F389682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 234 | 247 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1006264|Ga0081540_10062646 |
| Length | 378 |
| Sequence | MTATLTRIRQRDWRRLSRHQLFWPLLILAALLLFNLPFTPNFFSIGVRNGHLYGSLVSILYFGTVPILVALGMTLVIATGGIDLSVGAVMAISGAIACRLISHATDQNSVSLVFTAMALALLAALAAGLFNGLMVARAGVQPIVATLILMVAGRGIAQLITSGFILTELSRPYAVVGGYAAAVPTGLFIVVGFVAITAVLTRRTALGLLVESVGGNAEASRLAGVRAQRIKLMVYVFCALCAGVAGLWNSSSLGGADANNAGLWIELDAILAVVIGGTPLTGGRFSIGGTVVGALILQTLKTTIFTIGIPAQANMVFEAVVVIVICLLQSTDFRRRVGRLVRLPRPPRQRQAPPGELADAGHGPAIASVSQESVEATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 2 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 3 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 4 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 5 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 6 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 7 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 8 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 9 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 10 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 11 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 12 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 13 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 14 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 15 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 16 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 17 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 18 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 19 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 20 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 21 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 22 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 23 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 24 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 25 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 26 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 27 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 28 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 29 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 30 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 31 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 32 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 33 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 34 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 35 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 36 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 37 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 38 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 39 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 40 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 115 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 121 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 135 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 136 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 142 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 143 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 144 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 145 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 214 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 223 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 224 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 225 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 226 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 227 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 231 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 232 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 233 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 234 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.17 |
| Metatranscriptomes | 0 |
| Isolates | 14.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 0.69 |
| Rhizoplane | 6.21 |
| Rhizosphere | 71.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10011562 | 3300002075 | Bacteria | 1939 |
| 2 | rootH1_10075760 | 3300003323 | Bacteria | 4082 |
| 3 | Ga0070658_10021387 | 3300005327 | Bacteria | 5185 |
| 4 | Ga0070683_100008092 | 3300005329 | Bacteria | 8929 |
| 5 | Ga0070683_100065686 | 3300005329 | Bacteria | 3378 |
| 6 | Ga0070680_100006379 | 3300005336 | Bacteria | 8958 |
| 7 | Ga0070689_100090311 | 3300005340 | Bacteria | 2413 |
| 8 | Ga0070687_100052433 | 3300005343 | Bacteria | 2117 |
| 9 | Ga0070661_100006882 | 3300005344 | Bacteria | 7844 |
| 10 | Ga0070692_10054868 | 3300005345 | Bacteria | 2082 |
| 11 | Ga0070673_100173323 | 3300005364 | Bacteria | 1842 |
| 12 | Ga0070714_100002788 | 3300005435 | Bacteria | 12884 |
| 13 | Ga0070681_10044237 | 3300005458 | Bacteria | 4456 |
| 14 | Ga0070679_100019382 | 3300005530 | Bacteria | 6612 |
| 15 | Ga0070684_100015005 | 3300005535 | Bacteria | 6293 |
| 16 | Ga0070684_100142395 | 3300005535 | Bacteria | 2168 |
| 17 | Ga0070665_100023358 | 3300005548 | Bacteria | 6224 |
| 18 | Ga0070665_100379059 | 3300005548 | Bacteria | 1422 |
| 19 | Ga0068855_100022348 | 3300005563 | Bacteria | 7579 |
| 20 | Ga0068855_100294730 | 3300005563 | Bacteria | 1797 |
| 21 | Ga0070664_100004924 | 3300005564 | Bacteria | 10695 |
| 22 | Ga0070664_100201618 | 3300005564 | Bacteria | 1776 |
| 23 | Ga0068854_100001959 | 3300005578 | Bacteria | 12581 |
| 24 | Ga0068852_100174259 | 3300005616 | Bacteria | 2018 |
| 25 | Ga0068859_100158626 | 3300005617 | Bacteria | 2341 |
| 26 | Ga0068864_100006721 | 3300005618 | Bacteria | 9423 |
| 27 | Ga0068863_100011728 | 3300005841 | Bacteria | 8476 |
| 28 | Ga0068863_100481768 | 3300005841 | Bacteria | 1220 |
| 29 | Ga0068858_100093228 | 3300005842 | Bacteria | 2803 |
| 30 | Ga0081540_1006264 | 3300005983 | Bacteria | 8709 |
| 31 | Ga0081539_10001082 | 3300005985 | Bacteria | 49533 |
| 32 | Ga0075370_10083687 | 3300006353 | Bacteria | 1836 |
| 33 | Ga0075428_100000121 | 3300006844 | Bacteria | 67666 |
| 34 | Ga0075428_100017927 | 3300006844 | Bacteria | 7824 |
| 35 | Ga0075430_100002428 | 3300006846 | Bacteria | 15512 |
| 36 | Ga0075431_100002971 | 3300006847 | Bacteria | 16409 |
| 37 | Ga0075431_100011706 | 3300006847 | Bacteria | 8850 |
| 38 | Ga0075431_100337206 | 3300006847 | Bacteria | 1518 |
| 39 | Ga0075429_100008977 | 3300006880 | Bacteria | 8683 |
| 40 | Ga0068865_100007819 | 3300006881 | Bacteria | 6596 |
| 41 | Ga0097620_100158630 | 3300006931 | Bacteria | 2341 |
| 42 | Ga0105240_10023279 | 3300009093 | Bacteria | 8197 |
| 43 | Ga0105245_10051980 | 3300009098 | Bacteria | 3674 |
| 44 | Ga0105247_10072799 | 3300009101 | Bacteria | 2152 |
| 45 | Ga0114129_10005153 | 3300009147 | Bacteria | 18399 |
| 46 | Ga0105243_10068689 | 3300009148 | Bacteria | 2856 |
| 47 | Ga0105243_10157022 | 3300009148 | Bacteria | 1957 |
| 48 | Ga0105241_10024241 | 3300009174 | Bacteria | 4506 |
| 49 | Ga0105242_10020802 | 3300009176 | Bacteria | 5147 |
| 50 | Ga0105242_10158683 | 3300009176 | Bacteria | 1978 |
| 51 | Ga0105248_10009702 | 3300009177 | Bacteria | 10603 |
| 52 | Ga0105248_10011004 | 3300009177 | Bacteria | 9980 |
| 53 | Ga0105237_10150024 | 3300009545 | Bacteria | 2327 |
| 54 | Ga0105238_10009829 | 3300009551 | Bacteria | 9581 |
| 55 | Ga0105238_10275533 | 3300009551 | Bacteria | 1663 |
| 56 | Ga0105246_10097655 | 3300011119 | Bacteria | 2132 |
| 57 | Ga0157369_10022694 | 3300013105 | Bacteria | 6999 |
| 58 | Ga0157372_10133300 | 3300013307 | Bacteria | 2860 |
| 59 | Ga0163163_10004523 | 3300014325 | Bacteria | 11867 |
| 60 | Ga0163163_10060946 | 3300014325 | Bacteria | 3738 |
| 61 | Ga0163163_10111024 | 3300014325 | Bacteria | 2771 |
| 62 | Ga0182008_10004953 | 3300014497 | Bacteria | 7672 |
| 63 | Ga0157379_10036111 | 3300014968 | Bacteria | 4407 |
| 64 | Ga0157379_10117544 | 3300014968 | Bacteria | 2392 |
| 65 | Ga0157376_10099232 | 3300014969 | Bacteria | 2540 |
| 66 | Ga0183367_1009 | 3300015688 | Bacteria | 484598 |
| 67 | Ga0207426_1022550 | 3300025302 | Bacteria | 2160 |
| 68 | Ga0207688_10032956 | 3300025901 | Bacteria | 2864 |
| 69 | Ga0207647_10009338 | 3300025904 | Bacteria | 6972 |
| 70 | Ga0207647_10016979 | 3300025904 | Bacteria | 4955 |
| 71 | Ga0207707_10027914 | 3300025912 | Bacteria | 4935 |
| 72 | Ga0207695_10007795 | 3300025913 | Bacteria | 13557 |
| 73 | Ga0207671_10008123 | 3300025914 | Bacteria | 8955 |
| 74 | Ga0207660_10049626 | 3300025917 | Bacteria | 2976 |
| 75 | Ga0207660_10125354 | 3300025917 | Bacteria | 1950 |
| 76 | Ga0207649_10024522 | 3300025920 | Bacteria | 3507 |
| 77 | Ga0207694_10013911 | 3300025924 | Bacteria | 6067 |
| 78 | Ga0207659_10186438 | 3300025926 | Bacteria | 1648 |
| 79 | Ga0207664_10012446 | 3300025929 | Bacteria | 6083 |
| 80 | Ga0207644_10090609 | 3300025931 | Bacteria | 2279 |
| 81 | Ga0207691_10037718 | 3300025940 | Bacteria | 4474 |
| 82 | Ga0207711_10012325 | 3300025941 | Bacteria | 7106 |
| 83 | Ga0207711_10027645 | 3300025941 | Bacteria | 4767 |
| 84 | Ga0207661_10003012 | 3300025944 | Bacteria | 11649 |
| 85 | Ga0207661_10046224 | 3300025944 | Bacteria | 3451 |
| 86 | Ga0207661_10296020 | 3300025944 | Bacteria | 1450 |
| 87 | Ga0207679_10018780 | 3300025945 | Bacteria | 4638 |
| 88 | Ga0207679_10032663 | 3300025945 | Bacteria | 3657 |
| 89 | Ga0207678_10025812 | 3300026067 | Bacteria | 5127 |
| 90 | Ga0207702_10108112 | 3300026078 | Bacteria | 2467 |
| 91 | Ga0207641_10010182 | 3300026088 | Bacteria | 7733 |
| 92 | Ga0207648_10273359 | 3300026089 | Bacteria | 1510 |
| 93 | Ga0207676_10098040 | 3300026095 | Bacteria | 2422 |
| 94 | Ga0207674_10071379 | 3300026116 | Bacteria | 3489 |
| 95 | Ga0207674_10111998 | 3300026116 | Bacteria | 2703 |
| 96 | Ga0207675_100139306 | 3300026118 | Bacteria | 2304 |
| 97 | Ga0207698_10169562 | 3300026142 | Bacteria | 1920 |
| 98 | Ga0268266_10041733 | 3300028379 | Bacteria | 3916 |
| 99 | Ga0268266_10253140 | 3300028379 | Bacteria | 1630 |
| 100 | Ga0307517_10041560 | 3300028786 | Bacteria | 4961 |
| 101 | Ga0307515_10004526 | 3300028794 | Bacteria | 28712 |
| 102 | Ga0265340_10004165 | 3300031247 | Bacteria | 8119 |
| 103 | Ga0307513_10000476 | 3300031456 | Bacteria | 57781 |
| 104 | Ga0307513_10008634 | 3300031456 | Bacteria | 12986 |
| 105 | Ga0307513_10019863 | 3300031456 | Bacteria | 7984 |
| 106 | Ga0307509_10058669 | 3300031507 | Bacteria | 4074 |
| 107 | Ga0307408_100012422 | 3300031548 | Bacteria | 5642 |
| 108 | Ga0307508_10002597 | 3300031616 | Bacteria | 19002 |
| 109 | Ga0307508_10014180 | 3300031616 | Bacteria | 7269 |
| 110 | Ga0307508_10048809 | 3300031616 | Bacteria | 3770 |
| 111 | Ga0307508_10104446 | 3300031616 | Bacteria | 2430 |
| 112 | Ga0307508_10116607 | 3300031616 | Bacteria | 2272 |
| 113 | Ga0307514_10016453 | 3300031649 | Bacteria | 6093 |
| 114 | Ga0307516_10041629 | 3300031730 | Bacteria | 4564 |
| 115 | Ga0307516_10094284 | 3300031730 | Bacteria | 2818 |
| 116 | Ga0307405_10001361 | 3300031731 | Bacteria | 10255 |
| 117 | Ga0307518_10152058 | 3300031838 | Bacteria | 1600 |
| 118 | Ga0307406_10001653 | 3300031901 | Bacteria | 12258 |
| 119 | Ga0307406_10056034 | 3300031901 | Bacteria | 2522 |
| 120 | Ga0307406_10065173 | 3300031901 | Bacteria | 2367 |
| 121 | Ga0307407_10006381 | 3300031903 | Bacteria | 5232 |
| 122 | Ga0307409_100000234 | 3300031995 | Bacteria | 22466 |
| 123 | Ga0307416_100013143 | 3300032002 | Bacteria | 5616 |
| 124 | Ga0307416_100070496 | 3300032002 | Bacteria | 2899 |
| 125 | Ga0307416_100140994 | 3300032002 | Bacteria | 2191 |
| 126 | Ga0307415_100000003 | 3300032126 | Bacteria | 116928 |
| 127 | Ga0307507_10118718 | 3300033179 | Bacteria | 2124 |
| 128 | Ga0373943_0032216 | 3300035170 | Bacteria | 2491 |
| 129 | Ga0373942_0001428 | 3300035207 | Bacteria | 6153 |
| 130 | Ga0373925_0237824 | 3300037068 | Bacteria | 1458 |
| 131 | Ga0439436_0001484 | 3300041404 | Bacteria | 6823 |
| 132 | Ga0439436_0003869 | 3300041404 | Bacteria | 4584 |
| 133 | Ga0439439_0002878 | 3300041406 | Bacteria | 3730 |
| 134 | Ga0439439_0027117 | 3300041406 | Bacteria | 1446 |
| 135 | Ga0451797_0120722 | 3300041453 | Bacteria | 2536 |
| 136 | Ga0451802_1856646 | 3300041460 | Bacteria | 1879 |
| 137 | Ga0451853_0190751 | 3300041512 | Bacteria | 4011 |
| 138 | Ga0451853_2949179 | 3300041512 | Bacteria | 1623 |
| 139 | Ga0439433_0006525 | 3300041999 | Bacteria | 2512 |
| 140 | Ga0439449_0004249 | 3300042007 | Bacteria | 5538 |
| 141 | Ga0439457_000747 | 3300042014 | Bacteria | 9683 |
| 142 | Ga0450894_000183 | 3300042131 | Bacteria | 11292 |
| 143 | Ga0450898_002048 | 3300042134 | Bacteria | 2767 |
| 144 | Ga0450906_000257 | 3300042145 | Bacteria | 10247 |
| 145 | Ga0439458_0000129 | 3300042157 | Bacteria | 15799 |
| 146 | Ga0466961_0003521 | 3300044693 | Bacteria | 9764 |
| 147 | Ga0466970_0006452 | 3300044765 | Bacteria | 5866 |
| 148 | Ga0495603_0001527 | 3300046455 | Bacteria | 13521 |
| 149 | Ga0495603_0006778 | 3300046455 | Bacteria | 6871 |
| 150 | Ga0495629_0001210 | 3300046459 | Bacteria | 20267 |
| 151 | Ga0495651_0048130 | 3300046462 | Bacteria | 3294 |
| 152 | Ga0495585_0033119 | 3300046492 | Bacteria | 2927 |
| 153 | Ga0495594_0004679 | 3300046499 | Bacteria | 7054 |
| 154 | Ga0495594_0009881 | 3300046499 | Bacteria | 4944 |
| 155 | Ga0495596_0064820 | 3300046500 | Bacteria | 1421 |
| 156 | Ga0495608_0006068 | 3300046511 | Bacteria | 8579 |
| 157 | Ga0495618_0026783 | 3300046514 | Bacteria | 3586 |
| 158 | Ga0495628_0122571 | 3300046516 | Bacteria | 1993 |
| 159 | Ga0495630_0039360 | 3300046517 | Bacteria | 3535 |
| 160 | Ga0495643_0002210 | 3300046522 | Bacteria | 15864 |
| 161 | Ga0495644_0047320 | 3300046523 | Bacteria | 1616 |
| 162 | Ga0495663_0025013 | 3300046525 | Bacteria | 1739 |
| 163 | Ga0495640_0012199 | 3300046533 | Bacteria | 6578 |
| 164 | Ga0495667_0001707 | 3300046559 | Bacteria | 14582 |
| 165 | Ga0495668_0077771 | 3300046616 | Bacteria | 1822 |
| 166 | Ga0495625_0035607 | 3300046660 | Bacteria | 3668 |
| 167 | Ga0495625_0062523 | 3300046660 | Bacteria | 2631 |
| 168 | Ga0495588_0018459 | 3300046674 | Bacteria | 3402 |
| 169 | Ga0495657_0105727 | 3300046675 | Bacteria | 1788 |
| 170 | Ga0495613_0038873 | 3300046689 | Bacteria | 3528 |
| 171 | Ga0495670_0004432 | 3300046691 | Bacteria | 6886 |
| 172 | Ga0495589_0039895 | 3300046794 | Bacteria | 2345 |
| 173 | Ga0495600_0049003 | 3300046809 | Bacteria | 2756 |
| 174 | Ga0495660_0007528 | 3300046810 | Bacteria | 6392 |
| 175 | Ga0495674_0000459 | 3300047319 | Bacteria | 36825 |
| 176 | Ga0495676_0011537 | 3300047321 | Bacteria | 7968 |
| 177 | Ga0495680_0001410 | 3300047322 | Bacteria | 25933 |
| 178 | Ga0495677_0021057 | 3300047445 | Bacteria | 2364 |
| 179 | Ga0495685_002409 | 3300047447 | Bacteria | 5864 |
| 180 | Ga0495681_0005790 | 3300047470 | Bacteria | 8212 |
| 181 | Ga0495686_0059037 | 3300047472 | Bacteria | 2390 |
| 182 | Ga0496104_0010071 | 3300048907 | Bacteria | 8438 |
| 183 | Ga0496104_0059567 | 3300048907 | Bacteria | 3615 |
| 184 | Ga0496104_0320778 | 3300048907 | Bacteria | 1462 |
| 185 | Ga0496105_0008579 | 3300048908 | Bacteria | 7940 |
| 186 | Ga0496105_0031368 | 3300048908 | Bacteria | 4357 |
| 187 | Ga0496105_0284252 | 3300048908 | Bacteria | 1333 |
| 188 | Ga0496108_0006573 | 3300048911 | Bacteria | 9434 |
| 189 | Ga0496108_0047473 | 3300048911 | Bacteria | 3589 |
| 190 | Ga0496109_0018867 | 3300048912 | Bacteria | 6070 |
| 191 | Ga0496109_0028652 | 3300048912 | Bacteria | 4983 |
| 192 | Ga0496110_0033403 | 3300048913 | Bacteria | 4450 |
| 193 | Ga0496110_0172019 | 3300048913 | Bacteria | 1965 |
| 194 | Ga0496111_0004463 | 3300048914 | Bacteria | 8851 |
| 195 | Ga0496111_0063246 | 3300048914 | Bacteria | 2684 |
| 196 | Ga0496112_0011400 | 3300048915 | Bacteria | 8116 |
| 197 | Ga0496113_0006695 | 3300048916 | Bacteria | 7336 |
| 198 | Ga0501031_0004707 | 3300049568 | Bacteria | 8851 |
| 199 | Ga0501032_0001525 | 3300049569 | Bacteria | 18459 |
| 200 | Ga0501033_0005395 | 3300049570 | Bacteria | 10132 |
| 201 | Ga0501034_0004749 | 3300049571 | Bacteria | 15041 |
| 202 | Ga0501036_0007960 | 3300049572 | Bacteria | 8674 |
| 203 | Ga0501037_0012532 | 3300049573 | Bacteria | 6245 |
| 204 | Ga0501038_0000223 | 3300049574 | Bacteria | 48354 |
| 205 | Ga0501039_0008140 | 3300049575 | Bacteria | 7987 |
| 206 | Ga0501040_0009773 | 3300049576 | Bacteria | 6263 |
| 207 | Ga0501041_0023324 | 3300049577 | Bacteria | 3711 |
| 208 | Ga0501042_0021573 | 3300049578 | Bacteria | 4491 |
| 209 | Ga0501043_0000513 | 3300049579 | Bacteria | 34841 |
| 210 | Ga0501046_0013830 | 3300049580 | Bacteria | 6818 |
| 211 | Ga0501046_0182640 | 3300049580 | Bacteria | 1568 |
| 212 | Ga0501047_0000433 | 3300049581 | Bacteria | 46523 |
| 213 | Ga0501047_0165129 | 3300049581 | Bacteria | 2085 |
| 214 | Ga0501048_0009945 | 3300049582 | Bacteria | 7122 |
| 215 | Ga0501067_0003704 | 3300049583 | Bacteria | 8420 |
| 216 | Ga0501070_0098314 | 3300049586 | Bacteria | 2421 |
| 217 | Ga0501071_0003658 | 3300049587 | Bacteria | 9646 |
| 218 | Ga0501073_0052699 | 3300049589 | Bacteria | 2848 |
| 219 | Ga0501077_0014529 | 3300049593 | Bacteria | 4949 |
| 220 | Ga0501079_0015724 | 3300049741 | Bacteria | 5780 |
| 221 | Ga0501080_0125007 | 3300049742 | Bacteria | 2382 |
| 222 | Ga0501035_0000624 | 3300049822 | Bacteria | 38958 |
| 223 | Ga0501044_0004307 | 3300049823 | Bacteria | 15958 |
| 224 | Ga0501045_0008143 | 3300049824 | Bacteria | 7302 |
| 225 | nmdc:mga03n38_127144_c1 | 3300050490 | Bacteria | 1259 |
| 226 | nmdc:mga03n38_15401_c1 | 3300050490 | Bacteria | 2952 |
| 227 | nmdc:mga07m45_70494_c1 | 3300050496 | Bacteria | 1988 |
| 228 | nmdc:mga05p37_35352_c1 | 3300050507 | Bacteria | 6126 |
| 229 | nmdc:mga09592_14241_c1 | 3300050508 | Bacteria | 6493 |
| 230 | nmdc:mga0qj67_11974_c1 | 3300050509 | Bacteria | 6517 |
| 231 | nmdc:mga06r32_9976_c1 | 3300050510 | Bacteria | 8568 |
| 232 | Ga0495601_0015623 | 3300053077 | Bacteria | 4590 |
| 233 | Ga0495612_0023490 | 3300053078 | Bacteria | 2474 |
| 234 | Ga0500610_0050402 | 3300053079 | Bacteria | 2167 |
| 235 | Ga0495619_0015291 | 3300053085 | Bacteria | 4854 |
| 236 | Ga0495619_0149526 | 3300053085 | Bacteria | 1611 |
| 237 | Ga0500646_0002690 | 3300053090 | Bacteria | 4589 |
| 238 | Ga0500566_0065238 | 3300053094 | Bacteria | 2054 |
| 239 | Ga0500559_0000078 | 3300053136 | Bacteria | 76033 |
| 240 | Ga0500573_0000011 | 3300053140 | Bacteria | 209484 |
| 241 | Ga0500573_0002508 | 3300053140 | Bacteria | 9196 |
| 242 | Ga0500573_0021909 | 3300053140 | Bacteria | 3666 |
| 243 | Ga0500616_0000146 | 3300053153 | Bacteria | 119628 |
| 244 | Ga0500616_0001061 | 3300053153 | Bacteria | 28911 |
| 245 | Ga0500634_0004885 | 3300053161 | Bacteria | 6283 |
| 246 | Ga0500587_000300 | 3300053739 | Bacteria | 5542 |
| 247 | Ga0501084_0258913 | 3300054114 | Bacteria | 1469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10023279 | Ga0105240_100232794 | 260 |
| 2 | 3300009174 | Ga0105241_10024241 | Ga0105241_100242412 | 264 |
| 3 | 3300009551 | Ga0105238_10009829 | Ga0105238_100098294 | 265 |
| 4 | 3300009545 | Ga0105237_10150024 | Ga0105237_101500243 | 268 |
| 5 | 3300046500 | Ga0495596_0064820 | Ga0495596_0064820_432_1397 | 270 |
| 6 | 3300044693 | Ga0466961_0003521 | Ga0466961_0003521_4978_6111 | 275 |
| 7 | 3300044765 | Ga0466970_0006452 | Ga0466970_0006452_4412_5545 | 275 |
| 8 | 3300009177 | Ga0105248_10009702 | Ga0105248_100097027 | 279 |
| 9 | 3300014968 | Ga0157379_10036111 | Ga0157379_100361113 | 279 |
| 10 | 3300025941 | Ga0207711_10027645 | Ga0207711_100276453 | 279 |
| 11 | 3300025914 | Ga0207671_10008123 | Ga0207671_100081234 | 280 |
| 12 | 3300049586 | Ga0501070_0098314 | Ga0501070_0098314_551_1591 | 280 |
| 13 | 3300026067 | Ga0207678_10025812 | Ga0207678_100258124 | 281 |
| 14 | 3300005563 | Ga0068855_100022348 | Ga0068855_1000223486 | 282 |
| 15 | 3300005578 | Ga0068854_100001959 | Ga0068854_1000019594 | 282 |
| 16 | 3300005616 | Ga0068852_100174259 | Ga0068852_1001742592 | 282 |
| 17 | 3300025913 | Ga0207695_10007795 | Ga0207695_100077954 | 282 |
| 18 | 3300025924 | Ga0207694_10013911 | Ga0207694_100139113 | 282 |
| 19 | 3300026142 | Ga0207698_10169562 | Ga0207698_101695622 | 282 |
| 20 | 3300006844 | Ga0075428_100000121 | Ga0075428_10000012143 | 283 |
| 21 | 3300006847 | Ga0075431_100337206 | Ga0075431_1003372062 | 283 |
| 22 | 3300053085 | Ga0495619_0015291 | Ga0495619_0015291_1680_2792 | 283 |
| 23 | 3300005548 | Ga0070665_100023358 | Ga0070665_1000233584 | 284 |
| 24 | 3300028379 | Ga0268266_10041733 | Ga0268266_100417334 | 284 |
| 25 | 3300050509 | nmdc:mga0qj67_11974_c1 | nmdc:mga0qj67_11974_c1_2690_3730 | 284 |
| 26 | 3300050510 | nmdc:mga06r32_9976_c1 | nmdc:mga06r32_9976_c1_3602_4642 | 284 |
| 27 | 3300025904 | Ga0207647_10016979 | Ga0207647_100169792 | 285 |
| 28 | 3300031548 | Ga0307408_100012422 | Ga0307408_1000124225 | 285 |
| 29 | 3300031731 | Ga0307405_10001361 | Ga0307405_100013615 | 285 |
| 30 | 3300031901 | Ga0307406_10001653 | Ga0307406_100016535 | 285 |
| 31 | 3300031903 | Ga0307407_10006381 | Ga0307407_100063812 | 285 |
| 32 | 3300031995 | Ga0307409_100000234 | Ga0307409_1000002344 | 285 |
| 33 | 3300032002 | Ga0307416_100013143 | Ga0307416_1000131433 | 285 |
| 34 | 3300032126 | Ga0307415_100000003 | Ga0307415_1000000037 | 285 |
| 35 | 3300005841 | Ga0068863_100481768 | Ga0068863_1004817681 | 286 |
| 36 | 3300025944 | Ga0207661_10296020 | Ga0207661_102960202 | 286 |
| 37 | 3300031616 | Ga0307508_10116607 | Ga0307508_101166072 | 288 |
| 38 | 3300035170 | Ga0373943_0032216 | Ga0373943_0032216_260_1372 | 288 |
| 39 | 3300037068 | Ga0373925_0237824 | Ga0373925_0237824_192_1304 | 288 |
| 40 | 3300050507 | nmdc:mga05p37_35352_c1 | nmdc:mga05p37_35352_c1_3136_4176 | 288 |
| 41 | 3300050508 | nmdc:mga09592_14241_c1 | nmdc:mga09592_14241_c1_4142_5182 | 288 |
| 42 | iso_pu_bacteria | 2675903060 | 2676496468 | 289 |
| 43 | iso_pu_bacteria | 2884693830 | 2884701756 | 289 |
| 44 | iso_pu_bacteria | 2895427314 | 2895437433 | 289 |
| 45 | iso_pu_bacteria | 2895442618 | 2895446561 | 289 |
| 46 | 3300025302 | Ga0207426_1022550 | Ga0207426_10225502 | 290 |
| 47 | 3300006846 | Ga0075430_100002428 | Ga0075430_1000024283 | 291 |
| 48 | 3300006847 | Ga0075431_100002971 | Ga0075431_1000029712 | 291 |
| 49 | 3300031247 | Ga0265340_10004165 | Ga0265340_100041657 | 291 |
| 50 | 3300031456 | Ga0307513_10019863 | Ga0307513_100198637 | 291 |
| 51 | 3300031616 | Ga0307508_10048809 | Ga0307508_100488092 | 291 |
| 52 | 3300049580 | Ga0501046_0182640 | Ga0501046_0182640_324_1427 | 291 |
| 53 | 3300046462 | Ga0495651_0048130 | Ga0495651_0048130_1313_2407 | 292 |
| 54 | 3300053077 | Ga0495601_0015623 | Ga0495601_0015623_1283_2377 | 292 |
| 55 | 3300053078 | Ga0495612_0023490 | Ga0495612_0023490_357_1451 | 292 |
| 56 | 3300005329 | Ga0070683_100008092 | Ga0070683_1000080922 | 293 |
| 57 | 3300005564 | Ga0070664_100004924 | Ga0070664_1000049248 | 293 |
| 58 | 3300025944 | Ga0207661_10046224 | Ga0207661_100462242 | 293 |
| 59 | 3300025945 | Ga0207679_10018780 | Ga0207679_100187803 | 293 |
| 60 | 3300005985 | Ga0081539_10001082 | Ga0081539_100010823 | 294 |
| 61 | 3300032002 | Ga0307416_100140994 | Ga0307416_1001409942 | 294 |
| 62 | 3300006844 | Ga0075428_100017927 | Ga0075428_1000179273 | 295 |
| 63 | 3300006847 | Ga0075431_100011706 | Ga0075431_1000117063 | 295 |
| 64 | 3300006880 | Ga0075429_100008977 | Ga0075429_1000089774 | 295 |
| 65 | 3300009147 | Ga0114129_10005153 | Ga0114129_1000515311 | 295 |
| 66 | 3300041453 | Ga0451797_0120722 | Ga0451797_0120722_1136_2167 | 296 |
| 67 | 3300009101 | Ga0105247_10072799 | Ga0105247_100727992 | 297 |
| 68 | 3300014325 | Ga0163163_10004523 | Ga0163163_1000452311 | 297 |
| 69 | 3300049593 | Ga0501077_0014529 | Ga0501077_0014529_2596_3645 | 298 |
| 70 | 3300054114 | Ga0501084_0258913 | Ga0501084_0258913_289_1431 | 298 |
| 71 | iso_pu_bacteria | 2861520306 | 2861526852 | 298 |
| 72 | iso_pu_bacteria | 2935390628 | 2935393225 | 298 |
| 73 | iso_pu_bacteria | 8047710418 | 8047716077 | 298 |
| 74 | 3300025901 | Ga0207688_10032956 | Ga0207688_100329562 | 299 |
| 75 | 3300035207 | Ga0373942_0001428 | Ga0373942_0001428_485_1570 | 299 |
| 76 | 3300053153 | Ga0500616_0000146 | Ga0500616_0000146_103785_104855 | 299 |
| 77 | 3300005548 | Ga0070665_100379059 | Ga0070665_1003790592 | 300 |
| 78 | 3300025926 | Ga0207659_10186438 | Ga0207659_101864382 | 300 |
| 79 | 3300025940 | Ga0207691_10037718 | Ga0207691_100377183 | 300 |
| 80 | 3300028379 | Ga0268266_10253140 | Ga0268266_102531402 | 300 |
| 81 | 3300033179 | Ga0307507_10118718 | Ga0307507_101187181 | 300 |
| 82 | 3300046511 | Ga0495608_0006068 | Ga0495608_0006068_828_1880 | 300 |
| 83 | 3300046514 | Ga0495618_0026783 | Ga0495618_0026783_1214_2266 | 300 |
| 84 | 3300046516 | Ga0495628_0122571 | Ga0495628_0122571_802_1854 | 300 |
| 85 | 3300046517 | Ga0495630_0039360 | Ga0495630_0039360_344_1396 | 300 |
| 86 | 3300046533 | Ga0495640_0012199 | Ga0495640_0012199_5196_6248 | 300 |
| 87 | 3300046559 | Ga0495667_0001707 | Ga0495667_0001707_9523_10575 | 300 |
| 88 | 3300046675 | Ga0495657_0105727 | Ga0495657_0105727_41_1093 | 300 |
| 89 | 3300046809 | Ga0495600_0049003 | Ga0495600_0049003_1516_2568 | 300 |
| 90 | 3300047319 | Ga0495674_0000459 | Ga0495674_0000459_2906_3958 | 300 |
| 91 | 3300047322 | Ga0495680_0001410 | Ga0495680_0001410_12190_13242 | 300 |
| 92 | 3300053085 | Ga0495619_0149526 | Ga0495619_0149526_190_1242 | 300 |
| 93 | iso_pu_bacteria | 2856741275 | 2856744872 | 300 |
| 94 | iso_pu_bacteria | 2891395885 | 2891396181 | 300 |
| 95 | iso_pu_bacteria | 2891554331 | 2891558538 | 300 |
| 96 | iso_pu_bacteria | 2891562705 | 2891563890 | 300 |
| 97 | iso_pu_bacteria | 8055172936 | 8055179839 | 300 |
| 98 | 3300005435 | Ga0070714_100002788 | Ga0070714_1000027884 | 301 |
| 99 | 3300025929 | Ga0207664_10012446 | Ga0207664_100124463 | 301 |
| 100 | 3300028794 | Ga0307515_10004526 | Ga0307515_100045263 | 301 |
| 101 | iso_pu_bacteria | 2643221601 | 2644016797 | 301 |
| 102 | iso_pu_bacteria | 2643221631 | 2644178186 | 301 |
| 103 | 3300014325 | Ga0163163_10111024 | Ga0163163_101110242 | 302 |
| 104 | 3300031456 | Ga0307513_10000476 | Ga0307513_1000047618 | 302 |
| 105 | 3300031901 | Ga0307406_10056034 | Ga0307406_100560342 | 302 |
| 106 | 3300041512 | Ga0451853_0190751 | Ga0451853_0190751_891_1940 | 302 |
| 107 | 3300046492 | Ga0495585_0033119 | Ga0495585_0033119_1138_2223 | 302 |
| 108 | 3300005329 | Ga0070683_100065686 | Ga0070683_1000656863 | 303 |
| 109 | 3300005340 | Ga0070689_100090311 | Ga0070689_1000903112 | 303 |
| 110 | 3300005343 | Ga0070687_100052433 | Ga0070687_1000524332 | 303 |
| 111 | 3300005345 | Ga0070692_10054868 | Ga0070692_100548682 | 303 |
| 112 | 3300005364 | Ga0070673_100173323 | Ga0070673_1001733232 | 303 |
| 113 | 3300005564 | Ga0070664_100201618 | Ga0070664_1002016182 | 303 |
| 114 | 3300005617 | Ga0068859_100158626 | Ga0068859_1001586262 | 303 |
| 115 | 3300005842 | Ga0068858_100093228 | Ga0068858_1000932283 | 303 |
| 116 | 3300006881 | Ga0068865_100007819 | Ga0068865_1000078192 | 303 |
| 117 | 3300006931 | Ga0097620_100158630 | Ga0097620_1001586303 | 303 |
| 118 | 3300009098 | Ga0105245_10051980 | Ga0105245_100519802 | 303 |
| 119 | 3300009148 | Ga0105243_10068689 | Ga0105243_100686892 | 303 |
| 120 | 3300009148 | Ga0105243_10157022 | Ga0105243_101570222 | 303 |
| 121 | 3300009176 | Ga0105242_10020802 | Ga0105242_100208023 | 303 |
| 122 | 3300011119 | Ga0105246_10097655 | Ga0105246_100976552 | 303 |
| 123 | 3300014325 | Ga0163163_10060946 | Ga0163163_100609465 | 303 |
| 124 | 3300014969 | Ga0157376_10099232 | Ga0157376_100992323 | 303 |
| 125 | 3300025917 | Ga0207660_10125354 | Ga0207660_101253542 | 303 |
| 126 | 3300025931 | Ga0207644_10090609 | Ga0207644_100906092 | 303 |
| 127 | 3300026089 | Ga0207648_10273359 | Ga0207648_102733592 | 303 |
| 128 | 3300046455 | Ga0495603_0001527 | Ga0495603_0001527_9408_10472 | 303 |
| 129 | 3300046523 | Ga0495644_0047320 | Ga0495644_0047320_163_1227 | 303 |
| 130 | 3300046525 | Ga0495663_0025013 | Ga0495663_0025013_36_1100 | 303 |
| 131 | 3300046616 | Ga0495668_0077771 | Ga0495668_0077771_464_1528 | 303 |
| 132 | 3300046794 | Ga0495589_0039895 | Ga0495589_0039895_235_1299 | 303 |
| 133 | 3300047445 | Ga0495677_0021057 | Ga0495677_0021057_530_1594 | 303 |
| 134 | 3300048907 | Ga0496104_0059567 | Ga0496104_0059567_2102_3166 | 303 |
| 135 | 3300048907 | Ga0496104_0320778 | Ga0496104_0320778_44_1105 | 303 |
| 136 | 3300048908 | Ga0496105_0031368 | Ga0496105_0031368_2886_3950 | 303 |
| 137 | 3300048908 | Ga0496105_0284252 | Ga0496105_0284252_250_1311 | 303 |
| 138 | 3300048911 | Ga0496108_0047473 | Ga0496108_0047473_1235_2299 | 303 |
| 139 | 3300048912 | Ga0496109_0018867 | Ga0496109_0018867_632_1696 | 303 |
| 140 | 3300048913 | Ga0496110_0172019 | Ga0496110_0172019_607_1671 | 303 |
| 141 | 3300048914 | Ga0496111_0063246 | Ga0496111_0063246_807_1871 | 303 |
| 142 | 3300026118 | Ga0207675_100139306 | Ga0207675_1001393061 | 304 |
| 143 | 3300031730 | Ga0307516_10094284 | Ga0307516_100942842 | 304 |
| 144 | 3300046455 | Ga0495603_0006778 | Ga0495603_0006778_2237_3346 | 304 |
| 145 | 3300046459 | Ga0495629_0001210 | Ga0495629_0001210_13382_14491 | 304 |
| 146 | 3300046499 | Ga0495594_0004679 | Ga0495594_0004679_1646_2755 | 304 |
| 147 | 3300046660 | Ga0495625_0035607 | Ga0495625_0035607_2129_3214 | 304 |
| 148 | 3300046674 | Ga0495588_0018459 | Ga0495588_0018459_1037_2146 | 304 |
| 149 | 3300046689 | Ga0495613_0038873 | Ga0495613_0038873_782_1897 | 304 |
| 150 | 3300047321 | Ga0495676_0011537 | Ga0495676_0011537_2560_3669 | 304 |
| 151 | 3300047447 | Ga0495685_002409 | Ga0495685_002409_982_2067 | 304 |
| 152 | 3300049581 | Ga0501047_0165129 | Ga0501047_0165129_171_1256 | 304 |
| 153 | 3300053136 | Ga0500559_0000078 | Ga0500559_0000078_39636_40676 | 304 |
| 154 | 3300003323 | rootH1_10075760 | rootH1_100757602 | 305 |
| 155 | 3300005618 | Ga0068864_100006721 | Ga0068864_1000067218 | 305 |
| 156 | 3300005841 | Ga0068863_100011728 | Ga0068863_1000117285 | 305 |
| 157 | 3300009177 | Ga0105248_10011004 | Ga0105248_100110044 | 305 |
| 158 | 3300014968 | Ga0157379_10117544 | Ga0157379_101175442 | 305 |
| 159 | 3300025941 | Ga0207711_10012325 | Ga0207711_100123253 | 305 |
| 160 | 3300025945 | Ga0207679_10032663 | Ga0207679_100326633 | 305 |
| 161 | 3300026088 | Ga0207641_10010182 | Ga0207641_100101824 | 305 |
| 162 | 3300026095 | Ga0207676_10098040 | Ga0207676_100980402 | 305 |
| 163 | 3300026116 | Ga0207674_10071379 | Ga0207674_100713792 | 305 |
| 164 | 3300031616 | Ga0307508_10104446 | Ga0307508_101044462 | 305 |
| 165 | 3300042007 | Ga0439449_0004249 | Ga0439449_0004249_2105_3214 | 305 |
| 166 | 3300042157 | Ga0439458_0000129 | Ga0439458_0000129_10000_11085 | 305 |
| 167 | 3300048907 | Ga0496104_0010071 | Ga0496104_0010071_615_1715 | 305 |
| 168 | 3300048908 | Ga0496105_0008579 | Ga0496105_0008579_2269_3369 | 305 |
| 169 | 3300048911 | Ga0496108_0006573 | Ga0496108_0006573_4617_5717 | 305 |
| 170 | 3300048912 | Ga0496109_0028652 | Ga0496109_0028652_3477_4577 | 305 |
| 171 | 3300048913 | Ga0496110_0033403 | Ga0496110_0033403_2370_3470 | 305 |
| 172 | 3300048914 | Ga0496111_0004463 | Ga0496111_0004463_2150_3250 | 305 |
| 173 | 3300048915 | Ga0496112_0011400 | Ga0496112_0011400_4240_5340 | 305 |
| 174 | 3300048916 | Ga0496113_0006695 | Ga0496113_0006695_2245_3345 | 305 |
| 175 | 3300050490 | nmdc:mga03n38_127144_c1 | nmdc:mga03n38_127144_c1_153_1229 | 305 |
| 176 | 3300053140 | Ga0500573_0000011 | Ga0500573_0000011_82298_83365 | 305 |
| 177 | 3300053140 | Ga0500573_0002508 | Ga0500573_0002508_4620_5702 | 305 |
| 178 | 3300015688 | Ga0183367_1009 | Ga0183367_1009155 | 306 |
| 179 | 3300028786 | Ga0307517_10041560 | Ga0307517_100415604 | 306 |
| 180 | 3300031507 | Ga0307509_10058669 | Ga0307509_100586693 | 306 |
| 181 | 3300031616 | Ga0307508_10014180 | Ga0307508_100141802 | 306 |
| 182 | 3300031730 | Ga0307516_10041629 | Ga0307516_100416292 | 306 |
| 183 | 3300041460 | Ga0451802_1856646 | Ga0451802_1856646_263_1384 | 306 |
| 184 | 3300046499 | Ga0495594_0009881 | Ga0495594_0009881_1128_2222 | 306 |
| 185 | 3300046522 | Ga0495643_0002210 | Ga0495643_0002210_5814_6908 | 306 |
| 186 | 3300046691 | Ga0495670_0004432 | Ga0495670_0004432_2702_3796 | 306 |
| 187 | 3300046810 | Ga0495660_0007528 | Ga0495660_0007528_262_1356 | 306 |
| 188 | 3300047470 | Ga0495681_0005790 | Ga0495681_0005790_5939_7033 | 306 |
| 189 | 3300047472 | Ga0495686_0059037 | Ga0495686_0059037_103_1197 | 306 |
| 190 | 3300053079 | Ga0500610_0050402 | Ga0500610_0050402_67_1161 | 306 |
| 191 | 3300053094 | Ga0500566_0065238 | Ga0500566_0065238_726_1820 | 306 |
| 192 | 3300053161 | Ga0500634_0004885 | Ga0500634_0004885_4854_5948 | 306 |
| 193 | 3300053739 | Ga0500587_000300 | Ga0500587_000300_825_1919 | 306 |
| 194 | iso_pu_bacteria | 3006321560 | 3006327586 | 306 |
| 195 | 3300006353 | Ga0075370_10083687 | Ga0075370_100836872 | 307 |
| 196 | 3300009551 | Ga0105238_10275533 | Ga0105238_102755332 | 307 |
| 197 | 3300031456 | Ga0307513_10008634 | Ga0307513_1000863410 | 307 |
| 198 | 3300031616 | Ga0307508_10002597 | Ga0307508_100025976 | 307 |
| 199 | 3300031649 | Ga0307514_10016453 | Ga0307514_100164533 | 307 |
| 200 | 3300041404 | Ga0439436_0001484 | Ga0439436_0001484_1089_2213 | 307 |
| 201 | 3300041404 | Ga0439436_0003869 | Ga0439436_0003869_542_1624 | 307 |
| 202 | 3300041406 | Ga0439439_0002878 | Ga0439439_0002878_434_1558 | 307 |
| 203 | 3300041406 | Ga0439439_0027117 | Ga0439439_0027117_349_1413 | 307 |
| 204 | 3300041512 | Ga0451853_2949179 | Ga0451853_2949179_243_1388 | 307 |
| 205 | 3300041999 | Ga0439433_0006525 | Ga0439433_0006525_591_1673 | 307 |
| 206 | 3300042014 | Ga0439457_000747 | Ga0439457_000747_4651_5775 | 307 |
| 207 | 3300042145 | Ga0450906_000257 | Ga0450906_000257_5341_6420 | 307 |
| 208 | 3300046660 | Ga0495625_0062523 | Ga0495625_0062523_1311_2408 | 307 |
| 209 | 3300049568 | Ga0501031_0004707 | Ga0501031_0004707_4408_5493 | 307 |
| 210 | 3300049569 | Ga0501032_0001525 | Ga0501032_0001525_3359_4444 | 307 |
| 211 | 3300049570 | Ga0501033_0005395 | Ga0501033_0005395_6950_8035 | 307 |
| 212 | 3300049571 | Ga0501034_0004749 | Ga0501034_0004749_9752_10837 | 307 |
| 213 | 3300049572 | Ga0501036_0007960 | Ga0501036_0007960_3568_4653 | 307 |
| 214 | 3300049573 | Ga0501037_0012532 | Ga0501037_0012532_3359_4444 | 307 |
| 215 | 3300049574 | Ga0501038_0000223 | Ga0501038_0000223_5616_6701 | 307 |
| 216 | 3300049575 | Ga0501039_0008140 | Ga0501039_0008140_2917_4002 | 307 |
| 217 | 3300049576 | Ga0501040_0009773 | Ga0501040_0009773_3751_4836 | 307 |
| 218 | 3300049577 | Ga0501041_0023324 | Ga0501041_0023324_914_1999 | 307 |
| 219 | 3300049578 | Ga0501042_0021573 | Ga0501042_0021573_335_1420 | 307 |
| 220 | 3300049579 | Ga0501043_0000513 | Ga0501043_0000513_29501_30586 | 307 |
| 221 | 3300049580 | Ga0501046_0013830 | Ga0501046_0013830_2982_4067 | 307 |
| 222 | 3300049581 | Ga0501047_0000433 | Ga0501047_0000433_39823_40908 | 307 |
| 223 | 3300049582 | Ga0501048_0009945 | Ga0501048_0009945_2598_3683 | 307 |
| 224 | 3300049583 | Ga0501067_0003704 | Ga0501067_0003704_5621_6706 | 307 |
| 225 | 3300049587 | Ga0501071_0003658 | Ga0501071_0003658_5618_6703 | 307 |
| 226 | 3300049589 | Ga0501073_0052699 | Ga0501073_0052699_1429_2514 | 307 |
| 227 | 3300049741 | Ga0501079_0015724 | Ga0501079_0015724_2598_3683 | 307 |
| 228 | 3300049742 | Ga0501080_0125007 | Ga0501080_0125007_254_1339 | 307 |
| 229 | 3300049822 | Ga0501035_0000624 | Ga0501035_0000624_28852_29937 | 307 |
| 230 | 3300049823 | Ga0501044_0004307 | Ga0501044_0004307_5123_6208 | 307 |
| 231 | 3300049824 | Ga0501045_0008143 | Ga0501045_0008143_3748_4833 | 307 |
| 232 | 3300050490 | nmdc:mga03n38_15401_c1 | nmdc:mga03n38_15401_c1_347_1429 | 307 |
| 233 | 3300050496 | nmdc:mga07m45_70494_c1 | nmdc:mga07m45_70494_c1_206_1288 | 307 |
| 234 | iso_pu_bacteria | 2554235005 | 2554260954 | 307 |
| 235 | iso_pu_bacteria | 2643221647 | 2644268913 | 307 |
| 236 | iso_pu_bacteria | 2786546132 | 2786669304 | 307 |
| 237 | iso_pu_bacteria | 2811994879 | 2812358891 | 307 |
| 238 | iso_pu_bacteria | 2862281513 | 2862288368 | 307 |
| 239 | iso_pu_bacteria | 2877676314 | 2877682272 | 307 |
| 240 | iso_pu_bacteria | 2919468124 | 2919468439 | 307 |
| 241 | iso_pu_bacteria | 2947224130 | 2947229393 | 307 |
| 242 | iso_pu_bacteria | 2954002825 | 2954003973 | 307 |
| 243 | iso_pu_bacteria | 2954380949 | 2954387402 | 307 |
| 244 | iso_pu_bacteria | 2954673503 | 2954675767 | 307 |
| 245 | iso_pu_bacteria | 2954682443 | 2954688497 | 307 |
| 246 | iso_pu_bacteria | 2954691527 | 2954698235 | 307 |
| 247 | iso_pu_bacteria | 2954701450 | 2954703992 | 307 |
| 248 | iso_pu_bacteria | 3006486233 | 3006487818 | 307 |
| 249 | 3300005327 | Ga0070658_10021387 | Ga0070658_100213875 | 308 |
| 250 | 3300005336 | Ga0070680_100006379 | Ga0070680_1000063793 | 308 |
| 251 | 3300005344 | Ga0070661_100006882 | Ga0070661_1000068822 | 308 |
| 252 | 3300005458 | Ga0070681_10044237 | Ga0070681_100442374 | 308 |
| 253 | 3300005530 | Ga0070679_100019382 | Ga0070679_1000193825 | 308 |
| 254 | 3300005535 | Ga0070684_100015005 | Ga0070684_1000150052 | 308 |
| 255 | 3300013105 | Ga0157369_10022694 | Ga0157369_100226944 | 308 |
| 256 | 3300013307 | Ga0157372_10133300 | Ga0157372_101333001 | 308 |
| 257 | 3300025912 | Ga0207707_10027914 | Ga0207707_100279142 | 308 |
| 258 | 3300025917 | Ga0207660_10049626 | Ga0207660_100496262 | 308 |
| 259 | 3300025920 | Ga0207649_10024522 | Ga0207649_100245223 | 308 |
| 260 | 3300025944 | Ga0207661_10003012 | Ga0207661_100030126 | 308 |
| 261 | 3300026116 | Ga0207674_10111998 | Ga0207674_101119982 | 308 |
| 262 | 3300005535 | Ga0070684_100142395 | Ga0070684_1001423952 | 309 |
| 263 | 3300005983 | Ga0081540_1006264 | Ga0081540_10062646 | 309 |
| 264 | 3300031901 | Ga0307406_10065173 | Ga0307406_100651732 | 309 |
| 265 | 3300032002 | Ga0307416_100070496 | Ga0307416_1000704961 | 309 |
| 266 | 3300053153 | Ga0500616_0001061 | Ga0500616_0001061_18133_19209 | 309 |
| 267 | iso_pu_bacteria | 2643221587 | 2643947199 | 309 |
| 268 | iso_pu_bacteria | 2643221677 | 2644433330 | 309 |
| 269 | 3300053090 | Ga0500646_0002690 | Ga0500646_0002690_3248_4336 | 310 |
| 270 | 3300002075 | JGI24738J21930_10011562 | JGI24738J21930_100115622 | 311 |
| 271 | 3300005563 | Ga0068855_100294730 | Ga0068855_1002947302 | 311 |
| 272 | 3300009176 | Ga0105242_10158683 | Ga0105242_101586831 | 311 |
| 273 | 3300014497 | Ga0182008_10004953 | Ga0182008_100049534 | 311 |
| 274 | 3300025904 | Ga0207647_10009338 | Ga0207647_100093386 | 311 |
| 275 | 3300026078 | Ga0207702_10108112 | Ga0207702_101081122 | 311 |
| 276 | 3300031838 | Ga0307518_10152058 | Ga0307518_101520582 | 311 |
| 277 | 3300042131 | Ga0450894_000183 | Ga0450894_000183_1929_3008 | 311 |
| 278 | 3300042134 | Ga0450898_002048 | Ga0450898_002048_605_1684 | 311 |
| 279 | 3300053140 | Ga0500573_0021909 | Ga0500573_0021909_2115_3197 | 311 |
| 280 | iso_pu_bacteria | 2643221678 | 2644436127 | 311 |
| 281 | iso_pu_bacteria | 2643221714 | 2644632016 | 311 |
| 282 | iso_pu_bacteria | 2784746763 | 2785344592 | 311 |
| 283 | iso_pu_bacteria | 2808606359 | 2808840953 | 311 |
| 284 | iso_pu_bacteria | 2862382967 | 2862384274 | 311 |
| 285 | iso_pu_bacteria | 2863404153 | 2863405858 | 311 |
| 286 | iso_pu_bacteria | 2946072368 | 2946074910 | 311 |
| 287 | iso_pu_bacteria | 2990059506 | 2990067057 | 311 |
| 288 | iso_pu_bacteria | 8008558824 | 8008559269 | 311 |
| 289 | iso_pu_bacteria | 8048406513 | 8048407956 | 311 |
| 290 | iso_pu_bacteria | 8055066027 | 8055070174 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.4782 | 17 | 270 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4381 | 30 | 304 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4348 | 30 | 304 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.4104 | 17 | 270 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.335 | 49 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7064 | 49 | 289 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6926 | 49 | 289 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6791 | 49 | 289 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6721 | 49 | 289 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6499 | 49 | 289 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I0EJ36-F1-model_v4 | ABC transporter permease | 0.7353 | 3 | 296 |
GO:0005886
GO:0022857 |
| AF-A0A3D4KY75-F1-model_v4 | Sugar ABC transporter permease | 0.7277 | 62 | 303 |
GO:0005886
GO:0022857 |
| AF-A0A352CPJ2-F1-model_v4 | Sugar ABC transporter permease | 0.7226 | 94 | 303 |
GO:0005886
GO:0022857 |
| AF-A0A3C2BNR8-F1-model_v4 | deleted | 0.7202 | 49 | 222 |
|
| AF-A0A1Q7W1J3-F1-model_v4 | Sugar ABC transporter permease | 0.7188 | 1 | 303 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar