F389682

General Info

Members Datasets Scaffolds Average Seq Length
290 234 247 341

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1006264|Ga0081540_10062646
Length 378
Sequence MTATLTRIRQRDWRRLSRHQLFWPLLILAALLLFNLPFTPNFFSIGVRNGHLYGSLVSILYFGTVPILVALGMTLVIATGGIDLSVGAVMAISGAIACRLISHATDQNSVSLVFTAMALALLAALAAGLFNGLMVARAGVQPIVATLILMVAGRGIAQLITSGFILTELSRPYAVVGGYAAAVPTGLFIVVGFVAITAVLTRRTALGLLVESVGGNAEASRLAGVRAQRIKLMVYVFCALCAGVAGLWNSSSLGGADANNAGLWIELDAILAVVIGGTPLTGGRFSIGGTVVGALILQTLKTTIFTIGIPAQANMVFEAVVVIVICLLQSTDFRRRVGRLVRLPRPPRQRQAPPGELADAGHGPAIASVSQESVEATS

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
5 2643221647 Streptomyces sp. Root369 Isolate Unclassified
6 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
7 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
10 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
11 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
12 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
13 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
14 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
15 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
16 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
17 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
18 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
19 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
20 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
21 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
22 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
23 2891562705 Microbispora tritici MT50 Isolate Unclassified
24 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
25 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
26 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
27 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
28 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
29 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
30 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
31 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
32 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
33 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
34 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
35 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
36 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
37 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
38 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
39 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
231 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
232 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
233 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
234 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.17
Metatranscriptomes 0
Isolates 14.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 0.69
Rhizoplane 6.21
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 15.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10011562 3300002075 Bacteria 1939
2 rootH1_10075760 3300003323 Bacteria 4082
3 Ga0070658_10021387 3300005327 Bacteria 5185
4 Ga0070683_100008092 3300005329 Bacteria 8929
5 Ga0070683_100065686 3300005329 Bacteria 3378
6 Ga0070680_100006379 3300005336 Bacteria 8958
7 Ga0070689_100090311 3300005340 Bacteria 2413
8 Ga0070687_100052433 3300005343 Bacteria 2117
9 Ga0070661_100006882 3300005344 Bacteria 7844
10 Ga0070692_10054868 3300005345 Bacteria 2082
11 Ga0070673_100173323 3300005364 Bacteria 1842
12 Ga0070714_100002788 3300005435 Bacteria 12884
13 Ga0070681_10044237 3300005458 Bacteria 4456
14 Ga0070679_100019382 3300005530 Bacteria 6612
15 Ga0070684_100015005 3300005535 Bacteria 6293
16 Ga0070684_100142395 3300005535 Bacteria 2168
17 Ga0070665_100023358 3300005548 Bacteria 6224
18 Ga0070665_100379059 3300005548 Bacteria 1422
19 Ga0068855_100022348 3300005563 Bacteria 7579
20 Ga0068855_100294730 3300005563 Bacteria 1797
21 Ga0070664_100004924 3300005564 Bacteria 10695
22 Ga0070664_100201618 3300005564 Bacteria 1776
23 Ga0068854_100001959 3300005578 Bacteria 12581
24 Ga0068852_100174259 3300005616 Bacteria 2018
25 Ga0068859_100158626 3300005617 Bacteria 2341
26 Ga0068864_100006721 3300005618 Bacteria 9423
27 Ga0068863_100011728 3300005841 Bacteria 8476
28 Ga0068863_100481768 3300005841 Bacteria 1220
29 Ga0068858_100093228 3300005842 Bacteria 2803
30 Ga0081540_1006264 3300005983 Bacteria 8709
31 Ga0081539_10001082 3300005985 Bacteria 49533
32 Ga0075370_10083687 3300006353 Bacteria 1836
33 Ga0075428_100000121 3300006844 Bacteria 67666
34 Ga0075428_100017927 3300006844 Bacteria 7824
35 Ga0075430_100002428 3300006846 Bacteria 15512
36 Ga0075431_100002971 3300006847 Bacteria 16409
37 Ga0075431_100011706 3300006847 Bacteria 8850
38 Ga0075431_100337206 3300006847 Bacteria 1518
39 Ga0075429_100008977 3300006880 Bacteria 8683
40 Ga0068865_100007819 3300006881 Bacteria 6596
41 Ga0097620_100158630 3300006931 Bacteria 2341
42 Ga0105240_10023279 3300009093 Bacteria 8197
43 Ga0105245_10051980 3300009098 Bacteria 3674
44 Ga0105247_10072799 3300009101 Bacteria 2152
45 Ga0114129_10005153 3300009147 Bacteria 18399
46 Ga0105243_10068689 3300009148 Bacteria 2856
47 Ga0105243_10157022 3300009148 Bacteria 1957
48 Ga0105241_10024241 3300009174 Bacteria 4506
49 Ga0105242_10020802 3300009176 Bacteria 5147
50 Ga0105242_10158683 3300009176 Bacteria 1978
51 Ga0105248_10009702 3300009177 Bacteria 10603
52 Ga0105248_10011004 3300009177 Bacteria 9980
53 Ga0105237_10150024 3300009545 Bacteria 2327
54 Ga0105238_10009829 3300009551 Bacteria 9581
55 Ga0105238_10275533 3300009551 Bacteria 1663
56 Ga0105246_10097655 3300011119 Bacteria 2132
57 Ga0157369_10022694 3300013105 Bacteria 6999
58 Ga0157372_10133300 3300013307 Bacteria 2860
59 Ga0163163_10004523 3300014325 Bacteria 11867
60 Ga0163163_10060946 3300014325 Bacteria 3738
61 Ga0163163_10111024 3300014325 Bacteria 2771
62 Ga0182008_10004953 3300014497 Bacteria 7672
63 Ga0157379_10036111 3300014968 Bacteria 4407
64 Ga0157379_10117544 3300014968 Bacteria 2392
65 Ga0157376_10099232 3300014969 Bacteria 2540
66 Ga0183367_1009 3300015688 Bacteria 484598
67 Ga0207426_1022550 3300025302 Bacteria 2160
68 Ga0207688_10032956 3300025901 Bacteria 2864
69 Ga0207647_10009338 3300025904 Bacteria 6972
70 Ga0207647_10016979 3300025904 Bacteria 4955
71 Ga0207707_10027914 3300025912 Bacteria 4935
72 Ga0207695_10007795 3300025913 Bacteria 13557
73 Ga0207671_10008123 3300025914 Bacteria 8955
74 Ga0207660_10049626 3300025917 Bacteria 2976
75 Ga0207660_10125354 3300025917 Bacteria 1950
76 Ga0207649_10024522 3300025920 Bacteria 3507
77 Ga0207694_10013911 3300025924 Bacteria 6067
78 Ga0207659_10186438 3300025926 Bacteria 1648
79 Ga0207664_10012446 3300025929 Bacteria 6083
80 Ga0207644_10090609 3300025931 Bacteria 2279
81 Ga0207691_10037718 3300025940 Bacteria 4474
82 Ga0207711_10012325 3300025941 Bacteria 7106
83 Ga0207711_10027645 3300025941 Bacteria 4767
84 Ga0207661_10003012 3300025944 Bacteria 11649
85 Ga0207661_10046224 3300025944 Bacteria 3451
86 Ga0207661_10296020 3300025944 Bacteria 1450
87 Ga0207679_10018780 3300025945 Bacteria 4638
88 Ga0207679_10032663 3300025945 Bacteria 3657
89 Ga0207678_10025812 3300026067 Bacteria 5127
90 Ga0207702_10108112 3300026078 Bacteria 2467
91 Ga0207641_10010182 3300026088 Bacteria 7733
92 Ga0207648_10273359 3300026089 Bacteria 1510
93 Ga0207676_10098040 3300026095 Bacteria 2422
94 Ga0207674_10071379 3300026116 Bacteria 3489
95 Ga0207674_10111998 3300026116 Bacteria 2703
96 Ga0207675_100139306 3300026118 Bacteria 2304
97 Ga0207698_10169562 3300026142 Bacteria 1920
98 Ga0268266_10041733 3300028379 Bacteria 3916
99 Ga0268266_10253140 3300028379 Bacteria 1630
100 Ga0307517_10041560 3300028786 Bacteria 4961
101 Ga0307515_10004526 3300028794 Bacteria 28712
102 Ga0265340_10004165 3300031247 Bacteria 8119
103 Ga0307513_10000476 3300031456 Bacteria 57781
104 Ga0307513_10008634 3300031456 Bacteria 12986
105 Ga0307513_10019863 3300031456 Bacteria 7984
106 Ga0307509_10058669 3300031507 Bacteria 4074
107 Ga0307408_100012422 3300031548 Bacteria 5642
108 Ga0307508_10002597 3300031616 Bacteria 19002
109 Ga0307508_10014180 3300031616 Bacteria 7269
110 Ga0307508_10048809 3300031616 Bacteria 3770
111 Ga0307508_10104446 3300031616 Bacteria 2430
112 Ga0307508_10116607 3300031616 Bacteria 2272
113 Ga0307514_10016453 3300031649 Bacteria 6093
114 Ga0307516_10041629 3300031730 Bacteria 4564
115 Ga0307516_10094284 3300031730 Bacteria 2818
116 Ga0307405_10001361 3300031731 Bacteria 10255
117 Ga0307518_10152058 3300031838 Bacteria 1600
118 Ga0307406_10001653 3300031901 Bacteria 12258
119 Ga0307406_10056034 3300031901 Bacteria 2522
120 Ga0307406_10065173 3300031901 Bacteria 2367
121 Ga0307407_10006381 3300031903 Bacteria 5232
122 Ga0307409_100000234 3300031995 Bacteria 22466
123 Ga0307416_100013143 3300032002 Bacteria 5616
124 Ga0307416_100070496 3300032002 Bacteria 2899
125 Ga0307416_100140994 3300032002 Bacteria 2191
126 Ga0307415_100000003 3300032126 Bacteria 116928
127 Ga0307507_10118718 3300033179 Bacteria 2124
128 Ga0373943_0032216 3300035170 Bacteria 2491
129 Ga0373942_0001428 3300035207 Bacteria 6153
130 Ga0373925_0237824 3300037068 Bacteria 1458
131 Ga0439436_0001484 3300041404 Bacteria 6823
132 Ga0439436_0003869 3300041404 Bacteria 4584
133 Ga0439439_0002878 3300041406 Bacteria 3730
134 Ga0439439_0027117 3300041406 Bacteria 1446
135 Ga0451797_0120722 3300041453 Bacteria 2536
136 Ga0451802_1856646 3300041460 Bacteria 1879
137 Ga0451853_0190751 3300041512 Bacteria 4011
138 Ga0451853_2949179 3300041512 Bacteria 1623
139 Ga0439433_0006525 3300041999 Bacteria 2512
140 Ga0439449_0004249 3300042007 Bacteria 5538
141 Ga0439457_000747 3300042014 Bacteria 9683
142 Ga0450894_000183 3300042131 Bacteria 11292
143 Ga0450898_002048 3300042134 Bacteria 2767
144 Ga0450906_000257 3300042145 Bacteria 10247
145 Ga0439458_0000129 3300042157 Bacteria 15799
146 Ga0466961_0003521 3300044693 Bacteria 9764
147 Ga0466970_0006452 3300044765 Bacteria 5866
148 Ga0495603_0001527 3300046455 Bacteria 13521
149 Ga0495603_0006778 3300046455 Bacteria 6871
150 Ga0495629_0001210 3300046459 Bacteria 20267
151 Ga0495651_0048130 3300046462 Bacteria 3294
152 Ga0495585_0033119 3300046492 Bacteria 2927
153 Ga0495594_0004679 3300046499 Bacteria 7054
154 Ga0495594_0009881 3300046499 Bacteria 4944
155 Ga0495596_0064820 3300046500 Bacteria 1421
156 Ga0495608_0006068 3300046511 Bacteria 8579
157 Ga0495618_0026783 3300046514 Bacteria 3586
158 Ga0495628_0122571 3300046516 Bacteria 1993
159 Ga0495630_0039360 3300046517 Bacteria 3535
160 Ga0495643_0002210 3300046522 Bacteria 15864
161 Ga0495644_0047320 3300046523 Bacteria 1616
162 Ga0495663_0025013 3300046525 Bacteria 1739
163 Ga0495640_0012199 3300046533 Bacteria 6578
164 Ga0495667_0001707 3300046559 Bacteria 14582
165 Ga0495668_0077771 3300046616 Bacteria 1822
166 Ga0495625_0035607 3300046660 Bacteria 3668
167 Ga0495625_0062523 3300046660 Bacteria 2631
168 Ga0495588_0018459 3300046674 Bacteria 3402
169 Ga0495657_0105727 3300046675 Bacteria 1788
170 Ga0495613_0038873 3300046689 Bacteria 3528
171 Ga0495670_0004432 3300046691 Bacteria 6886
172 Ga0495589_0039895 3300046794 Bacteria 2345
173 Ga0495600_0049003 3300046809 Bacteria 2756
174 Ga0495660_0007528 3300046810 Bacteria 6392
175 Ga0495674_0000459 3300047319 Bacteria 36825
176 Ga0495676_0011537 3300047321 Bacteria 7968
177 Ga0495680_0001410 3300047322 Bacteria 25933
178 Ga0495677_0021057 3300047445 Bacteria 2364
179 Ga0495685_002409 3300047447 Bacteria 5864
180 Ga0495681_0005790 3300047470 Bacteria 8212
181 Ga0495686_0059037 3300047472 Bacteria 2390
182 Ga0496104_0010071 3300048907 Bacteria 8438
183 Ga0496104_0059567 3300048907 Bacteria 3615
184 Ga0496104_0320778 3300048907 Bacteria 1462
185 Ga0496105_0008579 3300048908 Bacteria 7940
186 Ga0496105_0031368 3300048908 Bacteria 4357
187 Ga0496105_0284252 3300048908 Bacteria 1333
188 Ga0496108_0006573 3300048911 Bacteria 9434
189 Ga0496108_0047473 3300048911 Bacteria 3589
190 Ga0496109_0018867 3300048912 Bacteria 6070
191 Ga0496109_0028652 3300048912 Bacteria 4983
192 Ga0496110_0033403 3300048913 Bacteria 4450
193 Ga0496110_0172019 3300048913 Bacteria 1965
194 Ga0496111_0004463 3300048914 Bacteria 8851
195 Ga0496111_0063246 3300048914 Bacteria 2684
196 Ga0496112_0011400 3300048915 Bacteria 8116
197 Ga0496113_0006695 3300048916 Bacteria 7336
198 Ga0501031_0004707 3300049568 Bacteria 8851
199 Ga0501032_0001525 3300049569 Bacteria 18459
200 Ga0501033_0005395 3300049570 Bacteria 10132
201 Ga0501034_0004749 3300049571 Bacteria 15041
202 Ga0501036_0007960 3300049572 Bacteria 8674
203 Ga0501037_0012532 3300049573 Bacteria 6245
204 Ga0501038_0000223 3300049574 Bacteria 48354
205 Ga0501039_0008140 3300049575 Bacteria 7987
206 Ga0501040_0009773 3300049576 Bacteria 6263
207 Ga0501041_0023324 3300049577 Bacteria 3711
208 Ga0501042_0021573 3300049578 Bacteria 4491
209 Ga0501043_0000513 3300049579 Bacteria 34841
210 Ga0501046_0013830 3300049580 Bacteria 6818
211 Ga0501046_0182640 3300049580 Bacteria 1568
212 Ga0501047_0000433 3300049581 Bacteria 46523
213 Ga0501047_0165129 3300049581 Bacteria 2085
214 Ga0501048_0009945 3300049582 Bacteria 7122
215 Ga0501067_0003704 3300049583 Bacteria 8420
216 Ga0501070_0098314 3300049586 Bacteria 2421
217 Ga0501071_0003658 3300049587 Bacteria 9646
218 Ga0501073_0052699 3300049589 Bacteria 2848
219 Ga0501077_0014529 3300049593 Bacteria 4949
220 Ga0501079_0015724 3300049741 Bacteria 5780
221 Ga0501080_0125007 3300049742 Bacteria 2382
222 Ga0501035_0000624 3300049822 Bacteria 38958
223 Ga0501044_0004307 3300049823 Bacteria 15958
224 Ga0501045_0008143 3300049824 Bacteria 7302
225 nmdc:mga03n38_127144_c1 3300050490 Bacteria 1259
226 nmdc:mga03n38_15401_c1 3300050490 Bacteria 2952
227 nmdc:mga07m45_70494_c1 3300050496 Bacteria 1988
228 nmdc:mga05p37_35352_c1 3300050507 Bacteria 6126
229 nmdc:mga09592_14241_c1 3300050508 Bacteria 6493
230 nmdc:mga0qj67_11974_c1 3300050509 Bacteria 6517
231 nmdc:mga06r32_9976_c1 3300050510 Bacteria 8568
232 Ga0495601_0015623 3300053077 Bacteria 4590
233 Ga0495612_0023490 3300053078 Bacteria 2474
234 Ga0500610_0050402 3300053079 Bacteria 2167
235 Ga0495619_0015291 3300053085 Bacteria 4854
236 Ga0495619_0149526 3300053085 Bacteria 1611
237 Ga0500646_0002690 3300053090 Bacteria 4589
238 Ga0500566_0065238 3300053094 Bacteria 2054
239 Ga0500559_0000078 3300053136 Bacteria 76033
240 Ga0500573_0000011 3300053140 Bacteria 209484
241 Ga0500573_0002508 3300053140 Bacteria 9196
242 Ga0500573_0021909 3300053140 Bacteria 3666
243 Ga0500616_0000146 3300053153 Bacteria 119628
244 Ga0500616_0001061 3300053153 Bacteria 28911
245 Ga0500634_0004885 3300053161 Bacteria 6283
246 Ga0500587_000300 3300053739 Bacteria 5542
247 Ga0501084_0258913 3300054114 Bacteria 1469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10023279 Ga0105240_100232794 260
2 3300009174 Ga0105241_10024241 Ga0105241_100242412 264
3 3300009551 Ga0105238_10009829 Ga0105238_100098294 265
4 3300009545 Ga0105237_10150024 Ga0105237_101500243 268
5 3300046500 Ga0495596_0064820 Ga0495596_0064820_432_1397 270
6 3300044693 Ga0466961_0003521 Ga0466961_0003521_4978_6111 275
7 3300044765 Ga0466970_0006452 Ga0466970_0006452_4412_5545 275
8 3300009177 Ga0105248_10009702 Ga0105248_100097027 279
9 3300014968 Ga0157379_10036111 Ga0157379_100361113 279
10 3300025941 Ga0207711_10027645 Ga0207711_100276453 279
11 3300025914 Ga0207671_10008123 Ga0207671_100081234 280
12 3300049586 Ga0501070_0098314 Ga0501070_0098314_551_1591 280
13 3300026067 Ga0207678_10025812 Ga0207678_100258124 281
14 3300005563 Ga0068855_100022348 Ga0068855_1000223486 282
15 3300005578 Ga0068854_100001959 Ga0068854_1000019594 282
16 3300005616 Ga0068852_100174259 Ga0068852_1001742592 282
17 3300025913 Ga0207695_10007795 Ga0207695_100077954 282
18 3300025924 Ga0207694_10013911 Ga0207694_100139113 282
19 3300026142 Ga0207698_10169562 Ga0207698_101695622 282
20 3300006844 Ga0075428_100000121 Ga0075428_10000012143 283
21 3300006847 Ga0075431_100337206 Ga0075431_1003372062 283
22 3300053085 Ga0495619_0015291 Ga0495619_0015291_1680_2792 283
23 3300005548 Ga0070665_100023358 Ga0070665_1000233584 284
24 3300028379 Ga0268266_10041733 Ga0268266_100417334 284
25 3300050509 nmdc:mga0qj67_11974_c1 nmdc:mga0qj67_11974_c1_2690_3730 284
26 3300050510 nmdc:mga06r32_9976_c1 nmdc:mga06r32_9976_c1_3602_4642 284
27 3300025904 Ga0207647_10016979 Ga0207647_100169792 285
28 3300031548 Ga0307408_100012422 Ga0307408_1000124225 285
29 3300031731 Ga0307405_10001361 Ga0307405_100013615 285
30 3300031901 Ga0307406_10001653 Ga0307406_100016535 285
31 3300031903 Ga0307407_10006381 Ga0307407_100063812 285
32 3300031995 Ga0307409_100000234 Ga0307409_1000002344 285
33 3300032002 Ga0307416_100013143 Ga0307416_1000131433 285
34 3300032126 Ga0307415_100000003 Ga0307415_1000000037 285
35 3300005841 Ga0068863_100481768 Ga0068863_1004817681 286
36 3300025944 Ga0207661_10296020 Ga0207661_102960202 286
37 3300031616 Ga0307508_10116607 Ga0307508_101166072 288
38 3300035170 Ga0373943_0032216 Ga0373943_0032216_260_1372 288
39 3300037068 Ga0373925_0237824 Ga0373925_0237824_192_1304 288
40 3300050507 nmdc:mga05p37_35352_c1 nmdc:mga05p37_35352_c1_3136_4176 288
41 3300050508 nmdc:mga09592_14241_c1 nmdc:mga09592_14241_c1_4142_5182 288
42 iso_pu_bacteria 2675903060 2676496468 289
43 iso_pu_bacteria 2884693830 2884701756 289
44 iso_pu_bacteria 2895427314 2895437433 289
45 iso_pu_bacteria 2895442618 2895446561 289
46 3300025302 Ga0207426_1022550 Ga0207426_10225502 290
47 3300006846 Ga0075430_100002428 Ga0075430_1000024283 291
48 3300006847 Ga0075431_100002971 Ga0075431_1000029712 291
49 3300031247 Ga0265340_10004165 Ga0265340_100041657 291
50 3300031456 Ga0307513_10019863 Ga0307513_100198637 291
51 3300031616 Ga0307508_10048809 Ga0307508_100488092 291
52 3300049580 Ga0501046_0182640 Ga0501046_0182640_324_1427 291
53 3300046462 Ga0495651_0048130 Ga0495651_0048130_1313_2407 292
54 3300053077 Ga0495601_0015623 Ga0495601_0015623_1283_2377 292
55 3300053078 Ga0495612_0023490 Ga0495612_0023490_357_1451 292
56 3300005329 Ga0070683_100008092 Ga0070683_1000080922 293
57 3300005564 Ga0070664_100004924 Ga0070664_1000049248 293
58 3300025944 Ga0207661_10046224 Ga0207661_100462242 293
59 3300025945 Ga0207679_10018780 Ga0207679_100187803 293
60 3300005985 Ga0081539_10001082 Ga0081539_100010823 294
61 3300032002 Ga0307416_100140994 Ga0307416_1001409942 294
62 3300006844 Ga0075428_100017927 Ga0075428_1000179273 295
63 3300006847 Ga0075431_100011706 Ga0075431_1000117063 295
64 3300006880 Ga0075429_100008977 Ga0075429_1000089774 295
65 3300009147 Ga0114129_10005153 Ga0114129_1000515311 295
66 3300041453 Ga0451797_0120722 Ga0451797_0120722_1136_2167 296
67 3300009101 Ga0105247_10072799 Ga0105247_100727992 297
68 3300014325 Ga0163163_10004523 Ga0163163_1000452311 297
69 3300049593 Ga0501077_0014529 Ga0501077_0014529_2596_3645 298
70 3300054114 Ga0501084_0258913 Ga0501084_0258913_289_1431 298
71 iso_pu_bacteria 2861520306 2861526852 298
72 iso_pu_bacteria 2935390628 2935393225 298
73 iso_pu_bacteria 8047710418 8047716077 298
74 3300025901 Ga0207688_10032956 Ga0207688_100329562 299
75 3300035207 Ga0373942_0001428 Ga0373942_0001428_485_1570 299
76 3300053153 Ga0500616_0000146 Ga0500616_0000146_103785_104855 299
77 3300005548 Ga0070665_100379059 Ga0070665_1003790592 300
78 3300025926 Ga0207659_10186438 Ga0207659_101864382 300
79 3300025940 Ga0207691_10037718 Ga0207691_100377183 300
80 3300028379 Ga0268266_10253140 Ga0268266_102531402 300
81 3300033179 Ga0307507_10118718 Ga0307507_101187181 300
82 3300046511 Ga0495608_0006068 Ga0495608_0006068_828_1880 300
83 3300046514 Ga0495618_0026783 Ga0495618_0026783_1214_2266 300
84 3300046516 Ga0495628_0122571 Ga0495628_0122571_802_1854 300
85 3300046517 Ga0495630_0039360 Ga0495630_0039360_344_1396 300
86 3300046533 Ga0495640_0012199 Ga0495640_0012199_5196_6248 300
87 3300046559 Ga0495667_0001707 Ga0495667_0001707_9523_10575 300
88 3300046675 Ga0495657_0105727 Ga0495657_0105727_41_1093 300
89 3300046809 Ga0495600_0049003 Ga0495600_0049003_1516_2568 300
90 3300047319 Ga0495674_0000459 Ga0495674_0000459_2906_3958 300
91 3300047322 Ga0495680_0001410 Ga0495680_0001410_12190_13242 300
92 3300053085 Ga0495619_0149526 Ga0495619_0149526_190_1242 300
93 iso_pu_bacteria 2856741275 2856744872 300
94 iso_pu_bacteria 2891395885 2891396181 300
95 iso_pu_bacteria 2891554331 2891558538 300
96 iso_pu_bacteria 2891562705 2891563890 300
97 iso_pu_bacteria 8055172936 8055179839 300
98 3300005435 Ga0070714_100002788 Ga0070714_1000027884 301
99 3300025929 Ga0207664_10012446 Ga0207664_100124463 301
100 3300028794 Ga0307515_10004526 Ga0307515_100045263 301
101 iso_pu_bacteria 2643221601 2644016797 301
102 iso_pu_bacteria 2643221631 2644178186 301
103 3300014325 Ga0163163_10111024 Ga0163163_101110242 302
104 3300031456 Ga0307513_10000476 Ga0307513_1000047618 302
105 3300031901 Ga0307406_10056034 Ga0307406_100560342 302
106 3300041512 Ga0451853_0190751 Ga0451853_0190751_891_1940 302
107 3300046492 Ga0495585_0033119 Ga0495585_0033119_1138_2223 302
108 3300005329 Ga0070683_100065686 Ga0070683_1000656863 303
109 3300005340 Ga0070689_100090311 Ga0070689_1000903112 303
110 3300005343 Ga0070687_100052433 Ga0070687_1000524332 303
111 3300005345 Ga0070692_10054868 Ga0070692_100548682 303
112 3300005364 Ga0070673_100173323 Ga0070673_1001733232 303
113 3300005564 Ga0070664_100201618 Ga0070664_1002016182 303
114 3300005617 Ga0068859_100158626 Ga0068859_1001586262 303
115 3300005842 Ga0068858_100093228 Ga0068858_1000932283 303
116 3300006881 Ga0068865_100007819 Ga0068865_1000078192 303
117 3300006931 Ga0097620_100158630 Ga0097620_1001586303 303
118 3300009098 Ga0105245_10051980 Ga0105245_100519802 303
119 3300009148 Ga0105243_10068689 Ga0105243_100686892 303
120 3300009148 Ga0105243_10157022 Ga0105243_101570222 303
121 3300009176 Ga0105242_10020802 Ga0105242_100208023 303
122 3300011119 Ga0105246_10097655 Ga0105246_100976552 303
123 3300014325 Ga0163163_10060946 Ga0163163_100609465 303
124 3300014969 Ga0157376_10099232 Ga0157376_100992323 303
125 3300025917 Ga0207660_10125354 Ga0207660_101253542 303
126 3300025931 Ga0207644_10090609 Ga0207644_100906092 303
127 3300026089 Ga0207648_10273359 Ga0207648_102733592 303
128 3300046455 Ga0495603_0001527 Ga0495603_0001527_9408_10472 303
129 3300046523 Ga0495644_0047320 Ga0495644_0047320_163_1227 303
130 3300046525 Ga0495663_0025013 Ga0495663_0025013_36_1100 303
131 3300046616 Ga0495668_0077771 Ga0495668_0077771_464_1528 303
132 3300046794 Ga0495589_0039895 Ga0495589_0039895_235_1299 303
133 3300047445 Ga0495677_0021057 Ga0495677_0021057_530_1594 303
134 3300048907 Ga0496104_0059567 Ga0496104_0059567_2102_3166 303
135 3300048907 Ga0496104_0320778 Ga0496104_0320778_44_1105 303
136 3300048908 Ga0496105_0031368 Ga0496105_0031368_2886_3950 303
137 3300048908 Ga0496105_0284252 Ga0496105_0284252_250_1311 303
138 3300048911 Ga0496108_0047473 Ga0496108_0047473_1235_2299 303
139 3300048912 Ga0496109_0018867 Ga0496109_0018867_632_1696 303
140 3300048913 Ga0496110_0172019 Ga0496110_0172019_607_1671 303
141 3300048914 Ga0496111_0063246 Ga0496111_0063246_807_1871 303
142 3300026118 Ga0207675_100139306 Ga0207675_1001393061 304
143 3300031730 Ga0307516_10094284 Ga0307516_100942842 304
144 3300046455 Ga0495603_0006778 Ga0495603_0006778_2237_3346 304
145 3300046459 Ga0495629_0001210 Ga0495629_0001210_13382_14491 304
146 3300046499 Ga0495594_0004679 Ga0495594_0004679_1646_2755 304
147 3300046660 Ga0495625_0035607 Ga0495625_0035607_2129_3214 304
148 3300046674 Ga0495588_0018459 Ga0495588_0018459_1037_2146 304
149 3300046689 Ga0495613_0038873 Ga0495613_0038873_782_1897 304
150 3300047321 Ga0495676_0011537 Ga0495676_0011537_2560_3669 304
151 3300047447 Ga0495685_002409 Ga0495685_002409_982_2067 304
152 3300049581 Ga0501047_0165129 Ga0501047_0165129_171_1256 304
153 3300053136 Ga0500559_0000078 Ga0500559_0000078_39636_40676 304
154 3300003323 rootH1_10075760 rootH1_100757602 305
155 3300005618 Ga0068864_100006721 Ga0068864_1000067218 305
156 3300005841 Ga0068863_100011728 Ga0068863_1000117285 305
157 3300009177 Ga0105248_10011004 Ga0105248_100110044 305
158 3300014968 Ga0157379_10117544 Ga0157379_101175442 305
159 3300025941 Ga0207711_10012325 Ga0207711_100123253 305
160 3300025945 Ga0207679_10032663 Ga0207679_100326633 305
161 3300026088 Ga0207641_10010182 Ga0207641_100101824 305
162 3300026095 Ga0207676_10098040 Ga0207676_100980402 305
163 3300026116 Ga0207674_10071379 Ga0207674_100713792 305
164 3300031616 Ga0307508_10104446 Ga0307508_101044462 305
165 3300042007 Ga0439449_0004249 Ga0439449_0004249_2105_3214 305
166 3300042157 Ga0439458_0000129 Ga0439458_0000129_10000_11085 305
167 3300048907 Ga0496104_0010071 Ga0496104_0010071_615_1715 305
168 3300048908 Ga0496105_0008579 Ga0496105_0008579_2269_3369 305
169 3300048911 Ga0496108_0006573 Ga0496108_0006573_4617_5717 305
170 3300048912 Ga0496109_0028652 Ga0496109_0028652_3477_4577 305
171 3300048913 Ga0496110_0033403 Ga0496110_0033403_2370_3470 305
172 3300048914 Ga0496111_0004463 Ga0496111_0004463_2150_3250 305
173 3300048915 Ga0496112_0011400 Ga0496112_0011400_4240_5340 305
174 3300048916 Ga0496113_0006695 Ga0496113_0006695_2245_3345 305
175 3300050490 nmdc:mga03n38_127144_c1 nmdc:mga03n38_127144_c1_153_1229 305
176 3300053140 Ga0500573_0000011 Ga0500573_0000011_82298_83365 305
177 3300053140 Ga0500573_0002508 Ga0500573_0002508_4620_5702 305
178 3300015688 Ga0183367_1009 Ga0183367_1009155 306
179 3300028786 Ga0307517_10041560 Ga0307517_100415604 306
180 3300031507 Ga0307509_10058669 Ga0307509_100586693 306
181 3300031616 Ga0307508_10014180 Ga0307508_100141802 306
182 3300031730 Ga0307516_10041629 Ga0307516_100416292 306
183 3300041460 Ga0451802_1856646 Ga0451802_1856646_263_1384 306
184 3300046499 Ga0495594_0009881 Ga0495594_0009881_1128_2222 306
185 3300046522 Ga0495643_0002210 Ga0495643_0002210_5814_6908 306
186 3300046691 Ga0495670_0004432 Ga0495670_0004432_2702_3796 306
187 3300046810 Ga0495660_0007528 Ga0495660_0007528_262_1356 306
188 3300047470 Ga0495681_0005790 Ga0495681_0005790_5939_7033 306
189 3300047472 Ga0495686_0059037 Ga0495686_0059037_103_1197 306
190 3300053079 Ga0500610_0050402 Ga0500610_0050402_67_1161 306
191 3300053094 Ga0500566_0065238 Ga0500566_0065238_726_1820 306
192 3300053161 Ga0500634_0004885 Ga0500634_0004885_4854_5948 306
193 3300053739 Ga0500587_000300 Ga0500587_000300_825_1919 306
194 iso_pu_bacteria 3006321560 3006327586 306
195 3300006353 Ga0075370_10083687 Ga0075370_100836872 307
196 3300009551 Ga0105238_10275533 Ga0105238_102755332 307
197 3300031456 Ga0307513_10008634 Ga0307513_1000863410 307
198 3300031616 Ga0307508_10002597 Ga0307508_100025976 307
199 3300031649 Ga0307514_10016453 Ga0307514_100164533 307
200 3300041404 Ga0439436_0001484 Ga0439436_0001484_1089_2213 307
201 3300041404 Ga0439436_0003869 Ga0439436_0003869_542_1624 307
202 3300041406 Ga0439439_0002878 Ga0439439_0002878_434_1558 307
203 3300041406 Ga0439439_0027117 Ga0439439_0027117_349_1413 307
204 3300041512 Ga0451853_2949179 Ga0451853_2949179_243_1388 307
205 3300041999 Ga0439433_0006525 Ga0439433_0006525_591_1673 307
206 3300042014 Ga0439457_000747 Ga0439457_000747_4651_5775 307
207 3300042145 Ga0450906_000257 Ga0450906_000257_5341_6420 307
208 3300046660 Ga0495625_0062523 Ga0495625_0062523_1311_2408 307
209 3300049568 Ga0501031_0004707 Ga0501031_0004707_4408_5493 307
210 3300049569 Ga0501032_0001525 Ga0501032_0001525_3359_4444 307
211 3300049570 Ga0501033_0005395 Ga0501033_0005395_6950_8035 307
212 3300049571 Ga0501034_0004749 Ga0501034_0004749_9752_10837 307
213 3300049572 Ga0501036_0007960 Ga0501036_0007960_3568_4653 307
214 3300049573 Ga0501037_0012532 Ga0501037_0012532_3359_4444 307
215 3300049574 Ga0501038_0000223 Ga0501038_0000223_5616_6701 307
216 3300049575 Ga0501039_0008140 Ga0501039_0008140_2917_4002 307
217 3300049576 Ga0501040_0009773 Ga0501040_0009773_3751_4836 307
218 3300049577 Ga0501041_0023324 Ga0501041_0023324_914_1999 307
219 3300049578 Ga0501042_0021573 Ga0501042_0021573_335_1420 307
220 3300049579 Ga0501043_0000513 Ga0501043_0000513_29501_30586 307
221 3300049580 Ga0501046_0013830 Ga0501046_0013830_2982_4067 307
222 3300049581 Ga0501047_0000433 Ga0501047_0000433_39823_40908 307
223 3300049582 Ga0501048_0009945 Ga0501048_0009945_2598_3683 307
224 3300049583 Ga0501067_0003704 Ga0501067_0003704_5621_6706 307
225 3300049587 Ga0501071_0003658 Ga0501071_0003658_5618_6703 307
226 3300049589 Ga0501073_0052699 Ga0501073_0052699_1429_2514 307
227 3300049741 Ga0501079_0015724 Ga0501079_0015724_2598_3683 307
228 3300049742 Ga0501080_0125007 Ga0501080_0125007_254_1339 307
229 3300049822 Ga0501035_0000624 Ga0501035_0000624_28852_29937 307
230 3300049823 Ga0501044_0004307 Ga0501044_0004307_5123_6208 307
231 3300049824 Ga0501045_0008143 Ga0501045_0008143_3748_4833 307
232 3300050490 nmdc:mga03n38_15401_c1 nmdc:mga03n38_15401_c1_347_1429 307
233 3300050496 nmdc:mga07m45_70494_c1 nmdc:mga07m45_70494_c1_206_1288 307
234 iso_pu_bacteria 2554235005 2554260954 307
235 iso_pu_bacteria 2643221647 2644268913 307
236 iso_pu_bacteria 2786546132 2786669304 307
237 iso_pu_bacteria 2811994879 2812358891 307
238 iso_pu_bacteria 2862281513 2862288368 307
239 iso_pu_bacteria 2877676314 2877682272 307
240 iso_pu_bacteria 2919468124 2919468439 307
241 iso_pu_bacteria 2947224130 2947229393 307
242 iso_pu_bacteria 2954002825 2954003973 307
243 iso_pu_bacteria 2954380949 2954387402 307
244 iso_pu_bacteria 2954673503 2954675767 307
245 iso_pu_bacteria 2954682443 2954688497 307
246 iso_pu_bacteria 2954691527 2954698235 307
247 iso_pu_bacteria 2954701450 2954703992 307
248 iso_pu_bacteria 3006486233 3006487818 307
249 3300005327 Ga0070658_10021387 Ga0070658_100213875 308
250 3300005336 Ga0070680_100006379 Ga0070680_1000063793 308
251 3300005344 Ga0070661_100006882 Ga0070661_1000068822 308
252 3300005458 Ga0070681_10044237 Ga0070681_100442374 308
253 3300005530 Ga0070679_100019382 Ga0070679_1000193825 308
254 3300005535 Ga0070684_100015005 Ga0070684_1000150052 308
255 3300013105 Ga0157369_10022694 Ga0157369_100226944 308
256 3300013307 Ga0157372_10133300 Ga0157372_101333001 308
257 3300025912 Ga0207707_10027914 Ga0207707_100279142 308
258 3300025917 Ga0207660_10049626 Ga0207660_100496262 308
259 3300025920 Ga0207649_10024522 Ga0207649_100245223 308
260 3300025944 Ga0207661_10003012 Ga0207661_100030126 308
261 3300026116 Ga0207674_10111998 Ga0207674_101119982 308
262 3300005535 Ga0070684_100142395 Ga0070684_1001423952 309
263 3300005983 Ga0081540_1006264 Ga0081540_10062646 309
264 3300031901 Ga0307406_10065173 Ga0307406_100651732 309
265 3300032002 Ga0307416_100070496 Ga0307416_1000704961 309
266 3300053153 Ga0500616_0001061 Ga0500616_0001061_18133_19209 309
267 iso_pu_bacteria 2643221587 2643947199 309
268 iso_pu_bacteria 2643221677 2644433330 309
269 3300053090 Ga0500646_0002690 Ga0500646_0002690_3248_4336 310
270 3300002075 JGI24738J21930_10011562 JGI24738J21930_100115622 311
271 3300005563 Ga0068855_100294730 Ga0068855_1002947302 311
272 3300009176 Ga0105242_10158683 Ga0105242_101586831 311
273 3300014497 Ga0182008_10004953 Ga0182008_100049534 311
274 3300025904 Ga0207647_10009338 Ga0207647_100093386 311
275 3300026078 Ga0207702_10108112 Ga0207702_101081122 311
276 3300031838 Ga0307518_10152058 Ga0307518_101520582 311
277 3300042131 Ga0450894_000183 Ga0450894_000183_1929_3008 311
278 3300042134 Ga0450898_002048 Ga0450898_002048_605_1684 311
279 3300053140 Ga0500573_0021909 Ga0500573_0021909_2115_3197 311
280 iso_pu_bacteria 2643221678 2644436127 311
281 iso_pu_bacteria 2643221714 2644632016 311
282 iso_pu_bacteria 2784746763 2785344592 311
283 iso_pu_bacteria 2808606359 2808840953 311
284 iso_pu_bacteria 2862382967 2862384274 311
285 iso_pu_bacteria 2863404153 2863405858 311
286 iso_pu_bacteria 2946072368 2946074910 311
287 iso_pu_bacteria 2990059506 2990067057 311
288 iso_pu_bacteria 8008558824 8008559269 311
289 iso_pu_bacteria 8048406513 8048407956 311
290 iso_pu_bacteria 8055066027 8055070174 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

55

326

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4782 17 270
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4381 30 304
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4348 30 304
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4104 17 270
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.335 49 296
ID Description Score Start End Superfamily
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7064 49 289 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6926 49 289 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6791 49 289 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6721 49 289 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6499 49 289 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A6I0EJ36-F1-model_v4 ABC transporter permease 0.7353 3 296 GO:0005886
GO:0022857
AF-A0A3D4KY75-F1-model_v4 Sugar ABC transporter permease 0.7277 62 303 GO:0005886
GO:0022857
AF-A0A352CPJ2-F1-model_v4 Sugar ABC transporter permease 0.7226 94 303 GO:0005886
GO:0022857
AF-A0A3C2BNR8-F1-model_v4 deleted 0.7202 49 222
AF-A0A1Q7W1J3-F1-model_v4 Sugar ABC transporter permease 0.7188 1 303 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
59.66 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map