 3300026035 Ga0207703_10562901 Ga0207703_105629011 157
176 3300026075 Ga0207708_10489199 Ga0207708_104891992 157
177 3300026088 Ga0207641_10203377 Ga0207641_102033772 157
178 3300026088 Ga0207641_10489783 Ga0207641_104897832 157
179 3300026095 Ga0207676_10107455 Ga0207676_101074552 157
180 3300026116 Ga0207674_10254746 Ga0207674_102547463 157
181 3300026121 Ga0207683_10750329 Ga0207683_107503292 157
182 3300027614 Ga0209970_1006942 Ga0209970_10069423 157
183 3300027907 Ga0207428_10007873 Ga0207428_100078734 157
184 3300028379 Ga0268266_10074845 Ga0268266_100748452 157
185 3300028380 Ga0268265_10115558 Ga0268265_101155583 157
186 3300028380 Ga0268265_10434667 Ga0268265_104346671 157
187 3300028381 Ga0268264_10594427 Ga0268264_105944271 157
188 3300028381 Ga0268264_11315838 Ga0268264_113158382 157
189 3300031548 Ga0307408_101491951 Ga0307408_1014919511 157
190 3300031731 Ga0307405_10110215 Ga0307405_101102153 157
191 3300031852 Ga0307410_10968026 Ga0307410_109680262 157
192 3300031901 Ga0307406_10126113 Ga0307406_101261132 157
193 3300031903 Ga0307407_10001819 Ga0307407_100018195 157
194 3300031911 Ga0307412_10594220 Ga0307412_105942202 157
195 3300031995 Ga0307409_100119530 Ga0307409_1001195303 157
196 3300032002 Ga0307416_100004319 Ga0307416_1000043196 157
197 3300032002 Ga0307416_100832062 Ga0307416_1008320622 157
198 3300032126 Ga0307415_100002223 Ga0307415_1000022235 157
199 3300035111 Ga0373923_0068420 Ga0373923_0068420_356_832 157
200 3300035410 Ga0373924_0006983 Ga0373924_0006983_3527_4003 157
201 3300036401 Ga0373937_0002065 Ga0373937_0002065_1576_2052 157
202 3300041410 Ga0439461_0058758 Ga0439461_0058758_49_522 157
203 3300041410 Ga0439461_0127381 Ga0439461_0127381_57_530 157
204 3300041999 Ga0439433_0041573 Ga0439433_0041573_526_999 157
205 3300042134 Ga0450898_140301 Ga0450898_140301_16_489 157
206 3300042156 Ga0439446_0073497 Ga0439446_0073497_168_641 157
207 3300042436 Ga0439435_0106497 Ga0439435_0106497_202_675 157
208 3300042530 Ga0450916_020541 Ga0450916_020541_51_527 157
209 3300045051 Ga0451576_0559119 Ga0451576_0559119_661_1134 157
210 3300046516 Ga0495628_0199321 Ga0495628_0199321_524_1000 157
211 3300046535 Ga0495586_0175033 Ga0495586_0175033_396_872 157
212 3300046537 Ga0495598_0207525 Ga0495598_0207525_97_579 157
213 3300046539 Ga0495621_0146255 Ga0495621_0146255_356_829 157
214 3300046543 Ga0495645_0553805 Ga0495645_0553805_138_614 157
215 3300046615 Ga0495656_0059050 Ga0495656_0059050_1129_1602 157
216 3300046664 Ga0495659_0042344 Ga0495659_0042344_850_1323 157
217 3300046664 Ga0495659_0140327 Ga0495659_0140327_275_748 157
218 3300046675 Ga0495657_0317428 Ga0495657_0317428_271_747 157
219 3300046679 Ga0495623_0160589 Ga0495623_0160589_371_847 157
220 3300047444 Ga0495675_0277018 Ga0495675_0277018_419_895 157
221 3300048911 Ga0496108_0398542 Ga0496108_0398542_138_611 157
222 3300048913 Ga0496110_0503341 Ga0496110_0503341_577_1050 157
223 3300048916 Ga0496113_0260925 Ga0496113_0260925_796_1269 157
224 3300049568 Ga0501031_0077857 Ga0501031_0077857_1644_2120 157
225 3300049572 Ga0501036_0330112 Ga0501036_0330112_106_579 157
226 3300049574 Ga0501038_0317392 Ga0501038_0317392_413_889 157
227 3300049575 Ga0501039_0328902 Ga0501039_0328902_199_675 157
228 3300049575 Ga0501039_0537994 Ga0501039_0537994_351_833 157
229 3300049575 Ga0501039_0706667 Ga0501039_0706667_60_545 157
230 3300049576 Ga0501040_0144999 Ga0501040_0144999_456_929 157
231 3300049576 Ga0501040_0610433 Ga0501040_0610433_33_518 157
232 3300049578 Ga0501042_0301776 Ga0501042_0301776_470_952 157
233 3300049580 Ga0501046_0665813 Ga0501046_0665813_75_560 157
234 3300049587 Ga0501071_0016531 Ga0501071_0016531_2063_2539 157
235 3300049587 Ga0501071_0094423 Ga0501071_0094423_1127_1600 157
236 3300049587 Ga0501071_0580161 Ga0501071_0580161_147_620 157
237 3300049588 Ga0501072_0293541 Ga0501072_0293541_258_731 157
238 3300049588 Ga0501072_0560459 Ga0501072_0560459_98_571 157
239 3300049590 Ga0501074_0567847 Ga0501074_0567847_201_683 157
240 3300049591 Ga0501075_0875101 Ga0501075_0875101_80_553 157
241 3300049591 Ga0501075_0923218 Ga0501075_0923218_10_483 157
242 3300049592 Ga0501076_0252608 Ga0501076_0252608_140_625 157
243 3300049592 Ga0501076_0787131 Ga0501076_0787131_110_586 157
244 3300049592 Ga0501076_0855374 Ga0501076_0855374_84_557 157
245 3300049593 Ga0501077_0214761 Ga0501077_0214761_202_678 157
246 3300049741 Ga0501079_0468719 Ga0501079_0468719_117_593 157
247 3300049822 Ga0501035_0515468 Ga0501035_0515468_84_557 157
248 3300049824 Ga0501045_0055240 Ga0501045_0055240_11_496 157
249 3300049824 Ga0501045_0530380 Ga0501045_0530380_357_839 157
250 3300049824 Ga0501045_0902464 Ga0501045_0902464_78_554 157
251 3300050507 nmdc:mga05p37_1029547_c1 nmdc:mga05p37_1029547_c1_271_771 157
252 3300050507 nmdc:mga05p37_128772_c1 nmdc:mga05p37_128772_c1_75_566 157
253 3300050507 nmdc:mga05p37_129618_c1 nmdc:mga05p37_129618_c1_2059_2532 157
254 3300050507 nmdc:mga05p37_1619361_c1 nmdc:mga05p37_1619361_c1_42_515 157
255 3300050507 nmdc:mga05p37_326148_c1 nmdc:mga05p37_326148_c1_317_790 157
256 3300050507 nmdc:mga05p37_80663_c1 nmdc:mga05p37_80663_c1_3502_3975 157
257 3300050508 nmdc:mga09592_173570_c1 nmdc:mga09592_173570_c1_988_1461 157
258 3300050508 nmdc:mga09592_241559_c1 nmdc:mga09592_241559_c1_692_1165 157
259 3300050508 nmdc:mga09592_803768_c1 nmdc:mga09592_803768_c1_165_638 157
260 3300050509 nmdc:mga0qj67_17069_c1 nmdc:mga0qj67_17069_c1_1492_1965 157
261 3300050509 nmdc:mga0qj67_262032_c1 nmdc:mga0qj67_262032_c1_128_601 157
262 3300050509 nmdc:mga0qj67_462286_c1 nmdc:mga0qj67_462286_c1_69_542 157
263 3300050509 nmdc:mga0qj67_641010_c1 nmdc:mga0qj67_641010_c1_179_652 157
264 3300050510 nmdc:mga06r32_1229671_c1 nmdc:mga06r32_1229671_c1_212_685 157
265 3300050510 nmdc:mga06r32_722332_c1 nmdc:mga06r32_722332_c1_403_876 157
266 3300050511 nmdc:mga08y16_1023611_c1 nmdc:mga08y16_1023611_c1_152_625 157
267 3300050511 nmdc:mga08y16_10473_c1 nmdc:mga08y16_10473_c1_4721_5194 157
268 3300050511 nmdc:mga08y16_1273078_c1 nmdc:mga08y16_1273078_c1_75_548 157
269 3300050511 nmdc:mga08y16_206959_c1 nmdc:mga08y16_206959_c1_486_959 157
270 3300050512 nmdc:mga0n895_1262030_c1 nmdc:mga0n895_1262030_c1_174_647 157
271 3300050512 nmdc:mga0n895_1486980_c1 nmdc:mga0n895_1486980_c1_47_523 157
272 3300050512 nmdc:mga0n895_353995_c1 nmdc:mga0n895_353995_c1_427_900 157
273 3300050512 nmdc:mga0n895_515621_c1 nmdc:mga0n895_515621_c1_153_626 157
274 3300050512 nmdc:mga0n895_65604_c1 nmdc:mga0n895_65604_c1_2828_3301 157
275 3300050512 nmdc:mga0n895_777918_c1 nmdc:mga0n895_777918_c1_36_509 157
276 3300050513 nmdc:mga0rr50_100870_c1 nmdc:mga0rr50_100870_c1_1278_1751 157
277 3300050515 nmdc:mga0a205_1129949_c1 nmdc:mga0a205_1129949_c1_45_530 157
278 3300050515 nmdc:mga0a205_23716_c1 nmdc:mga0a205_23716_c1_3881_4354 157
279 3300050515 nmdc:mga0a205_304740_c1 nmdc:mga0a205_304740_c1_170_649 157
280 3300050515 nmdc:mga0a205_42969_c1 nmdc:mga0a205_42969_c1_1869_2342 157
281 3300050515 nmdc:mga0a205_729196_c1 nmdc:mga0a205_729196_c1_294_770 157
282 3300050515 nmdc:mga0a205_76_c1 nmdc:mga0a205_76_c1_52942_53415 157
283 3300054114 Ga0501084_0123092 Ga0501084_0123092_1402_1878 157
284 3300054114 Ga0501084_0375772 Ga0501084_0375772_588_1061 157
285 3300054114 Ga0501084_0674350 Ga0501084_0674350_331_807 157
286 3300060353 Ga0501082_0158062 Ga0501082_0158062_924_1400 157
287 3300060353 Ga0501082_0206986 Ga0501082_0206986_870_1355 157
288 3300060353 Ga0501082_0355183 Ga0501082_0355183_791_1267 157
289 3300060353 Ga0501082_0461810 Ga0501082_0461810_409_882 157
290 3300061734 Ga0530510_0304826 Ga0530510_0304826_95_571 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

15

146

0.87

PF07609

DUF1572

Protein of unknown function (DUF1572)

88

167

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.7201 1 153
5cog-assembly1.cif.gz_A crystal structure of yeast irc4 0.7102 7 151
5com-assembly2.cif.gz_B crystal structure of uncharacterized protein q187f5 from clostridium difficile 630 0.7075 7 151
5cof-assembly1.cif.gz_A crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 0.7043 7 155
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.6998 1 153
ID Description Score Start End Superfamily
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7102 7 151 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.702 10 149 1.20.120.450
2f22B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6939 7 155 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6802 10 149 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6755 1 153 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8HLR2-F1-model_v4 ABC transporter 0.9808 1 157
AF-A0A2V8HLR2-F1-model_v4 ABC transporter 0.9746 1 157
AF-A0A2V7JJL8-F1-model_v4 ABC transporter 0.9646 3 156
AF-A0A1M7NWC6-F1-model_v4 DinB superfamily protein 0.963 3 157
AF-A0A2V8HUC6-F1-model_v4 ABC transporter 0.9618 3 157

Feature Viewer

pLDDT pTM Quality
94.35 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map