F389816
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 161 | 290 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10254746|Ga0207674_102547463 |
| Length | 183 |
| Sequence | MPHDAIRDHLVRVLDWEEAHVGFDKAIDGIPADKRGMKAPGFEYSAWQLLEHMRLAQDDILDFCTNPNYVHNLKWPDDYWPSATPPSDAAWNESVASFVRAREKVKAVARDVKDLTAPVPTGTATQTYLRAILLVADHTAYHVGQLVFVAKHFAGPNWKSLSIPKGQSKQHVVGAFKQGFVPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 107 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 111 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 112 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 113 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 114 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 115 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 98.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10017653 | 3300005290 | Bacteria | 1604 |
| 2 | Ga0065712_10222040 | 3300005290 | Bacteria | 1029 |
| 3 | Ga0065715_10020365 | 3300005293 | Bacteria | 2526 |
| 4 | Ga0065707_10085282 | 3300005295 | Bacteria | 6288 |
| 5 | Ga0065707_10355448 | 3300005295 | Bacteria | 912 |
| 6 | Ga0065707_10903745 | 3300005295 | Bacteria | 566 |
| 7 | Ga0070676_10475247 | 3300005328 | Bacteria | 883 |
| 8 | Ga0070690_100118294 | 3300005330 | Unclassified | 1776 |
| 9 | Ga0070670_100128025 | 3300005331 | Bacteria | 2191 |
| 10 | Ga0070670_100740925 | 3300005331 | Bacteria | 885 |
| 11 | Ga0070670_101578230 | 3300005331 | Unclassified | 603 |
| 12 | Ga0068869_100071342 | 3300005334 | Bacteria | 2572 |
| 13 | Ga0070666_10451138 | 3300005335 | Unclassified | 929 |
| 14 | Ga0070666_10805016 | 3300005335 | Unclassified | 692 |
| 15 | Ga0070682_100215854 | 3300005337 | Bacteria | 1362 |
| 16 | Ga0068868_101314804 | 3300005338 | Unclassified | 672 |
| 17 | Ga0070689_100086100 | 3300005340 | Bacteria | 2471 |
| 18 | Ga0070689_100473840 | 3300005340 | Bacteria | 1068 |
| 19 | Ga0070689_100607565 | 3300005340 | Unclassified | 948 |
| 20 | Ga0070691_10632932 | 3300005341 | Bacteria | 635 |
| 21 | Ga0070668_100052717 | 3300005347 | Bacteria | 3136 |
| 22 | Ga0070668_100125781 | 3300005347 | Bacteria | 2053 |
| 23 | Ga0070669_100225516 | 3300005353 | Bacteria | 1483 |
| 24 | Ga0070675_100013444 | 3300005354 | Bacteria | 6434 |
| 25 | Ga0070675_100029407 | 3300005354 | Bacteria | 4432 |
| 26 | Ga0070675_100107354 | 3300005354 | Unclassified | 2357 |
| 27 | Ga0070675_100135308 | 3300005354 | Bacteria | 2103 |
| 28 | Ga0070671_100068799 | 3300005355 | Bacteria | 2953 |
| 29 | Ga0070674_100122665 | 3300005356 | Unclassified | 1926 |
| 30 | Ga0070674_100322607 | 3300005356 | Bacteria | 1239 |
| 31 | Ga0070674_101219757 | 3300005356 | Unclassified | 668 |
| 32 | Ga0070673_100132015 | 3300005364 | Bacteria | 2097 |
| 33 | Ga0070673_100795462 | 3300005364 | Bacteria | 873 |
| 34 | Ga0070688_100025577 | 3300005365 | Bacteria | 3496 |
| 35 | Ga0070688_100427063 | 3300005365 | Bacteria | 986 |
| 36 | Ga0070705_100053529 | 3300005440 | Unclassified | 2363 |
| 37 | Ga0070694_100221937 | 3300005444 | Bacteria | 1418 |
| 38 | Ga0070694_100894855 | 3300005444 | Unclassified | 732 |
| 39 | Ga0070708_100710333 | 3300005445 | Bacteria | 946 |
| 40 | Ga0070678_100113686 | 3300005456 | Bacteria | 2123 |
| 41 | Ga0070678_100127577 | 3300005456 | Bacteria | 2016 |
| 42 | Ga0070678_100199610 | 3300005456 | Bacteria | 1650 |
| 43 | Ga0070685_10040597 | 3300005466 | Bacteria | 2649 |
| 44 | Ga0070706_100486528 | 3300005467 | Unclassified | 1148 |
| 45 | Ga0070706_100898684 | 3300005467 | Unclassified | 818 |
| 46 | Ga0070707_100227127 | 3300005468 | Unclassified | 1818 |
| 47 | Ga0070698_100426151 | 3300005471 | Unclassified | 1261 |
| 48 | Ga0070699_100003006 | 3300005518 | Bacteria | 14986 |
| 49 | Ga0070684_101846564 | 3300005535 | Unclassified | 570 |
| 50 | Ga0070697_100103126 | 3300005536 | Bacteria | 2371 |
| 51 | Ga0070672_100028569 | 3300005543 | Bacteria | 4173 |
| 52 | Ga0070672_100326489 | 3300005543 | Bacteria | 1305 |
| 53 | Ga0070672_100377357 | 3300005543 | Bacteria | 1212 |
| 54 | Ga0070672_100387663 | 3300005543 | Bacteria | 1196 |
| 55 | Ga0070672_100606205 | 3300005543 | Unclassified | 954 |
| 56 | Ga0070686_100091676 | 3300005544 | Bacteria | 2034 |
| 57 | Ga0070686_100350710 | 3300005544 | Bacteria | 1109 |
| 58 | Ga0070695_100704926 | 3300005545 | Bacteria | 801 |
| 59 | Ga0070695_101294515 | 3300005545 | Unclassified | 602 |
| 60 | Ga0070665_100131781 | 3300005548 | Bacteria | 2502 |
| 61 | Ga0070704_100092059 | 3300005549 | Unclassified | 2263 |
| 62 | Ga0070704_100473643 | 3300005549 | Bacteria | 1082 |
| 63 | Ga0068855_100310968 | 3300005563 | Bacteria | 1743 |
| 64 | Ga0070664_100127068 | 3300005564 | Bacteria | 2237 |
| 65 | Ga0070664_101223973 | 3300005564 | Unclassified | 708 |
| 66 | Ga0068857_100055811 | 3300005577 | Bacteria | 3505 |
| 67 | Ga0068854_101484817 | 3300005578 | Bacteria | 615 |
| 68 | Ga0068859_100128766 | 3300005617 | Unclassified | 2602 |
| 69 | Ga0068859_100653475 | 3300005617 | Bacteria | 1143 |
| 70 | Ga0068859_101788095 | 3300005617 | Unclassified | 679 |
| 71 | Ga0068864_100047813 | 3300005618 | Bacteria | 3676 |
| 72 | Ga0068864_100163523 | 3300005618 | Bacteria | 2024 |
| 73 | Ga0068870_10132635 | 3300005840 | Bacteria | 1449 |
| 74 | Ga0068863_100135455 | 3300005841 | Bacteria | 2353 |
| 75 | Ga0068858_100619170 | 3300005842 | Bacteria | 1051 |
| 76 | Ga0068860_100633937 | 3300005843 | Bacteria | 1076 |
| 77 | Ga0068860_100790722 | 3300005843 | Unclassified | 962 |
| 78 | Ga0068860_100971750 | 3300005843 | Bacteria | 867 |
| 79 | Ga0068860_101205656 | 3300005843 | Unclassified | 777 |
| 80 | Ga0068871_100449633 | 3300006358 | Bacteria | 1154 |
| 81 | Ga0075428_100095026 | 3300006844 | Bacteria | 3249 |
| 82 | Ga0075428_100444998 | 3300006844 | Unclassified | 1388 |
| 83 | Ga0075430_100029161 | 3300006846 | Bacteria | 4684 |
| 84 | Ga0075430_100285510 | 3300006846 | Unclassified | 1365 |
| 85 | Ga0075430_100452595 | 3300006846 | Bacteria | 1059 |
| 86 | Ga0075431_100129754 | 3300006847 | Unclassified | 2600 |
| 87 | Ga0075433_10000202 | 3300006852 | Bacteria | 33478 |
| 88 | Ga0075433_10005660 | 3300006852 | Bacteria | 9818 |
| 89 | Ga0075433_10420892 | 3300006852 | Bacteria | 1178 |
| 90 | Ga0075434_100017450 | 3300006871 | Bacteria | 6917 |
| 91 | Ga0075434_100054139 | 3300006871 | Bacteria | 3986 |
| 92 | Ga0075434_100755583 | 3300006871 | Bacteria | 989 |
| 93 | Ga0075434_100983390 | 3300006871 | Bacteria | 858 |
| 94 | Ga0075434_101722575 | 3300006871 | Unclassified | 634 |
| 95 | Ga0075429_100151664 | 3300006880 | Bacteria | 2029 |
| 96 | Ga0075429_100227112 | 3300006880 | Bacteria | 1635 |
| 97 | Ga0075429_100256912 | 3300006880 | Bacteria | 1530 |
| 98 | Ga0075429_100549831 | 3300006880 | Unclassified | 1012 |
| 99 | Ga0097620_100128764 | 3300006931 | Unclassified | 2602 |
| 100 | Ga0097620_100653503 | 3300006931 | Bacteria | 1143 |
| 101 | Ga0097620_101788183 | 3300006931 | Unclassified | 679 |
| 102 | Ga0075435_100021849 | 3300007076 | Bacteria | 4930 |
| 103 | Ga0111539_10005953 | 3300009094 | Bacteria | 15750 |
| 104 | Ga0111539_10020945 | 3300009094 | Bacteria | 8050 |
| 105 | Ga0111539_10029785 | 3300009094 | Bacteria | 6643 |
| 106 | Ga0111539_10088635 | 3300009094 | Bacteria | 3635 |
| 107 | Ga0111539_10856245 | 3300009094 | Unclassified | 1058 |
| 108 | Ga0111539_11490844 | 3300009094 | Bacteria | 784 |
| 109 | Ga0114129_10018633 | 3300009147 | Bacteria | 9882 |
| 110 | Ga0114129_10019353 | 3300009147 | Bacteria | 9696 |
| 111 | Ga0114129_10054962 | 3300009147 | Bacteria | 5581 |
| 112 | Ga0114129_10074863 | 3300009147 | Bacteria | 4715 |
| 113 | Ga0114129_10131909 | 3300009147 | Bacteria | 3430 |
| 114 | Ga0114129_10355065 | 3300009147 | Unclassified | 1941 |
| 115 | Ga0114129_10765508 | 3300009147 | Bacteria | 1235 |
| 116 | Ga0114129_12096848 | 3300009147 | Bacteria | 682 |
| 117 | Ga0105248_10199314 | 3300009177 | Unclassified | 2255 |
| 118 | Ga0105248_10208460 | 3300009177 | Bacteria | 2202 |
| 119 | Ga0105249_10195478 | 3300009553 | Bacteria | 1977 |
| 120 | Ga0105249_11518947 | 3300009553 | Bacteria | 742 |
| 121 | Ga0157375_10510929 | 3300013308 | Bacteria | 1365 |
| 122 | Ga0157375_10538483 | 3300013308 | Unclassified | 1330 |
| 123 | Ga0163163_10301392 | 3300014325 | Unclassified | 1655 |
| 124 | Ga0163163_11178323 | 3300014325 | Unclassified | 829 |
| 125 | Ga0157380_10026550 | 3300014326 | Bacteria | 4397 |
| 126 | Ga0157380_10785187 | 3300014326 | Unclassified | 968 |
| 127 | Ga0157377_10586326 | 3300014745 | Bacteria | 793 |
| 128 | Ga0157377_10605708 | 3300014745 | Unclassified | 782 |
| 129 | Ga0157377_10969027 | 3300014745 | Unclassified | 641 |
| 130 | Ga0157376_10124144 | 3300014969 | Bacteria | 2293 |
| 131 | Ga0207682_10171818 | 3300025893 | Bacteria | 986 |
| 132 | Ga0207688_10045696 | 3300025901 | Bacteria | 2444 |
| 133 | Ga0207680_10356624 | 3300025903 | Bacteria | 1028 |
| 134 | Ga0207645_10262318 | 3300025907 | Bacteria | 1145 |
| 135 | Ga0207684_10764141 | 3300025910 | Unclassified | 818 |
| 136 | Ga0207684_10776370 | 3300025910 | Unclassified | 811 |
| 137 | Ga0207693_10034107 | 3300025915 | Bacteria | 4014 |
| 138 | Ga0207660_10546173 | 3300025917 | Bacteria | 942 |
| 139 | Ga0207662_10186140 | 3300025918 | Unclassified | 1338 |
| 140 | Ga0207681_10158164 | 3300025923 | Bacteria | 1705 |
| 141 | Ga0207681_10646025 | 3300025923 | Unclassified | 877 |
| 142 | Ga0207650_10051857 | 3300025925 | Bacteria | 3037 |
| 143 | Ga0207650_10583874 | 3300025925 | Bacteria | 939 |
| 144 | Ga0207650_11241840 | 3300025925 | Unclassified | 634 |
| 145 | Ga0207659_10010668 | 3300025926 | Bacteria | 5778 |
| 146 | Ga0207659_10019268 | 3300025926 | Bacteria | 4487 |
| 147 | Ga0207659_10934651 | 3300025926 | Bacteria | 746 |
| 148 | Ga0207709_10330422 | 3300025935 | Bacteria | 1144 |
| 149 | Ga0207670_10024397 | 3300025936 | Bacteria | 3779 |
| 150 | Ga0207670_10726468 | 3300025936 | Unclassified | 823 |
| 151 | Ga0207669_10736213 | 3300025937 | Bacteria | 813 |
| 152 | Ga0207669_10784855 | 3300025937 | Bacteria | 789 |
| 153 | Ga0207704_11277859 | 3300025938 | Unclassified | 627 |
| 154 | Ga0207691_10015709 | 3300025940 | Bacteria | 7196 |
| 155 | Ga0207691_10027112 | 3300025940 | Bacteria | 5375 |
| 156 | Ga0207691_10168619 | 3300025940 | Bacteria | 1918 |
| 157 | Ga0207711_10371189 | 3300025941 | Bacteria | 1327 |
| 158 | Ga0207689_10658108 | 3300025942 | Bacteria | 883 |
| 159 | Ga0207679_10232564 | 3300025945 | Bacteria | 1557 |
| 160 | Ga0207667_10565619 | 3300025949 | Bacteria | 1149 |
| 161 | Ga0207651_10008870 | 3300025960 | Bacteria | 5461 |
| 162 | Ga0207651_10033984 | 3300025960 | Bacteria | 3296 |
| 163 | Ga0207651_10222688 | 3300025960 | Bacteria | 1526 |
| 164 | Ga0207712_11480899 | 3300025961 | Unclassified | 608 |
| 165 | Ga0207640_11345422 | 3300025981 | Unclassified | 639 |
| 166 | Ga0207703_10126702 | 3300026035 | Bacteria | 2199 |
| 167 | Ga0207703_10562901 | 3300026035 | Bacteria | 1076 |
| 168 | Ga0207708_10489199 | 3300026075 | Bacteria | 1030 |
| 169 | Ga0207641_10203377 | 3300026088 | Bacteria | 1827 |
| 170 | Ga0207641_10489783 | 3300026088 | Unclassified | 1193 |
| 171 | Ga0207676_10107455 | 3300026095 | Bacteria | 2327 |
| 172 | Ga0207674_10254746 | 3300026116 | Unclassified | 1702 |
| 173 | Ga0207683_10750329 | 3300026121 | Bacteria | 905 |
| 174 | Ga0209970_1006942 | 3300027614 | Bacteria | 1857 |
| 175 | Ga0207428_10007873 | 3300027907 | Bacteria | 9690 |
| 176 | Ga0268266_10074845 | 3300028379 | Bacteria | 2941 |
| 177 | Ga0268265_10115558 | 3300028380 | Unclassified | 2200 |
| 178 | Ga0268265_10434667 | 3300028380 | Bacteria | 1222 |
| 179 | Ga0268264_10594427 | 3300028381 | Bacteria | 1090 |
| 180 | Ga0268264_11081802 | 3300028381 | Unclassified | 810 |
| 181 | Ga0268264_11315838 | 3300028381 | Unclassified | 733 |
| 182 | Ga0307408_101491951 | 3300031548 | Bacteria | 639 |
| 183 | Ga0307405_10110215 | 3300031731 | Bacteria | 1863 |
| 184 | Ga0307410_10968026 | 3300031852 | Bacteria | 732 |
| 185 | Ga0307406_10126113 | 3300031901 | Unclassified | 1789 |
| 186 | Ga0307407_10001819 | 3300031903 | Bacteria | 8003 |
| 187 | Ga0307412_10337313 | 3300031911 | Unclassified | 1205 |
| 188 | Ga0307412_10594220 | 3300031911 | Bacteria | 936 |
| 189 | Ga0307409_100119530 | 3300031995 | Bacteria | 2228 |
| 190 | Ga0307416_100004319 | 3300032002 | Bacteria | 8540 |
| 191 | Ga0307416_100832062 | 3300032002 | Bacteria | 1020 |
| 192 | Ga0307415_100002223 | 3300032126 | Bacteria | 9614 |
| 193 | Ga0373923_0068420 | 3300035111 | Bacteria | 1520 |
| 194 | Ga0373924_0006983 | 3300035410 | Bacteria | 4064 |
| 195 | Ga0373937_0002065 | 3300036401 | Bacteria | 16794 |
| 196 | Ga0439461_0058758 | 3300041410 | Bacteria | 869 |
| 197 | Ga0439461_0127381 | 3300041410 | Unclassified | 641 |
| 198 | Ga0439433_0041573 | 3300041999 | Unclassified | 1071 |
| 199 | Ga0450898_140301 | 3300042134 | Unclassified | 525 |
| 200 | Ga0439446_0073497 | 3300042156 | Bacteria | 1049 |
| 201 | Ga0439435_0106497 | 3300042436 | Bacteria | 866 |
| 202 | Ga0450916_020541 | 3300042530 | Unclassified | 903 |
| 203 | Ga0451576_0559119 | 3300045051 | Bacteria | 1202 |
| 204 | Ga0495603_0034145 | 3300046455 | Bacteria | 3060 |
| 205 | Ga0495582_0792812 | 3300046473 | Unclassified | 548 |
| 206 | Ga0495594_0205933 | 3300046499 | Bacteria | 1121 |
| 207 | Ga0495628_0199321 | 3300046516 | Bacteria | 1509 |
| 208 | Ga0495586_0175033 | 3300046535 | Unclassified | 1213 |
| 209 | Ga0495598_0207525 | 3300046537 | Unclassified | 710 |
| 210 | Ga0495621_0146255 | 3300046539 | Unclassified | 927 |
| 211 | Ga0495645_0553805 | 3300046543 | Unclassified | 712 |
| 212 | Ga0495656_0059050 | 3300046615 | Bacteria | 1667 |
| 213 | Ga0495659_0042344 | 3300046664 | Unclassified | 1630 |
| 214 | Ga0495659_0140327 | 3300046664 | Bacteria | 964 |
| 215 | Ga0495657_0317428 | 3300046675 | Unclassified | 926 |
| 216 | Ga0495623_0160589 | 3300046679 | Unclassified | 1321 |
| 217 | Ga0495647_0082038 | 3300046681 | Bacteria | 1309 |
| 218 | Ga0495675_0277018 | 3300047444 | Unclassified | 1001 |
| 219 | Ga0496108_0398542 | 3300048911 | Bacteria | 1202 |
| 220 | Ga0496110_0503341 | 3300048913 | Bacteria | 1103 |
| 221 | Ga0496113_0260925 | 3300048916 | Bacteria | 1384 |
| 222 | Ga0501031_0077857 | 3300049568 | Bacteria | 2160 |
| 223 | Ga0501036_0330112 | 3300049572 | Bacteria | 1274 |
| 224 | Ga0501038_0317392 | 3300049574 | Unclassified | 1220 |
| 225 | Ga0501039_0328902 | 3300049575 | Unclassified | 1201 |
| 226 | Ga0501039_0537994 | 3300049575 | Bacteria | 917 |
| 227 | Ga0501039_0706667 | 3300049575 | Unclassified | 788 |
| 228 | Ga0501040_0144999 | 3300049576 | Unclassified | 1673 |
| 229 | Ga0501040_0610433 | 3300049576 | Unclassified | 788 |
| 230 | Ga0501042_0301776 | 3300049578 | Bacteria | 1157 |
| 231 | Ga0501046_0665813 | 3300049580 | Unclassified | 735 |
| 232 | Ga0501071_0016531 | 3300049587 | Bacteria | 5076 |
| 233 | Ga0501071_0094423 | 3300049587 | Bacteria | 2200 |
| 234 | Ga0501071_0580161 | 3300049587 | Bacteria | 862 |
| 235 | Ga0501072_0293541 | 3300049588 | Bacteria | 1292 |
| 236 | Ga0501072_0560459 | 3300049588 | Bacteria | 902 |
| 237 | Ga0501074_0567847 | 3300049590 | Bacteria | 803 |
| 238 | Ga0501075_0875101 | 3300049591 | Unclassified | 683 |
| 239 | Ga0501075_0923218 | 3300049591 | Bacteria | 663 |
| 240 | Ga0501076_0252608 | 3300049592 | Bacteria | 1443 |
| 241 | Ga0501076_0787131 | 3300049592 | Unclassified | 785 |
| 242 | Ga0501076_0855374 | 3300049592 | Bacteria | 750 |
| 243 | Ga0501077_0214761 | 3300049593 | Unclassified | 1222 |
| 244 | Ga0501079_0468719 | 3300049741 | Unclassified | 989 |
| 245 | Ga0501035_0515468 | 3300049822 | Bacteria | 983 |
| 246 | Ga0501045_0055240 | 3300049824 | Bacteria | 2904 |
| 247 | Ga0501045_0530380 | 3300049824 | Bacteria | 874 |
| 248 | Ga0501045_0902464 | 3300049824 | Unclassified | 649 |
| 249 | nmdc:mga05p37_1029547_c1 | 3300050507 | Bacteria | 871 |
| 250 | nmdc:mga05p37_128772_c1 | 3300050507 | Bacteria | 3107 |
| 251 | nmdc:mga05p37_129618_c1 | 3300050507 | Bacteria | 3095 |
| 252 | nmdc:mga05p37_1619361_c1 | 3300050507 | Unclassified | 637 |
| 253 | nmdc:mga05p37_326148_c1 | 3300050507 | Bacteria | 1815 |
| 254 | nmdc:mga05p37_80663_c1 | 3300050507 | Bacteria | 4008 |
| 255 | nmdc:mga09592_173570_c1 | 3300050508 | Unclassified | 1864 |
| 256 | nmdc:mga09592_241559_c1 | 3300050508 | Unclassified | 1565 |
| 257 | nmdc:mga09592_803768_c1 | 3300050508 | Bacteria | 795 |
| 258 | nmdc:mga0qj67_17069_c1 | 3300050509 | Bacteria | 5515 |
| 259 | nmdc:mga0qj67_262032_c1 | 3300050509 | Bacteria | 1402 |
| 260 | nmdc:mga0qj67_462286_c1 | 3300050509 | Bacteria | 1022 |
| 261 | nmdc:mga0qj67_641010_c1 | 3300050509 | Unclassified | 848 |
| 262 | nmdc:mga06r32_1229671_c1 | 3300050510 | Unclassified | 695 |
| 263 | nmdc:mga06r32_722332_c1 | 3300050510 | Bacteria | 961 |
| 264 | nmdc:mga08y16_1023611_c1 | 3300050511 | Unclassified | 805 |
| 265 | nmdc:mga08y16_10473_c1 | 3300050511 | Bacteria | 9727 |
| 266 | nmdc:mga08y16_1273078_c1 | 3300050511 | Unclassified | 703 |
| 267 | nmdc:mga08y16_206959_c1 | 3300050511 | Unclassified | 2032 |
| 268 | nmdc:mga08y16_90828_c1 | 3300050511 | Bacteria | 3183 |
| 269 | nmdc:mga0n895_1262030_c1 | 3300050512 | Bacteria | 711 |
| 270 | nmdc:mga0n895_1486980_c1 | 3300050512 | Unclassified | 644 |
| 271 | nmdc:mga0n895_353995_c1 | 3300050512 | Bacteria | 1487 |
| 272 | nmdc:mga0n895_515621_c1 | 3300050512 | Bacteria | 1203 |
| 273 | nmdc:mga0n895_65604_c1 | 3300050512 | Bacteria | 3594 |
| 274 | nmdc:mga0n895_777918_c1 | 3300050512 | Unclassified | 949 |
| 275 | nmdc:mga0rr50_100870_c1 | 3300050513 | Bacteria | 2268 |
| 276 | nmdc:mga08x19_63954_c1 | 3300050514 | Bacteria | 2388 |
| 277 | nmdc:mga0a205_1129949_c1 | 3300050515 | Unclassified | 631 |
| 278 | nmdc:mga0a205_23716_c1 | 3300050515 | Bacteria | 5821 |
| 279 | nmdc:mga0a205_304740_c1 | 3300050515 | Bacteria | 1465 |
| 280 | nmdc:mga0a205_42969_c1 | 3300050515 | Bacteria | 3904 |
| 281 | nmdc:mga0a205_729196_c1 | 3300050515 | Unclassified | 840 |
| 282 | nmdc:mga0a205_76_c1 | 3300050515 | Bacteria | 54611 |
| 283 | Ga0501084_0123092 | 3300054114 | Unclassified | 2181 |
| 284 | Ga0501084_0375772 | 3300054114 | Unclassified | 1201 |
| 285 | Ga0501084_0674350 | 3300054114 | Unclassified | 872 |
| 286 | Ga0501082_0158062 | 3300060353 | Bacteria | 1969 |
| 287 | Ga0501082_0206986 | 3300060353 | Bacteria | 1707 |
| 288 | Ga0501082_0355183 | 3300060353 | Unclassified | 1278 |
| 289 | Ga0501082_0461810 | 3300060353 | Bacteria | 1110 |
| 290 | Ga0530510_0304826 | 3300061734 | Unclassified | 1192 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100052717 | Ga0070668_1000527174 | 129 |
| 2 | 3300005356 | Ga0070674_100122665 | Ga0070674_1001226652 | 142 |
| 3 | 3300031911 | Ga0307412_10337313 | Ga0307412_103373132 | 144 |
| 4 | 3300050514 | nmdc:mga08x19_63954_c1 | nmdc:mga08x19_63954_c1_874_1353 | 146 |
| 5 | 3300005445 | Ga0070708_100710333 | Ga0070708_1007103331 | 147 |
| 6 | 3300005843 | Ga0068860_100633937 | Ga0068860_1006339371 | 147 |
| 7 | 3300009147 | Ga0114129_10765508 | Ga0114129_107655082 | 147 |
| 8 | 3300005456 | Ga0070678_100127577 | Ga0070678_1001275772 | 155 |
| 9 | 3300005543 | Ga0070672_100377357 | Ga0070672_1003773572 | 155 |
| 10 | 3300005295 | Ga0065707_10355448 | Ga0065707_103554482 | 156 |
| 11 | 3300005295 | Ga0065707_10903745 | Ga0065707_109037451 | 156 |
| 12 | 3300005843 | Ga0068860_101205656 | Ga0068860_1012056561 | 156 |
| 13 | 3300009094 | Ga0111539_10029785 | Ga0111539_100297858 | 156 |
| 14 | 3300028381 | Ga0268264_11081802 | Ga0268264_110818022 | 156 |
| 15 | 3300046455 | Ga0495603_0034145 | Ga0495603_0034145_2252_2728 | 156 |
| 16 | 3300046473 | Ga0495582_0792812 | Ga0495582_0792812_34_510 | 156 |
| 17 | 3300046499 | Ga0495594_0205933 | Ga0495594_0205933_326_802 | 156 |
| 18 | 3300046681 | Ga0495647_0082038 | Ga0495647_0082038_126_602 | 156 |
| 19 | 3300050511 | nmdc:mga08y16_90828_c1 | nmdc:mga08y16_90828_c1_1584_2066 | 156 |
| 20 | 3300005290 | Ga0065712_10017653 | Ga0065712_100176531 | 157 |
| 21 | 3300005290 | Ga0065712_10222040 | Ga0065712_102220401 | 157 |
| 22 | 3300005293 | Ga0065715_10020365 | Ga0065715_100203652 | 157 |
| 23 | 3300005295 | Ga0065707_10085282 | Ga0065707_100852825 | 157 |
| 24 | 3300005328 | Ga0070676_10475247 | Ga0070676_104752472 | 157 |
| 25 | 3300005330 | Ga0070690_100118294 | Ga0070690_1001182942 | 157 |
| 26 | 3300005331 | Ga0070670_100128025 | Ga0070670_1001280253 | 157 |
| 27 | 3300005331 | Ga0070670_100740925 | Ga0070670_1007409252 | 157 |
| 28 | 3300005331 | Ga0070670_101578230 | Ga0070670_1015782301 | 157 |
| 29 | 3300005334 | Ga0068869_100071342 | Ga0068869_1000713423 | 157 |
| 30 | 3300005335 | Ga0070666_10451138 | Ga0070666_104511382 | 157 |
| 31 | 3300005335 | Ga0070666_10805016 | Ga0070666_108050161 | 157 |
| 32 | 3300005337 | Ga0070682_100215854 | Ga0070682_1002158542 | 157 |
| 33 | 3300005338 | Ga0068868_101314804 | Ga0068868_1013148041 | 157 |
| 34 | 3300005340 | Ga0070689_100086100 | Ga0070689_1000861002 | 157 |
| 35 | 3300005340 | Ga0070689_100473840 | Ga0070689_1004738401 | 157 |
| 36 | 3300005340 | Ga0070689_100607565 | Ga0070689_1006075651 | 157 |
| 37 | 3300005341 | Ga0070691_10632932 | Ga0070691_106329321 | 157 |
| 38 | 3300005347 | Ga0070668_100125781 | Ga0070668_1001257813 | 157 |
| 39 | 3300005353 | Ga0070669_100225516 | Ga0070669_1002255161 | 157 |
| 40 | 3300005354 | Ga0070675_100013444 | Ga0070675_1000134443 | 157 |
| 41 | 3300005354 | Ga0070675_100029407 | Ga0070675_1000294071 | 157 |
| 42 | 3300005354 | Ga0070675_100107354 | Ga0070675_1001073542 | 157 |
| 43 | 3300005354 | Ga0070675_100135308 | Ga0070675_1001353082 | 157 |
| 44 | 3300005355 | Ga0070671_100068799 | Ga0070671_1000687994 | 157 |
| 45 | 3300005356 | Ga0070674_100322607 | Ga0070674_1003226072 | 157 |
| 46 | 3300005356 | Ga0070674_101219757 | Ga0070674_1012197571 | 157 |
| 47 | 3300005364 | Ga0070673_100132015 | Ga0070673_1001320151 | 157 |
| 48 | 3300005364 | Ga0070673_100795462 | Ga0070673_1007954622 | 157 |
| 49 | 3300005365 | Ga0070688_100025577 | Ga0070688_1000255775 | 157 |
| 50 | 3300005365 | Ga0070688_100427063 | Ga0070688_1004270631 | 157 |
| 51 | 3300005440 | Ga0070705_100053529 | Ga0070705_1000535291 | 157 |
| 52 | 3300005444 | Ga0070694_100221937 | Ga0070694_1002219372 | 157 |
| 53 | 3300005444 | Ga0070694_100894855 | Ga0070694_1008948552 | 157 |
| 54 | 3300005456 | Ga0070678_100113686 | Ga0070678_1001136863 | 157 |
| 55 | 3300005456 | Ga0070678_100199610 | Ga0070678_1001996103 | 157 |
| 56 | 3300005466 | Ga0070685_10040597 | Ga0070685_100405975 | 157 |
| 57 | 3300005467 | Ga0070706_100486528 | Ga0070706_1004865282 | 157 |
| 58 | 3300005467 | Ga0070706_100898684 | Ga0070706_1008986842 | 157 |
| 59 | 3300005468 | Ga0070707_100227127 | Ga0070707_1002271272 | 157 |
| 60 | 3300005471 | Ga0070698_100426151 | Ga0070698_1004261512 | 157 |
| 61 | 3300005518 | Ga0070699_100003006 | Ga0070699_10000300617 | 157 |
| 62 | 3300005535 | Ga0070684_101846564 | Ga0070684_1018465641 | 157 |
| 63 | 3300005536 | Ga0070697_100103126 | Ga0070697_1001031262 | 157 |
| 64 | 3300005543 | Ga0070672_100028569 | Ga0070672_1000285697 | 157 |
| 65 | 3300005543 | Ga0070672_100326489 | Ga0070672_1003264892 | 157 |
| 66 | 3300005543 | Ga0070672_100387663 | Ga0070672_1003876631 | 157 |
| 67 | 3300005543 | Ga0070672_100606205 | Ga0070672_1006062052 | 157 |
| 68 | 3300005544 | Ga0070686_100091676 | Ga0070686_1000916762 | 157 |
| 69 | 3300005544 | Ga0070686_100350710 | Ga0070686_1003507101 | 157 |
| 70 | 3300005545 | Ga0070695_100704926 | Ga0070695_1007049262 | 157 |
| 71 | 3300005545 | Ga0070695_101294515 | Ga0070695_1012945151 | 157 |
| 72 | 3300005548 | Ga0070665_100131781 | Ga0070665_1001317812 | 157 |
| 73 | 3300005549 | Ga0070704_100092059 | Ga0070704_1000920595 | 157 |
| 74 | 3300005549 | Ga0070704_100473643 | Ga0070704_1004736432 | 157 |
| 75 | 3300005563 | Ga0068855_100310968 | Ga0068855_1003109684 | 157 |
| 76 | 3300005564 | Ga0070664_100127068 | Ga0070664_1001270682 | 157 |
| 77 | 3300005564 | Ga0070664_101223973 | Ga0070664_1012239732 | 157 |
| 78 | 3300005577 | Ga0068857_100055811 | Ga0068857_1000558116 | 157 |
| 79 | 3300005578 | Ga0068854_101484817 | Ga0068854_1014848172 | 157 |
| 80 | 3300005617 | Ga0068859_100128766 | Ga0068859_1001287664 | 157 |
| 81 | 3300005617 | Ga0068859_100653475 | Ga0068859_1006534752 | 157 |
| 82 | 3300005617 | Ga0068859_101788095 | Ga0068859_1017880951 | 157 |
| 83 | 3300005618 | Ga0068864_100047813 | Ga0068864_1000478132 | 157 |
| 84 | 3300005618 | Ga0068864_100163523 | Ga0068864_1001635231 | 157 |
| 85 | 3300005840 | Ga0068870_10132635 | Ga0068870_101326352 | 157 |
| 86 | 3300005841 | Ga0068863_100135455 | Ga0068863_1001354553 | 157 |
| 87 | 3300005842 | Ga0068858_100619170 | Ga0068858_1006191701 | 157 |
| 88 | 3300005843 | Ga0068860_100790722 | Ga0068860_1007907221 | 157 |
| 89 | 3300005843 | Ga0068860_100971750 | Ga0068860_1009717502 | 157 |
| 90 | 3300006358 | Ga0068871_100449633 | Ga0068871_1004496332 | 157 |
| 91 | 3300006844 | Ga0075428_100095026 | Ga0075428_1000950262 | 157 |
| 92 | 3300006844 | Ga0075428_100444998 | Ga0075428_1004449982 | 157 |
| 93 | 3300006846 | Ga0075430_100029161 | Ga0075430_1000291615 | 157 |
| 94 | 3300006846 | Ga0075430_100285510 | Ga0075430_1002855102 | 157 |
| 95 | 3300006846 | Ga0075430_100452595 | Ga0075430_1004525952 | 157 |
| 96 | 3300006847 | Ga0075431_100129754 | Ga0075431_1001297543 | 157 |
| 97 | 3300006852 | Ga0075433_10000202 | Ga0075433_100002023 | 157 |
| 98 | 3300006852 | Ga0075433_10005660 | Ga0075433_100056606 | 157 |
| 99 | 3300006852 | Ga0075433_10420892 | Ga0075433_104208922 | 157 |
| 100 | 3300006871 | Ga0075434_100017450 | Ga0075434_1000174502 | 157 |
| 101 | 3300006871 | Ga0075434_100054139 | Ga0075434_1000541392 | 157 |
| 102 | 3300006871 | Ga0075434_100755583 | Ga0075434_1007555832 | 157 |
| 103 | 3300006871 | Ga0075434_100983390 | Ga0075434_1009833902 | 157 |
| 104 | 3300006871 | Ga0075434_101722575 | Ga0075434_1017225751 | 157 |
| 105 | 3300006880 | Ga0075429_100151664 | Ga0075429_1001516642 | 157 |
| 106 | 3300006880 | Ga0075429_100227112 | Ga0075429_1002271123 | 157 |
| 107 | 3300006880 | Ga0075429_100256912 | Ga0075429_1002569123 | 157 |
| 108 | 3300006880 | Ga0075429_100549831 | Ga0075429_1005498312 | 157 |
| 109 | 3300006931 | Ga0097620_100128764 | Ga0097620_1001287644 | 157 |
| 110 | 3300006931 | Ga0097620_100653503 | Ga0097620_1006535032 | 157 |
| 111 | 3300006931 | Ga0097620_101788183 | Ga0097620_1017881831 | 157 |
| 112 | 3300007076 | Ga0075435_100021849 | Ga0075435_1000218493 | 157 |
| 113 | 3300009094 | Ga0111539_10005953 | Ga0111539_100059533 | 157 |
| 114 | 3300009094 | Ga0111539_10020945 | Ga0111539_100209456 | 157 |
| 115 | 3300009094 | Ga0111539_10088635 | Ga0111539_100886353 | 157 |
| 116 | 3300009094 | Ga0111539_10856245 | Ga0111539_108562451 | 157 |
| 117 | 3300009094 | Ga0111539_11490844 | Ga0111539_114908441 | 157 |
| 118 | 3300009147 | Ga0114129_10018633 | Ga0114129_100186332 | 157 |
| 119 | 3300009147 | Ga0114129_10019353 | Ga0114129_1001935311 | 157 |
| 120 | 3300009147 | Ga0114129_10054962 | Ga0114129_100549623 | 157 |
| 121 | 3300009147 | Ga0114129_10074863 | Ga0114129_100748631 | 157 |
| 122 | 3300009147 | Ga0114129_10131909 | Ga0114129_101319092 | 157 |
| 123 | 3300009147 | Ga0114129_10355065 | Ga0114129_103550654 | 157 |
| 124 | 3300009147 | Ga0114129_12096848 | Ga0114129_120968482 | 157 |
| 125 | 3300009177 | Ga0105248_10199314 | Ga0105248_101993142 | 157 |
| 126 | 3300009177 | Ga0105248_10208460 | Ga0105248_102084603 | 157 |
| 127 | 3300009553 | Ga0105249_10195478 | Ga0105249_101954782 | 157 |
| 128 | 3300009553 | Ga0105249_11518947 | Ga0105249_115189471 | 157 |
| 129 | 3300013308 | Ga0157375_10510929 | Ga0157375_105109293 | 157 |
| 130 | 3300013308 | Ga0157375_10538483 | Ga0157375_105384832 | 157 |
| 131 | 3300014325 | Ga0163163_10301392 | Ga0163163_103013924 | 157 |
| 132 | 3300014325 | Ga0163163_11178323 | Ga0163163_111783231 | 157 |
| 133 | 3300014326 | Ga0157380_10026550 | Ga0157380_100265502 | 157 |
| 134 | 3300014326 | Ga0157380_10785187 | Ga0157380_107851872 | 157 |
| 135 | 3300014745 | Ga0157377_10586326 | Ga0157377_105863262 | 157 |
| 136 | 3300014745 | Ga0157377_10605708 | Ga0157377_106057082 | 157 |
| 137 | 3300014745 | Ga0157377_10969027 | Ga0157377_109690271 | 157 |
| 138 | 3300014969 | Ga0157376_10124144 | Ga0157376_101241444 | 157 |
| 139 | 3300025893 | Ga0207682_10171818 | Ga0207682_101718182 | 157 |
| 140 | 3300025901 | Ga0207688_10045696 | Ga0207688_100456963 | 157 |
| 141 | 3300025903 | Ga0207680_10356624 | Ga0207680_103566241 | 157 |
| 142 | 3300025907 | Ga0207645_10262318 | Ga0207645_102623182 | 157 |
| 143 | 3300025910 | Ga0207684_10764141 | Ga0207684_107641412 | 157 |
| 144 | 3300025910 | Ga0207684_10776370 | Ga0207684_107763701 | 157 |
| 145 | 3300025915 | Ga0207693_10034107 | Ga0207693_100341073 | 157 |
| 146 | 3300025917 | Ga0207660_10546173 | Ga0207660_105461731 | 157 |
| 147 | 3300025918 | Ga0207662_10186140 | Ga0207662_101861402 | 157 |
| 148 | 3300025923 | Ga0207681_10158164 | Ga0207681_101581643 | 157 |
| 149 | 3300025923 | Ga0207681_10646025 | Ga0207681_106460252 | 157 |
| 150 | 3300025925 | Ga0207650_10051857 | Ga0207650_100518574 | 157 |
| 151 | 3300025925 | Ga0207650_10583874 | Ga0207650_105838742 | 157 |
| 152 | 3300025925 | Ga0207650_11241840 | Ga0207650_112418401 | 157 |
| 153 | 3300025926 | Ga0207659_10010668 | Ga0207659_100106685 | 157 |
| 154 | 3300025926 | Ga0207659_10019268 | Ga0207659_100192687 | 157 |
| 155 | 3300025926 | Ga0207659_10934651 | Ga0207659_109346512 | 157 |
| 156 | 3300025935 | Ga0207709_10330422 | Ga0207709_103304222 | 157 |
| 157 | 3300025936 | Ga0207670_10024397 | Ga0207670_100243974 | 157 |
| 158 | 3300025936 | Ga0207670_10726468 | Ga0207670_107264682 | 157 |
| 159 | 3300025937 | Ga0207669_10736213 | Ga0207669_107362131 | 157 |
| 160 | 3300025937 | Ga0207669_10784855 | Ga0207669_107848551 | 157 |
| 161 | 3300025938 | Ga0207704_11277859 | Ga0207704_112778591 | 157 |
| 162 | 3300025940 | Ga0207691_10015709 | Ga0207691_100157093 | 157 |
| 163 | 3300025940 | Ga0207691_10027112 | Ga0207691_100271126 | 157 |
| 164 | 3300025940 | Ga0207691_10168619 | Ga0207691_101686191 | 157 |
| 165 | 3300025941 | Ga0207711_10371189 | Ga0207711_103711892 | 157 |
| 166 | 3300025942 | Ga0207689_10658108 | Ga0207689_106581082 | 157 |
| 167 | 3300025945 | Ga0207679_10232564 | Ga0207679_102325641 | 157 |
| 168 | 3300025949 | Ga0207667_10565619 | Ga0207667_105656192 | 157 |
| 169 | 3300025960 | Ga0207651_10008870 | Ga0207651_100088704 | 157 |
| 170 | 3300025960 | Ga0207651_10033984 | Ga0207651_100339842 | 157 |
| 171 | 3300025960 | Ga0207651_10222688 | Ga0207651_102226881 | 157 |
| 172 | 3300025961 | Ga0207712_11480899 | Ga0207712_114808991 | 157 |
| 173 | 3300025981 | Ga0207640_11345422 | Ga0207640_113454221 | 157 |
| 174 | 3300026035 | Ga0207703_10126702 | Ga0207703_101267023 | 157 |
| 175 | 3300026035 | Ga0207703_10562901 | Ga0207703_105629011 | 157 |
| 176 | 3300026075 | Ga0207708_10489199 | Ga0207708_104891992 | 157 |
| 177 | 3300026088 | Ga0207641_10203377 | Ga0207641_102033772 | 157 |
| 178 | 3300026088 | Ga0207641_10489783 | Ga0207641_104897832 | 157 |
| 179 | 3300026095 | Ga0207676_10107455 | Ga0207676_101074552 | 157 |
| 180 | 3300026116 | Ga0207674_10254746 | Ga0207674_102547463 | 157 |
| 181 | 3300026121 | Ga0207683_10750329 | Ga0207683_107503292 | 157 |
| 182 | 3300027614 | Ga0209970_1006942 | Ga0209970_10069423 | 157 |
| 183 | 3300027907 | Ga0207428_10007873 | Ga0207428_100078734 | 157 |
| 184 | 3300028379 | Ga0268266_10074845 | Ga0268266_100748452 | 157 |
| 185 | 3300028380 | Ga0268265_10115558 | Ga0268265_101155583 | 157 |
| 186 | 3300028380 | Ga0268265_10434667 | Ga0268265_104346671 | 157 |
| 187 | 3300028381 | Ga0268264_10594427 | Ga0268264_105944271 | 157 |
| 188 | 3300028381 | Ga0268264_11315838 | Ga0268264_113158382 | 157 |
| 189 | 3300031548 | Ga0307408_101491951 | Ga0307408_1014919511 | 157 |
| 190 | 3300031731 | Ga0307405_10110215 | Ga0307405_101102153 | 157 |
| 191 | 3300031852 | Ga0307410_10968026 | Ga0307410_109680262 | 157 |
| 192 | 3300031901 | Ga0307406_10126113 | Ga0307406_101261132 | 157 |
| 193 | 3300031903 | Ga0307407_10001819 | Ga0307407_100018195 | 157 |
| 194 | 3300031911 | Ga0307412_10594220 | Ga0307412_105942202 | 157 |
| 195 | 3300031995 | Ga0307409_100119530 | Ga0307409_1001195303 | 157 |
| 196 | 3300032002 | Ga0307416_100004319 | Ga0307416_1000043196 | 157 |
| 197 | 3300032002 | Ga0307416_100832062 | Ga0307416_1008320622 | 157 |
| 198 | 3300032126 | Ga0307415_100002223 | Ga0307415_1000022235 | 157 |
| 199 | 3300035111 | Ga0373923_0068420 | Ga0373923_0068420_356_832 | 157 |
| 200 | 3300035410 | Ga0373924_0006983 | Ga0373924_0006983_3527_4003 | 157 |
| 201 | 3300036401 | Ga0373937_0002065 | Ga0373937_0002065_1576_2052 | 157 |
| 202 | 3300041410 | Ga0439461_0058758 | Ga0439461_0058758_49_522 | 157 |
| 203 | 3300041410 | Ga0439461_0127381 | Ga0439461_0127381_57_530 | 157 |
| 204 | 3300041999 | Ga0439433_0041573 | Ga0439433_0041573_526_999 | 157 |
| 205 | 3300042134 | Ga0450898_140301 | Ga0450898_140301_16_489 | 157 |
| 206 | 3300042156 | Ga0439446_0073497 | Ga0439446_0073497_168_641 | 157 |
| 207 | 3300042436 | Ga0439435_0106497 | Ga0439435_0106497_202_675 | 157 |
| 208 | 3300042530 | Ga0450916_020541 | Ga0450916_020541_51_527 | 157 |
| 209 | 3300045051 | Ga0451576_0559119 | Ga0451576_0559119_661_1134 | 157 |
| 210 | 3300046516 | Ga0495628_0199321 | Ga0495628_0199321_524_1000 | 157 |
| 211 | 3300046535 | Ga0495586_0175033 | Ga0495586_0175033_396_872 | 157 |
| 212 | 3300046537 | Ga0495598_0207525 | Ga0495598_0207525_97_579 | 157 |
| 213 | 3300046539 | Ga0495621_0146255 | Ga0495621_0146255_356_829 | 157 |
| 214 | 3300046543 | Ga0495645_0553805 | Ga0495645_0553805_138_614 | 157 |
| 215 | 3300046615 | Ga0495656_0059050 | Ga0495656_0059050_1129_1602 | 157 |
| 216 | 3300046664 | Ga0495659_0042344 | Ga0495659_0042344_850_1323 | 157 |
| 217 | 3300046664 | Ga0495659_0140327 | Ga0495659_0140327_275_748 | 157 |
| 218 | 3300046675 | Ga0495657_0317428 | Ga0495657_0317428_271_747 | 157 |
| 219 | 3300046679 | Ga0495623_0160589 | Ga0495623_0160589_371_847 | 157 |
| 220 | 3300047444 | Ga0495675_0277018 | Ga0495675_0277018_419_895 | 157 |
| 221 | 3300048911 | Ga0496108_0398542 | Ga0496108_0398542_138_611 | 157 |
| 222 | 3300048913 | Ga0496110_0503341 | Ga0496110_0503341_577_1050 | 157 |
| 223 | 3300048916 | Ga0496113_0260925 | Ga0496113_0260925_796_1269 | 157 |
| 224 | 3300049568 | Ga0501031_0077857 | Ga0501031_0077857_1644_2120 | 157 |
| 225 | 3300049572 | Ga0501036_0330112 | Ga0501036_0330112_106_579 | 157 |
| 226 | 3300049574 | Ga0501038_0317392 | Ga0501038_0317392_413_889 | 157 |
| 227 | 3300049575 | Ga0501039_0328902 | Ga0501039_0328902_199_675 | 157 |
| 228 | 3300049575 | Ga0501039_0537994 | Ga0501039_0537994_351_833 | 157 |
| 229 | 3300049575 | Ga0501039_0706667 | Ga0501039_0706667_60_545 | 157 |
| 230 | 3300049576 | Ga0501040_0144999 | Ga0501040_0144999_456_929 | 157 |
| 231 | 3300049576 | Ga0501040_0610433 | Ga0501040_0610433_33_518 | 157 |
| 232 | 3300049578 | Ga0501042_0301776 | Ga0501042_0301776_470_952 | 157 |
| 233 | 3300049580 | Ga0501046_0665813 | Ga0501046_0665813_75_560 | 157 |
| 234 | 3300049587 | Ga0501071_0016531 | Ga0501071_0016531_2063_2539 | 157 |
| 235 | 3300049587 | Ga0501071_0094423 | Ga0501071_0094423_1127_1600 | 157 |
| 236 | 3300049587 | Ga0501071_0580161 | Ga0501071_0580161_147_620 | 157 |
| 237 | 3300049588 | Ga0501072_0293541 | Ga0501072_0293541_258_731 | 157 |
| 238 | 3300049588 | Ga0501072_0560459 | Ga0501072_0560459_98_571 | 157 |
| 239 | 3300049590 | Ga0501074_0567847 | Ga0501074_0567847_201_683 | 157 |
| 240 | 3300049591 | Ga0501075_0875101 | Ga0501075_0875101_80_553 | 157 |
| 241 | 3300049591 | Ga0501075_0923218 | Ga0501075_0923218_10_483 | 157 |
| 242 | 3300049592 | Ga0501076_0252608 | Ga0501076_0252608_140_625 | 157 |
| 243 | 3300049592 | Ga0501076_0787131 | Ga0501076_0787131_110_586 | 157 |
| 244 | 3300049592 | Ga0501076_0855374 | Ga0501076_0855374_84_557 | 157 |
| 245 | 3300049593 | Ga0501077_0214761 | Ga0501077_0214761_202_678 | 157 |
| 246 | 3300049741 | Ga0501079_0468719 | Ga0501079_0468719_117_593 | 157 |
| 247 | 3300049822 | Ga0501035_0515468 | Ga0501035_0515468_84_557 | 157 |
| 248 | 3300049824 | Ga0501045_0055240 | Ga0501045_0055240_11_496 | 157 |
| 249 | 3300049824 | Ga0501045_0530380 | Ga0501045_0530380_357_839 | 157 |
| 250 | 3300049824 | Ga0501045_0902464 | Ga0501045_0902464_78_554 | 157 |
| 251 | 3300050507 | nmdc:mga05p37_1029547_c1 | nmdc:mga05p37_1029547_c1_271_771 | 157 |
| 252 | 3300050507 | nmdc:mga05p37_128772_c1 | nmdc:mga05p37_128772_c1_75_566 | 157 |
| 253 | 3300050507 | nmdc:mga05p37_129618_c1 | nmdc:mga05p37_129618_c1_2059_2532 | 157 |
| 254 | 3300050507 | nmdc:mga05p37_1619361_c1 | nmdc:mga05p37_1619361_c1_42_515 | 157 |
| 255 | 3300050507 | nmdc:mga05p37_326148_c1 | nmdc:mga05p37_326148_c1_317_790 | 157 |
| 256 | 3300050507 | nmdc:mga05p37_80663_c1 | nmdc:mga05p37_80663_c1_3502_3975 | 157 |
| 257 | 3300050508 | nmdc:mga09592_173570_c1 | nmdc:mga09592_173570_c1_988_1461 | 157 |
| 258 | 3300050508 | nmdc:mga09592_241559_c1 | nmdc:mga09592_241559_c1_692_1165 | 157 |
| 259 | 3300050508 | nmdc:mga09592_803768_c1 | nmdc:mga09592_803768_c1_165_638 | 157 |
| 260 | 3300050509 | nmdc:mga0qj67_17069_c1 | nmdc:mga0qj67_17069_c1_1492_1965 | 157 |
| 261 | 3300050509 | nmdc:mga0qj67_262032_c1 | nmdc:mga0qj67_262032_c1_128_601 | 157 |
| 262 | 3300050509 | nmdc:mga0qj67_462286_c1 | nmdc:mga0qj67_462286_c1_69_542 | 157 |
| 263 | 3300050509 | nmdc:mga0qj67_641010_c1 | nmdc:mga0qj67_641010_c1_179_652 | 157 |
| 264 | 3300050510 | nmdc:mga06r32_1229671_c1 | nmdc:mga06r32_1229671_c1_212_685 | 157 |
| 265 | 3300050510 | nmdc:mga06r32_722332_c1 | nmdc:mga06r32_722332_c1_403_876 | 157 |
| 266 | 3300050511 | nmdc:mga08y16_1023611_c1 | nmdc:mga08y16_1023611_c1_152_625 | 157 |
| 267 | 3300050511 | nmdc:mga08y16_10473_c1 | nmdc:mga08y16_10473_c1_4721_5194 | 157 |
| 268 | 3300050511 | nmdc:mga08y16_1273078_c1 | nmdc:mga08y16_1273078_c1_75_548 | 157 |
| 269 | 3300050511 | nmdc:mga08y16_206959_c1 | nmdc:mga08y16_206959_c1_486_959 | 157 |
| 270 | 3300050512 | nmdc:mga0n895_1262030_c1 | nmdc:mga0n895_1262030_c1_174_647 | 157 |
| 271 | 3300050512 | nmdc:mga0n895_1486980_c1 | nmdc:mga0n895_1486980_c1_47_523 | 157 |
| 272 | 3300050512 | nmdc:mga0n895_353995_c1 | nmdc:mga0n895_353995_c1_427_900 | 157 |
| 273 | 3300050512 | nmdc:mga0n895_515621_c1 | nmdc:mga0n895_515621_c1_153_626 | 157 |
| 274 | 3300050512 | nmdc:mga0n895_65604_c1 | nmdc:mga0n895_65604_c1_2828_3301 | 157 |
| 275 | 3300050512 | nmdc:mga0n895_777918_c1 | nmdc:mga0n895_777918_c1_36_509 | 157 |
| 276 | 3300050513 | nmdc:mga0rr50_100870_c1 | nmdc:mga0rr50_100870_c1_1278_1751 | 157 |
| 277 | 3300050515 | nmdc:mga0a205_1129949_c1 | nmdc:mga0a205_1129949_c1_45_530 | 157 |
| 278 | 3300050515 | nmdc:mga0a205_23716_c1 | nmdc:mga0a205_23716_c1_3881_4354 | 157 |
| 279 | 3300050515 | nmdc:mga0a205_304740_c1 | nmdc:mga0a205_304740_c1_170_649 | 157 |
| 280 | 3300050515 | nmdc:mga0a205_42969_c1 | nmdc:mga0a205_42969_c1_1869_2342 | 157 |
| 281 | 3300050515 | nmdc:mga0a205_729196_c1 | nmdc:mga0a205_729196_c1_294_770 | 157 |
| 282 | 3300050515 | nmdc:mga0a205_76_c1 | nmdc:mga0a205_76_c1_52942_53415 | 157 |
| 283 | 3300054114 | Ga0501084_0123092 | Ga0501084_0123092_1402_1878 | 157 |
| 284 | 3300054114 | Ga0501084_0375772 | Ga0501084_0375772_588_1061 | 157 |
| 285 | 3300054114 | Ga0501084_0674350 | Ga0501084_0674350_331_807 | 157 |
| 286 | 3300060353 | Ga0501082_0158062 | Ga0501082_0158062_924_1400 | 157 |
| 287 | 3300060353 | Ga0501082_0206986 | Ga0501082_0206986_870_1355 | 157 |
| 288 | 3300060353 | Ga0501082_0355183 | Ga0501082_0355183_791_1267 | 157 |
| 289 | 3300060353 | Ga0501082_0461810 | Ga0501082_0461810_409_882 | 157 |
| 290 | 3300061734 | Ga0530510_0304826 | Ga0530510_0304826_95_571 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ou6-assembly1.cif.gz_A-2 | crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution | 0.7201 | 1 | 153 |
| 5cog-assembly1.cif.gz_A | crystal structure of yeast irc4 | 0.7102 | 7 | 151 |
| 5com-assembly2.cif.gz_B | crystal structure of uncharacterized protein q187f5 from clostridium difficile 630 | 0.7075 | 7 | 151 |
| 5cof-assembly1.cif.gz_A | crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 | 0.7043 | 7 | 155 |
| 2ou6-assembly1.cif.gz_A-2 | crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution | 0.6998 | 1 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cogA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7102 | 7 | 151 | 1.20.120.450 |
| af_P71985_5_134_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.702 | 10 | 149 | 1.20.120.450 |
| 2f22B00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6939 | 7 | 155 | 1.20.120.450 |
| af_P71985_5_134_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6802 | 10 | 149 | 1.20.120.450 |
| 2ou6A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6755 | 1 | 153 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8HLR2-F1-model_v4 | ABC transporter | 0.9808 | 1 | 157 |
|
| AF-A0A2V8HLR2-F1-model_v4 | ABC transporter | 0.9746 | 1 | 157 |
|
| AF-A0A2V7JJL8-F1-model_v4 | ABC transporter | 0.9646 | 3 | 156 |
|
| AF-A0A1M7NWC6-F1-model_v4 | DinB superfamily protein | 0.963 | 3 | 157 |
|
| AF-A0A2V8HUC6-F1-model_v4 | ABC transporter | 0.9618 | 3 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar