F389676

General Info

Members Datasets Scaffolds Average Seq Length
290 174 580 218

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10042935|Ga0081455_100429353
Length 228
Sequence VPDVGEAIGQILPLAVGVAVSPVPIIAVILMLVTPRARMNGPAFVLGWLVGLAAVGVIVLAIASPADANDDGEPATWVSVLKLALGLLLVVVALREWRGRPRGGEQAATPKWMGALDNFTPVKALLGGVVLSIANPKNLLLILGGAAALAQFGLSGGDETGCWIVFTVIASIGVGAPVVIYFAMGDRAAAILDELKTWMARNNAAVMAVLCLIIGVKLVGDAISGLSA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
92 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
93 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 6.9
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10042935 3300005937 Bacteria 3961
2 JGI25407J50210_10010281 3300003373 Bacteria 2379
3 JGI25407J50210_10024686 3300003373 Bacteria 1559
4 JGI25404J52841_10029135 3300003659 Bacteria 1184
5 Ga0070683_100740343 3300005329 Bacteria 942
6 Ga0070683_100781590 3300005329 Bacteria 915
7 Ga0068869_100025995 3300005334 Bacteria 4071
8 Ga0070689_100097246 3300005340 Bacteria 2328
9 Ga0070687_100017348 3300005343 Bacteria 3307
10 Ga0070692_10231729 3300005345 Bacteria 1097
11 Ga0070674_100193169 3300005356 Bacteria 1567
12 Ga0070673_100429446 3300005364 Bacteria 1186
13 Ga0070688_100702105 3300005365 Bacteria 783
14 Ga0070710_10007529 3300005437 Bacteria 5274
15 Ga0070705_100149574 3300005440 Bacteria 1547
16 Ga0070663_100625146 3300005455 Bacteria 908
17 Ga0068867_100141556 3300005459 Bacteria 1880
18 Ga0068853_100328490 3300005539 Bacteria 1419
19 Ga0070665_100274955 3300005548 Bacteria 1686
20 Ga0070702_100006376 3300005615 Bacteria 5581
21 Ga0070702_100372147 3300005615 Bacteria 1013
22 Ga0068852_100384300 3300005616 Bacteria 1378
23 Ga0068859_100075913 3300005617 Bacteria 3401
24 Ga0068859_101011931 3300005617 Unclassified 913
25 Ga0068866_10047574 3300005718 Bacteria 2163
26 Ga0068861_100084598 3300005719 Bacteria 2490
27 Ga0068851_10274080 3300005834 Bacteria 963
28 Ga0068870_10187069 3300005840 Bacteria 1247
29 Ga0068862_100127537 3300005844 Bacteria 2248
30 Ga0081455_10003888 3300005937 Bacteria 17011
31 Ga0081455_10150102 3300005937 Bacteria 1798
32 Ga0081455_10257546 3300005937 Bacteria 1272
33 Ga0081538_10000191 3300005981 Bacteria 67563
34 Ga0081538_10000468 3300005981 Bacteria 45298
35 Ga0081538_10000999 3300005981 Bacteria 30090
36 Ga0081538_10002182 3300005981 Bacteria 19423
37 Ga0081538_10041322 3300005981 Bacteria 2928
38 Ga0081538_10044206 3300005981 Bacteria 2782
39 Ga0081538_10140487 3300005981 Bacteria 1115
40 Ga0081540_1003386 3300005983 Bacteria 12640
41 Ga0081540_1068487 3300005983 Bacteria 1653
42 Ga0081540_1071988 3300005983 Bacteria 1594
43 Ga0070712_100002347 3300006175 Bacteria 11666
44 Ga0097621_100600649 3300006237 Bacteria 1006
45 Ga0075433_10099664 3300006852 Bacteria 2572
46 Ga0075434_100521727 3300006871 Unclassified 1208
47 Ga0075434_100828292 3300006871 Bacteria 941
48 Ga0097620_100075913 3300006931 Bacteria 3401
49 Ga0097620_101012048 3300006931 Unclassified 913
50 Ga0075435_100424534 3300007076 Bacteria 1145
51 Ga0111539_10174890 3300009094 Bacteria 2508
52 Ga0105245_10076265 3300009098 Bacteria 3054
53 Ga0105245_10928192 3300009098 Bacteria 913
54 Ga0105247_10086744 3300009101 Bacteria 1981
55 Ga0105243_10183603 3300009148 Bacteria 1821
56 Ga0105242_10342628 3300009176 Bacteria 1378
57 Ga0105248_10656825 3300009177 Bacteria 1183
58 Ga0105246_10414461 3300011119 Bacteria 1122
59 Ga0157369_10197882 3300013105 Bacteria 2109
60 Ga0163162_11105251 3300013306 Bacteria 898
61 Ga0157380_10000016 3300014326 Bacteria 126029
62 Ga0157380_10163001 3300014326 Bacteria 1940
63 Ga0157380_10452616 3300014326 Bacteria 1233
64 Ga0157377_10233114 3300014745 Bacteria 1185
65 Ga0157379_10211414 3300014968 Bacteria 1756
66 Ga0163161_10602496 3300017792 Bacteria 906
67 Ga0213875_10250148 3300021388 Bacteria 836
68 Ga0207692_10009690 3300025898 Bacteria 4033
69 Ga0207642_10088067 3300025899 Bacteria 1526
70 Ga0207688_10191997 3300025901 Bacteria 1222
71 Ga0207647_10339113 3300025904 Bacteria 852
72 Ga0207693_10024244 3300025915 Bacteria 4816
73 Ga0207663_10004259 3300025916 Bacteria 7098
74 Ga0207662_10008180 3300025918 Bacteria 5719
75 Ga0207687_10076962 3300025927 Bacteria 2398
76 Ga0207687_10282543 3300025927 Bacteria 1331
77 Ga0207664_10055487 3300025929 Bacteria 3144
78 Ga0207664_10373877 3300025929 Bacteria 1264
79 Ga0207690_10013945 3300025932 Bacteria 4843
80 Ga0207686_10266753 3300025934 Bacteria 1258
81 Ga0207669_10343757 3300025937 Bacteria 1150
82 Ga0207704_10051775 3300025938 Bacteria 2485
83 Ga0207704_10428817 3300025938 Bacteria 1050
84 Ga0207661_10296715 3300025944 Bacteria 1448
85 Ga0207661_10392347 3300025944 Bacteria 1258
86 Ga0207639_10252140 3300026041 Bacteria 1539
87 Ga0207678_10273221 3300026067 Unclassified 1450
88 Ga0207678_10281372 3300026067 Bacteria 1428
89 Ga0207708_10140800 3300026075 Bacteria 1892
90 Ga0207708_10325908 3300026075 Bacteria 1254
91 Ga0207648_10039763 3300026089 Bacteria 4134
92 Ga0207676_10140585 3300026095 Bacteria 2066
93 Ga0207675_100060872 3300026118 Bacteria 3525
94 Ga0207698_10295970 3300026142 Bacteria 1504
95 Ga0207428_10296581 3300027907 Bacteria 1197
96 Ga0268266_10999219 3300028379 Bacteria 810
97 Ga0268265_10082975 3300028380 Bacteria 2536
98 Ga0307408_100137597 3300031548 Bacteria 1913
99 Ga0307405_10006263 3300031731 Bacteria 5837
100 Ga0307405_10022049 3300031731 Bacteria 3594
101 Ga0307405_10452073 3300031731 Bacteria 1019
102 Ga0307405_10649174 3300031731 Bacteria 867
103 Ga0307413_10111771 3300031824 Bacteria 1830
104 Ga0307410_10023052 3300031852 Bacteria 3862
105 Ga0307410_10163455 3300031852 Bacteria 1670
106 Ga0307410_10344240 3300031852 Bacteria 1189
107 Ga0307410_10380840 3300031852 Bacteria 1135
108 Ga0307406_10003657 3300031901 Bacteria 8377
109 Ga0307406_10007153 3300031901 Bacteria 6183
110 Ga0307406_10100071 3300031901 Bacteria 1972
111 Ga0307406_10111705 3300031901 Bacteria 1883
112 Ga0307406_10401665 3300031901 Bacteria 1086
113 Ga0307407_10097592 3300031903 Bacteria 1817
114 Ga0307407_10133007 3300031903 Bacteria 1594
115 Ga0307407_10289600 3300031903 Bacteria 1138
116 Ga0307412_10063927 3300031911 Bacteria 2485
117 Ga0307412_10237997 3300031911 Bacteria 1406
118 Ga0307412_10701888 3300031911 Bacteria 868
119 Ga0307409_100010060 3300031995 Bacteria 5853
120 Ga0307409_100020640 3300031995 Bacteria 4495
121 Ga0307409_100351359 3300031995 Bacteria 1391
122 Ga0307416_100185153 3300032002 Bacteria 1956
123 Ga0307416_100308416 3300032002 Bacteria 1578
124 Ga0307416_100649642 3300032002 Bacteria 1139
125 Ga0307416_100711820 3300032002 Bacteria 1094
126 Ga0307414_10050202 3300032004 Bacteria 2889
127 Ga0307411_10355103 3300032005 Bacteria 1196
128 Ga0307411_10676018 3300032005 Bacteria 897
129 Ga0307415_100008525 3300032126 Bacteria 5689
130 Ga0307415_100070773 3300032126 Bacteria 2450
131 Ga0307415_100086410 3300032126 Bacteria 2257
132 Ga0307415_100134732 3300032126 Bacteria 1876
133 Ga0307415_101062921 3300032126 Bacteria 756
134 Ga0373955_0168406 3300035172 Bacteria 1296
135 Ga0373933_0483928 3300035724 Bacteria 810
136 Ga0373937_0462823 3300036401 Bacteria 1204
137 Ga0436364_0046449 3300037853 Bacteria 8315
138 Ga0436364_1477953 3300037853 Bacteria 2280
139 Ga0436365_0563623 3300039437 Bacteria 1228
140 Ga0436365_0736401 3300039437 Bacteria 998
141 Ga0436365_0766410 3300039437 Bacteria 7385
142 Ga0436362_0867423 3300039453 Bacteria 3199
143 Ga0451853_0975736 3300041512 Bacteria 1018
144 Ga0439448_0011619 3300042005 Bacteria 2626
145 Ga0439463_002321 3300042016 Bacteria 4854
146 Ga0439464_0008849 3300042439 Bacteria 2639
147 Ga0439460_0013338 3300042461 Bacteria 2148
148 Ga0495592_0157688 3300046454 Bacteria 1564
149 Ga0495592_0475687 3300046454 Bacteria 779
150 Ga0495629_0154954 3300046459 Unclassified 1592
151 Ga0495651_0004234 3300046462 Bacteria 10995
152 Ga0495651_0137949 3300046462 Bacteria 1772
153 Ga0495653_0116544 3300046463 Bacteria 1910
154 Ga0495582_0144393 3300046473 Bacteria 1349
155 Ga0495582_0286842 3300046473 Bacteria 945
156 Ga0495662_0051611 3300046476 Bacteria 1985
157 Ga0495662_0270549 3300046476 Bacteria 836
158 Ga0495608_0002664 3300046511 Bacteria 12816
159 Ga0495628_0085193 3300046516 Bacteria 2452
160 Ga0495630_0005203 3300046517 Bacteria 9167
161 Ga0495630_0008132 3300046517 Bacteria 7537
162 Ga0495630_0047947 3300046517 Bacteria 3196
163 Ga0495644_0166978 3300046523 Bacteria 845
164 Ga0495666_0010366 3300046526 Bacteria 4645
165 Ga0495652_0300181 3300046529 Bacteria 1168
166 Ga0495640_0010090 3300046533 Bacteria 7321
167 Ga0495587_0065367 3300046536 Bacteria 2124
168 Ga0495667_0000356 3300046559 Bacteria 29062
169 Ga0495656_0071551 3300046615 Bacteria 1542
170 Ga0495599_0030839 3300046678 Bacteria 3366
171 Ga0495599_0064668 3300046678 Bacteria 2285
172 Ga0495646_0139128 3300046680 Bacteria 1359
173 Ga0495646_0170223 3300046680 Bacteria 1201
174 Ga0495658_0076101 3300046683 Bacteria 1961
175 Ga0495658_0116699 3300046683 Bacteria 1610
176 Ga0495658_0332936 3300046683 Bacteria 963
177 Ga0495613_0011998 3300046689 Bacteria 6440
178 Ga0495624_0260426 3300046690 Bacteria 1048
179 Ga0495600_0176305 3300046809 Bacteria 1378
180 Ga0495600_0250171 3300046809 Bacteria 1127
181 Ga0495604_0014377 3300047317 Bacteria 6313
182 Ga0495674_0000584 3300047319 Bacteria 34100
183 Ga0495674_0091176 3300047319 Bacteria 2603
184 Ga0495674_0468915 3300047319 Bacteria 1010
185 Ga0495676_0515112 3300047321 Bacteria 784
186 Ga0495680_0000204 3300047322 Bacteria 64223
187 Ga0495680_0026636 3300047322 Bacteria 4762
188 Ga0495680_0065351 3300047322 Bacteria 2786
189 Ga0495675_0153112 3300047444 Bacteria 1424
190 Ga0495602_0017143 3300048088 Bacteria 7266
191 Ga0496100_0232348 3300048903 Bacteria 1357
192 Ga0496102_0123946 3300048905 Bacteria 2415
193 Ga0496102_0243803 3300048905 Bacteria 1694
194 Ga0496102_0909954 3300048905 Bacteria 801
195 Ga0496104_0201212 3300048907 Bacteria 1904
196 Ga0496106_0032818 3300048909 Bacteria 3871
197 Ga0496106_0221271 3300048909 Bacteria 1510
198 Ga0496107_0039945 3300048910 Bacteria 3367
199 Ga0496108_0019418 3300048911 Bacteria 5581
200 Ga0496108_0286746 3300048911 Bacteria 1433
201 Ga0496108_0361928 3300048911 Bacteria 1266
202 Ga0496109_0101061 3300048912 Bacteria 2676
203 Ga0496109_0103109 3300048912 Bacteria 2647
204 Ga0496110_0157318 3300048913 Bacteria 2059
205 Ga0496110_0392499 3300048913 Bacteria 1265
206 Ga0496110_0692311 3300048913 Bacteria 920
207 Ga0496112_0039197 3300048915 Bacteria 4628
208 Ga0496112_0860622 3300048915 Bacteria 830
209 Ga0496113_0014144 3300048916 Bacteria 5434
210 Ga0496114_0221678 3300048917 Bacteria 1660
211 Ga0496121_0001564 3300048924 Bacteria 38212
212 Ga0501031_0012995 3300049568 Bacteria 5432
213 Ga0501032_0014186 3300049569 Bacteria 5645
214 Ga0501032_0014917 3300049569 Bacteria 5498
215 Ga0501033_0008605 3300049570 Bacteria 7897
216 Ga0501034_0062531 3300049571 Bacteria 3738
217 Ga0501036_0061808 3300049572 Bacteria 3172
218 Ga0501037_0003025 3300049573 Bacteria 12207
219 Ga0501037_0006192 3300049573 Bacteria 8751
220 Ga0501038_0000449 3300049574 Bacteria 35859
221 Ga0501038_0015277 3300049574 Bacteria 6980
222 Ga0501039_0014205 3300049575 Bacteria 6096
223 Ga0501039_0043321 3300049575 Bacteria 3476
224 Ga0501040_0005446 3300049576 Bacteria 8237
225 Ga0501040_0378234 3300049576 Bacteria 1016
226 Ga0501041_0005720 3300049577 Bacteria 7264
227 Ga0501041_0030071 3300049577 Bacteria 3278
228 Ga0501041_0198182 3300049577 Bacteria 1258
229 Ga0501042_0005061 3300049578 Bacteria 8459
230 Ga0501042_0006659 3300049578 Bacteria 7528
231 Ga0501042_0033037 3300049578 Bacteria 3666
232 Ga0501042_0154390 3300049578 Bacteria 1656
233 Ga0501043_0013324 3300049579 Bacteria 6429
234 Ga0501043_0024079 3300049579 Bacteria 4777
235 Ga0501046_0008837 3300049580 Bacteria 8751
236 Ga0501047_0113005 3300049581 Bacteria 2598
237 Ga0501048_0004591 3300049582 Bacteria 10510
238 Ga0501048_0110013 3300049582 Bacteria 1945
239 Ga0501067_0248764 3300049583 Bacteria 989
240 Ga0501068_0000296 3300049584 Bacteria 24872
241 Ga0501068_0036827 3300049584 Bacteria 2927
242 Ga0501069_0001914 3300049585 Bacteria 10391
243 Ga0501069_0012847 3300049585 Bacteria 4458
244 Ga0501070_0010567 3300049586 Bacteria 7802
245 Ga0501070_0018489 3300049586 Bacteria 5848
246 Ga0501071_0002139 3300049587 Bacteria 11864
247 Ga0501071_0290317 3300049587 Bacteria 1238
248 Ga0501072_0029200 3300049588 Bacteria 4305
249 Ga0501072_0049603 3300049588 Bacteria 3305
250 Ga0501072_0174205 3300049588 Bacteria 1716
251 Ga0501072_0249914 3300049588 Bacteria 1412
252 Ga0501073_0001149 3300049589 Bacteria 19291
253 Ga0501073_0014038 3300049589 Bacteria 5819
254 Ga0501074_0011597 3300049590 Bacteria 6407
255 Ga0501074_0028980 3300049590 Bacteria 4010
256 Ga0501075_0004175 3300049591 Bacteria 9752
257 Ga0501076_0023100 3300049592 Bacteria 4788
258 Ga0501076_0025062 3300049592 Bacteria 4613
259 Ga0501076_0090521 3300049592 Bacteria 2461
260 Ga0501076_0210167 3300049592 Bacteria 1590
261 Ga0501076_0631036 3300049592 Bacteria 884
262 Ga0501077_0011820 3300049593 Bacteria 5459
263 Ga0501077_0024919 3300049593 Bacteria 3798
264 Ga0501077_0147850 3300049593 Bacteria 1491
265 Ga0501077_0211215 3300049593 Bacteria 1233
266 Ga0501079_0016503 3300049741 Bacteria 5640
267 Ga0501079_0307263 3300049741 Bacteria 1241
268 Ga0501080_0002557 3300049742 Bacteria 15927
269 Ga0501080_0023887 3300049742 Bacteria 5666
270 Ga0501081_0023241 3300049743 Bacteria 4154
271 Ga0501083_0000472 3300049744 Bacteria 25836
272 Ga0501083_0022008 3300049744 Bacteria 4426
273 Ga0501035_0003940 3300049822 Bacteria 14156
274 Ga0501035_0010681 3300049822 Bacteria 8500
275 Ga0501044_0033830 3300049823 Bacteria 5367
276 Ga0501044_0051300 3300049823 Bacteria 4254
277 Ga0501045_0014546 3300049824 Bacteria 5578
278 Ga0501045_0173245 3300049824 Bacteria 1607
279 nmdc:mga08y16_28163_c1 3300050511 Bacteria 5922
280 Ga0495601_0360153 3300053077 Bacteria 945
281 Ga0495601_0515491 3300053077 Bacteria 771
282 Ga0495619_0043207 3300053085 Bacteria 2954
283 Ga0500616_0061437 3300053153 Bacteria 1944
284 Ga0501084_0010915 3300054114 Bacteria 7523
285 Ga0501084_0183997 3300054114 Bacteria 1763
286 Ga0501084_0447032 3300054114 Bacteria 1093
287 Ga0501084_0668265 3300054114 Bacteria 877
288 Ga0501082_0003300 3300060353 Bacteria 14083
289 Ga0530510_0007565 3300061734 Bacteria 7570
290 Ga0530510_0024507 3300061734 Bacteria 4305
291 Ga0081455_10042935
292 JGI25407J50210_10010281
293 JGI25407J50210_10024686
294 JGI25404J52841_10029135
295 Ga0070683_100740343
296 Ga0070683_100781590
297 Ga0068869_100025995
298 Ga0070689_100097246
299 Ga0070687_100017348
300 Ga0070692_10231729
301 Ga0070674_100193169
302 Ga0070673_100429446
303 Ga0070688_100702105
304 Ga0070710_10007529
305 Ga0070705_100149574
306 Ga0070663_100625146
307 Ga0068867_100141556
308 Ga0068853_100328490
309 Ga0070665_100274955
310 Ga0070702_100006376
311 Ga0070702_100372147
312 Ga0068852_100384300
313 Ga0068859_100075913
314 Ga0068859_101011931
315 Ga0068866_10047574
316 Ga0068861_100084598
317 Ga0068851_10274080
318 Ga0068870_10187069
319 Ga0068862_100127537
320 Ga0081455_10003888
321 Ga0081455_10150102
322 Ga0081455_10257546
323 Ga0081538_10000191
324 Ga0081538_10000468
325 Ga0081538_10000999
326 Ga0081538_10002182
327 Ga0081538_10041322
328 Ga0081538_10044206
329 Ga0081538_10140487
330 Ga0081540_1003386
331 Ga0081540_1068487
332 Ga0081540_1071988
333 Ga0070712_100002347
334 Ga0097621_100600649
335 Ga0075433_10099664
336 Ga0075434_100521727
337 Ga0075434_100828292
338 Ga0097620_100075913
339 Ga0097620_101012048
340 Ga0075435_100424534
341 Ga0111539_10174890
342 Ga0105245_10076265
343 Ga0105245_10928192
344 Ga0105247_10086744
345 Ga0105243_10183603
346 Ga0105242_10342628
347 Ga0105248_10656825
348 Ga0105246_10414461
349 Ga0157369_10197882
350 Ga0163162_11105251
351 Ga0157380_10000016
352 Ga0157380_10163001
353 Ga0157380_10452616
354 Ga0157377_10233114
355 Ga0157379_10211414
356 Ga0163161_10602496
357 Ga0213875_10250148
358 Ga0207692_10009690
359 Ga0207642_10088067
360 Ga0207688_10191997
361 Ga0207647_10339113
362 Ga0207693_10024244
363 Ga0207663_10004259
364 Ga0207662_10008180
365 Ga0207687_10076962
366 Ga0207687_10282543
367 Ga0207664_10055487
368 Ga0207664_10373877
369 Ga0207690_10013945
370 Ga0207686_10266753
371 Ga0207669_10343757
372 Ga0207704_10051775
373 Ga0207704_10428817
374 Ga0207661_10296715
375 Ga0207661_10392347
376 Ga0207639_10252140
377 Ga0207678_10273221
378 Ga0207678_10281372
379 Ga0207708_10140800
380 Ga0207708_10325908
381 Ga0207648_10039763
382 Ga0207676_10140585
383 Ga0207675_100060872
384 Ga0207698_10295970
385 Ga0207428_10296581
386 Ga0268266_10999219
387 Ga0268265_10082975
388 Ga0307408_100137597
389 Ga0307405_10006263
390 Ga0307405_10022049
391 Ga0307405_10452073
392 Ga0307405_10649174
393 Ga0307413_10111771
394 Ga0307410_10023052
395 Ga0307410_10163455
396 Ga0307410_10344240
397 Ga0307410_10380840
398 Ga0307406_10003657
399 Ga0307406_10007153
400 Ga0307406_10100071
401 Ga0307406_10111705
402 Ga0307406_10401665
403 Ga0307407_10097592
404 Ga0307407_10133007
405 Ga0307407_10289600
406 Ga0307412_10063927
407 Ga0307412_10237997
408 Ga0307412_10701888
409 Ga0307409_100010060
410 Ga0307409_100020640
411 Ga0307409_100351359
412 Ga0307416_100185153
413 Ga0307416_100308416
414 Ga0307416_100649642
415 Ga0307416_100711820
416 Ga0307414_10050202
417 Ga0307411_10355103
418 Ga0307411_10676018
419 Ga0307415_100008525
420 Ga0307415_100070773
421 Ga0307415_100086410
422 Ga0307415_100134732
423 Ga0307415_101062921
424 Ga0373955_0168406
425 Ga0373933_0483928
426 Ga0373937_0462823
427 Ga0436364_0046449
428 Ga0436364_1477953
429 Ga0436365_0563623
430 Ga0436365_0736401
431 Ga0436365_0766410
432 Ga0436362_0867423
433 Ga0451853_0975736
434 Ga0439448_0011619
435 Ga0439463_002321
436 Ga0439464_0008849
437 Ga0439460_0013338
438 Ga0495592_0157688
439 Ga0495592_0475687
440 Ga0495629_0154954
441 Ga0495651_0004234
442 Ga0495651_0137949
443 Ga0495653_0116544
444 Ga0495582_0144393
445 Ga0495582_0286842
446 Ga0495662_0051611
447 Ga0495662_0270549
448 Ga0495608_0002664
449 Ga0495628_0085193
450 Ga0495630_0005203
451 Ga0495630_0008132
452 Ga0495630_0047947
453 Ga0495644_0166978
454 Ga0495666_0010366
455 Ga0495652_0300181
456 Ga0495640_0010090
457 Ga0495587_0065367
458 Ga0495667_0000356
459 Ga0495656_0071551
460 Ga0495599_0030839
461 Ga0495599_0064668
462 Ga0495646_0139128
463 Ga0495646_0170223
464 Ga0495658_0076101
465 Ga0495658_0116699
466 Ga0495658_0332936
467 Ga0495613_0011998
468 Ga0495624_0260426
469 Ga0495600_0176305
470 Ga0495600_0250171
471 Ga0495604_0014377
472 Ga0495674_0000584
473 Ga0495674_0091176
474 Ga0495674_0468915
475 Ga0495676_0515112
476 Ga0495680_0000204
477 Ga0495680_0026636
478 Ga0495680_0065351
479 Ga0495675_0153112
480 Ga0495602_0017143
481 Ga0496100_0232348
482 Ga0496102_0123946
483 Ga0496102_0243803
484 Ga0496102_0909954
485 Ga0496104_0201212
486 Ga0496106_0032818
487 Ga0496106_0221271
488 Ga0496107_0039945
489 Ga0496108_0019418
490 Ga0496108_0286746
491 Ga0496108_0361928
492 Ga0496109_0101061
493 Ga0496109_0103109
494 Ga0496110_0157318
495 Ga0496110_0392499
496 Ga0496110_0692311
497 Ga0496112_0039197
498 Ga0496112_0860622
499 Ga0496113_0014144
500 Ga0496114_0221678
501 Ga0496121_0001564
502 Ga0501031_0012995
503 Ga0501032_0014186
504 Ga0501032_0014917
505 Ga0501033_0008605
506 Ga0501034_0062531
507 Ga0501036_0061808
508 Ga0501037_0003025
509 Ga0501037_0006192
510 Ga0501038_0000449
511 Ga0501038_0015277
512 Ga0501039_0014205
513 Ga0501039_0043321
514 Ga0501040_0005446
515 Ga0501040_0378234
516 Ga0501041_0005720
517 Ga0501041_0030071
518 Ga0501041_0198182
519 Ga0501042_0005061
520 Ga0501042_0006659
521 Ga0501042_0033037
522 Ga0501042_0154390
523 Ga0501043_0013324
524 Ga0501043_0024079
525 Ga0501046_0008837
526 Ga0501047_0113005
527 Ga0501048_0004591
528 Ga0501048_0110013
529 Ga0501067_0248764
530 Ga0501068_0000296
531 Ga0501068_0036827
532 Ga0501069_0001914
533 Ga0501069_0012847
534 Ga0501070_0010567
535 Ga0501070_0018489
536 Ga0501071_0002139
537 Ga0501071_0290317
538 Ga0501072_0029200
539 Ga0501072_0049603
540 Ga0501072_0174205
541 Ga0501072_0249914
542 Ga0501073_0001149
543 Ga0501073_0014038
544 Ga0501074_0011597
545 Ga0501074_0028980
546 Ga0501075_0004175
547 Ga0501076_0023100
548 Ga0501076_0025062
549 Ga0501076_0090521
550 Ga0501076_0210167
551 Ga0501076_0631036
552 Ga0501077_0011820
553 Ga0501077_0024919
554 Ga0501077_0147850
555 Ga0501077_0211215
556 Ga0501079_0016503
557 Ga0501079_0307263
558 Ga0501080_0002557
559 Ga0501080_0023887
560 Ga0501081_0023241
561 Ga0501083_0000472
562 Ga0501083_0022008
563 Ga0501035_0003940
564 Ga0501035_0010681
565 Ga0501044_0033830
566 Ga0501044_0051300
567 Ga0501045_0014546
568 Ga0501045_0173245
569 nmdc:mga08y16_28163_c1
570 Ga0495601_0360153
571 Ga0495601_0515491
572 Ga0495619_0043207
573 Ga0500616_0061437
574 Ga0501084_0010915
575 Ga0501084_0183997
576 Ga0501084_0447032
577 Ga0501084_0668265
578 Ga0501082_0003300
579 Ga0530510_0007565
580 Ga0530510_0024507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11139

SfLAP

Sap, sulfolipid-1-addressing protein

11

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6f-assembly1.cif.gz_B cryo-em structure of a zinc-loaded d51a mutant of the yiip-fab complex 0.3675 17 189
8f6j-assembly1.cif.gz_A cryo-em structure of a zinc-loaded d287a mutant of the yiip-fab complex 0.3557 14 189
8f6h-assembly1.cif.gz_B cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.3552 15 190
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.34 51 188
8f6f-assembly1.cif.gz_B cryo-em structure of a zinc-loaded d51a mutant of the yiip-fab complex 0.3396 17 189
ID Description Score Start End Superfamily
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3986 24 190 1.20.1250.20
af_Q57891_4_200_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.3737 13 191 1.20.1510.10
af_K7K8J1_75_296_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.368 37 191 1.20.1510.10
af_Q10LJ2_76_298_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.3652 48 191 1.20.1510.10
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3628 24 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1I4GTX3-F1-model_v4 Sap, sulfolipid-1-addressing protein 0.8564 28 191 GO:0016020
AF-A0A0F6YII2-F1-model_v4 Uncharacterized protein 0.8508 19 190 GO:0016020
AF-A0A1V2KQW3-F1-model_v4 GAP family protein 0.8037 1 190 GO:0016020
AF-A0A516Q076-F1-model_v4 GAP family protein 0.7971 1 191 GO:0016020
AF-A0A1V2KQW3-F1-model_v4 GAP family protein 0.796 1 190 GO:0016020

Map