F389672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 158 | 290 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100219942|Ga0068860_1002199422 |
| Length | 464 |
| Sequence | MKHWKTGNTRCPPTVPTPFSVSRFIRVTPDLLKSPLHLLPEYRRLALPTEQAKSLPEKDSSALIGRIFKAFQFRDFRLMWTGACTSQIGTQMQTAAQSWLVYDLSKHSSVFLGLDNFLGTLPIVLFSLVGGVFADRHDRRKVLLGSQYVQTVCAFLLAALVFTGVVHVWHVLCLSVVVGMAQSFGGPAYSALIPSLVPKEHLQNAISLNSIQFNLARVIGPALGGIALIKLGAAWNFTFNGISFVGVIITLYLIQTTFIPAKSREPIMTSMKEGIRFMRQQPGMESLIALAFLMTTLGFPVIIFLVVFAEEVFKGGTQTFTWLLCSSGAGAVTGALIAAGGRQKRKGLAALIMLAALGLFTMAFAQSPSTPVACAMLFLAGASLMGVFSMITTLVQMIIPDNMRGRVMSVYNLALRGGGPVGSLLVGTIMIPRFGAPLTFTIAGALEILLAIYFLTVNRRVAVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 101 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 106 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 111 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 112 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 113 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 157 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 158 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 1.38 |
| Rhizosphere | 85.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10061435 | 3300003320 | Bacteria | 5244 |
| 2 | rootH2_10063979 | 3300003320 | Bacteria | 4290 |
| 3 | Ga0070658_10007748 | 3300005327 | Bacteria | 8654 |
| 4 | Ga0070683_100048323 | 3300005329 | Bacteria | 3933 |
| 5 | Ga0070683_100118750 | 3300005329 | Bacteria | 2497 |
| 6 | Ga0070680_100033863 | 3300005336 | Bacteria | 4119 |
| 7 | Ga0070680_100084662 | 3300005336 | Bacteria | 2619 |
| 8 | Ga0070660_100063875 | 3300005339 | Bacteria | 2863 |
| 9 | Ga0070661_100083718 | 3300005344 | Bacteria | 2356 |
| 10 | Ga0070671_100008609 | 3300005355 | Bacteria | 8179 |
| 11 | Ga0070659_100022432 | 3300005366 | Unclassified | 4820 |
| 12 | Ga0070667_100103614 | 3300005367 | Bacteria | 2460 |
| 13 | Ga0070713_100009588 | 3300005436 | Bacteria | 6944 |
| 14 | Ga0070713_100022949 | 3300005436 | Bacteria | 4831 |
| 15 | Ga0070711_100072866 | 3300005439 | Bacteria | 2424 |
| 16 | Ga0070711_100111500 | 3300005439 | Bacteria | 2009 |
| 17 | Ga0070700_100047890 | 3300005441 | Bacteria | 2647 |
| 18 | Ga0070708_100111596 | 3300005445 | Unclassified | 2514 |
| 19 | Ga0070678_100211547 | 3300005456 | Bacteria | 1607 |
| 20 | Ga0070662_100074301 | 3300005457 | Unclassified | 2514 |
| 21 | Ga0070681_10020212 | 3300005458 | Bacteria | 6675 |
| 22 | Ga0068867_100086703 | 3300005459 | Unclassified | 2369 |
| 23 | Ga0070679_100000302 | 3300005530 | Bacteria | 42063 |
| 24 | Ga0070679_100003228 | 3300005530 | Bacteria | 14891 |
| 25 | Ga0070679_100047842 | 3300005530 | Bacteria | 4262 |
| 26 | Ga0070684_100002999 | 3300005535 | Bacteria | 12566 |
| 27 | Ga0070684_100041083 | 3300005535 | Bacteria | 3986 |
| 28 | Ga0070684_100065799 | 3300005535 | Bacteria | 3182 |
| 29 | Ga0070684_100178671 | 3300005535 | Bacteria | 1929 |
| 30 | Ga0070684_100247011 | 3300005535 | Bacteria | 1631 |
| 31 | Ga0068853_100005025 | 3300005539 | Bacteria | 10314 |
| 32 | Ga0068853_100205786 | 3300005539 | Unclassified | 1792 |
| 33 | Ga0068853_100309013 | 3300005539 | Unclassified | 1463 |
| 34 | Ga0070665_100010863 | 3300005548 | Bacteria | 9211 |
| 35 | Ga0070665_100026142 | 3300005548 | Bacteria | 5878 |
| 36 | Ga0070665_100155072 | 3300005548 | Bacteria | 2292 |
| 37 | Ga0068855_100026860 | 3300005563 | Bacteria | 6888 |
| 38 | Ga0068855_100037056 | 3300005563 | Bacteria | 5802 |
| 39 | Ga0068855_100050220 | 3300005563 | Bacteria | 4917 |
| 40 | Ga0070664_100155685 | 3300005564 | Bacteria | 2019 |
| 41 | Ga0068857_100004932 | 3300005577 | Bacteria | 11327 |
| 42 | Ga0068857_100006252 | 3300005577 | Bacteria | 10183 |
| 43 | Ga0068854_100134239 | 3300005578 | Bacteria | 1893 |
| 44 | Ga0068856_100001623 | 3300005614 | Bacteria | 23549 |
| 45 | Ga0068856_100004199 | 3300005614 | Bacteria | 14388 |
| 46 | Ga0068859_100124780 | 3300005617 | Unclassified | 2643 |
| 47 | Ga0068864_100079695 | 3300005618 | Bacteria | 2868 |
| 48 | Ga0068863_100011828 | 3300005841 | Bacteria | 8435 |
| 49 | Ga0068863_100067611 | 3300005841 | Unclassified | 3380 |
| 50 | Ga0068860_100052450 | 3300005843 | Unclassified | 3880 |
| 51 | Ga0068860_100219942 | 3300005843 | Bacteria | 1844 |
| 52 | Ga0081455_10034970 | 3300005937 | Unclassified | 4496 |
| 53 | Ga0070717_10003653 | 3300006028 | Bacteria | 11042 |
| 54 | Ga0070717_10016499 | 3300006028 | Bacteria | 5726 |
| 55 | Ga0097621_100003726 | 3300006237 | Bacteria | 10555 |
| 56 | Ga0097621_100079078 | 3300006237 | Bacteria | 2733 |
| 57 | Ga0097621_100286870 | 3300006237 | Unclassified | 1450 |
| 58 | Ga0068871_100096325 | 3300006358 | Bacteria | 2472 |
| 59 | Ga0068865_100160334 | 3300006881 | Bacteria | 1715 |
| 60 | Ga0097620_100124788 | 3300006931 | Unclassified | 2643 |
| 61 | Ga0075435_100121572 | 3300007076 | Unclassified | 2179 |
| 62 | Ga0105240_10000713 | 3300009093 | Bacteria | 60923 |
| 63 | Ga0105240_10002246 | 3300009093 | Bacteria | 31374 |
| 64 | Ga0105240_10007222 | 3300009093 | Bacteria | 16180 |
| 65 | Ga0105240_10009999 | 3300009093 | Bacteria | 13368 |
| 66 | Ga0105240_10012690 | 3300009093 | Bacteria | 11611 |
| 67 | Ga0105240_10033151 | 3300009093 | Bacteria | 6675 |
| 68 | Ga0105240_10163412 | 3300009093 | Bacteria | 2642 |
| 69 | Ga0105240_10203544 | 3300009093 | Bacteria | 2318 |
| 70 | Ga0105245_10008232 | 3300009098 | Bacteria | 9113 |
| 71 | Ga0105245_10012377 | 3300009098 | Bacteria | 7424 |
| 72 | Ga0105247_10056152 | 3300009101 | Bacteria | 2431 |
| 73 | Ga0105243_10085067 | 3300009148 | Bacteria | 2592 |
| 74 | Ga0105241_10000080 | 3300009174 | Bacteria | 71562 |
| 75 | Ga0105241_10001247 | 3300009174 | Bacteria | 19418 |
| 76 | Ga0105242_10025379 | 3300009176 | Bacteria | 4690 |
| 77 | Ga0105242_10046886 | 3300009176 | Unclassified | 3508 |
| 78 | Ga0105242_10220978 | 3300009176 | Bacteria | 1693 |
| 79 | Ga0105248_10016708 | 3300009177 | Bacteria | 8079 |
| 80 | Ga0105248_10108081 | 3300009177 | Bacteria | 3137 |
| 81 | Ga0105248_10143668 | 3300009177 | Unclassified | 2692 |
| 82 | Ga0105237_10003585 | 3300009545 | Bacteria | 18365 |
| 83 | Ga0105237_10011684 | 3300009545 | Bacteria | 9289 |
| 84 | Ga0105237_10014420 | 3300009545 | Bacteria | 8266 |
| 85 | Ga0105237_10017143 | 3300009545 | Bacteria | 7513 |
| 86 | Ga0105237_10072325 | 3300009545 | Bacteria | 3442 |
| 87 | Ga0105237_10083219 | 3300009545 | Bacteria | 3191 |
| 88 | Ga0105237_10116910 | 3300009545 | Unclassified | 2660 |
| 89 | Ga0105238_10002827 | 3300009551 | Bacteria | 17320 |
| 90 | Ga0105238_10004139 | 3300009551 | Bacteria | 14390 |
| 91 | Ga0105238_10185351 | 3300009551 | Bacteria | 2057 |
| 92 | Ga0105238_10263102 | 3300009551 | Bacteria | 1705 |
| 93 | Ga0105239_10004434 | 3300010375 | Bacteria | 16782 |
| 94 | Ga0105239_10068336 | 3300010375 | Bacteria | 3904 |
| 95 | Ga0105246_10012163 | 3300011119 | Bacteria | 5363 |
| 96 | Ga0105246_10035569 | 3300011119 | Bacteria | 3329 |
| 97 | Ga0157370_10002114 | 3300013104 | Bacteria | 24266 |
| 98 | Ga0157370_10004725 | 3300013104 | Bacteria | 15528 |
| 99 | Ga0157370_10015598 | 3300013104 | Bacteria | 7720 |
| 100 | Ga0157370_10093805 | 3300013104 | Unclassified | 2817 |
| 101 | Ga0157369_10001335 | 3300013105 | Bacteria | 30481 |
| 102 | Ga0157369_10002000 | 3300013105 | Bacteria | 24536 |
| 103 | Ga0157369_10002554 | 3300013105 | Bacteria | 21788 |
| 104 | Ga0157369_10006249 | 3300013105 | Bacteria | 13823 |
| 105 | Ga0157369_10099401 | 3300013105 | Bacteria | 3102 |
| 106 | Ga0157369_10174483 | 3300013105 | Unclassified | 2263 |
| 107 | Ga0157374_10002041 | 3300013296 | Bacteria | 16965 |
| 108 | Ga0157374_10002960 | 3300013296 | Bacteria | 14224 |
| 109 | Ga0157374_10013303 | 3300013296 | Bacteria | 7180 |
| 110 | Ga0157374_10216172 | 3300013296 | Bacteria | 1880 |
| 111 | Ga0157378_10228182 | 3300013297 | Unclassified | 1773 |
| 112 | Ga0163162_10002178 | 3300013306 | Bacteria | 18377 |
| 113 | Ga0157372_10011642 | 3300013307 | Bacteria | 9364 |
| 114 | Ga0157372_10036761 | 3300013307 | Bacteria | 5400 |
| 115 | Ga0157372_10052912 | 3300013307 | Bacteria | 4523 |
| 116 | Ga0157375_10006730 | 3300013308 | Bacteria | 10011 |
| 117 | Ga0163163_10014192 | 3300014325 | Bacteria | 7317 |
| 118 | Ga0163163_10015113 | 3300014325 | Bacteria | 7124 |
| 119 | Ga0163163_10018449 | 3300014325 | Bacteria | 6531 |
| 120 | Ga0163163_10083430 | 3300014325 | Bacteria | 3201 |
| 121 | Ga0157379_10011574 | 3300014968 | Bacteria | 7702 |
| 122 | Ga0157379_10037370 | 3300014968 | Bacteria | 4329 |
| 123 | Ga0157376_10049626 | 3300014969 | Unclassified | 3477 |
| 124 | Ga0213872_10000466 | 3300021361 | Bacteria | 32902 |
| 125 | Ga0213874_10029809 | 3300021377 | Archaea | 1568 |
| 126 | Ga0213876_10035843 | 3300021384 | Bacteria | 2616 |
| 127 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 128 | Ga0213875_10005358 | 3300021388 | Bacteria | 6896 |
| 129 | Ga0213875_10006277 | 3300021388 | Bacteria | 6256 |
| 130 | Ga0213875_10012402 | 3300021388 | Bacteria | 4214 |
| 131 | Ga0213875_10012909 | 3300021388 | Bacteria | 4114 |
| 132 | Ga0213875_10091622 | 3300021388 | Unclassified | 1418 |
| 133 | Ga0207705_10040361 | 3300025909 | Unclassified | 3347 |
| 134 | Ga0207654_10000598 | 3300025911 | Bacteria | 20314 |
| 135 | Ga0207654_10014130 | 3300025911 | Bacteria | 4119 |
| 136 | Ga0207654_10139030 | 3300025911 | Bacteria | 1547 |
| 137 | Ga0207707_10000469 | 3300025912 | Bacteria | 41694 |
| 138 | Ga0207707_10049556 | 3300025912 | Unclassified | 3659 |
| 139 | Ga0207695_10001695 | 3300025913 | Bacteria | 35368 |
| 140 | Ga0207695_10002673 | 3300025913 | Bacteria | 26047 |
| 141 | Ga0207695_10068479 | 3300025913 | Bacteria | 3637 |
| 142 | Ga0207695_10094952 | 3300025913 | Bacteria | 2988 |
| 143 | Ga0207671_10016568 | 3300025914 | Bacteria | 5723 |
| 144 | Ga0207671_10031622 | 3300025914 | Bacteria | 3943 |
| 145 | Ga0207671_10136963 | 3300025914 | Unclassified | 1883 |
| 146 | Ga0207693_10145035 | 3300025915 | Bacteria | 1867 |
| 147 | Ga0207663_10020484 | 3300025916 | Unclassified | 3745 |
| 148 | Ga0207660_10013048 | 3300025917 | Bacteria | 5440 |
| 149 | Ga0207657_10246327 | 3300025919 | Bacteria | 1426 |
| 150 | Ga0207652_10002671 | 3300025921 | Bacteria | 14956 |
| 151 | Ga0207652_10003282 | 3300025921 | Bacteria | 13394 |
| 152 | Ga0207694_10001694 | 3300025924 | Bacteria | 18474 |
| 153 | Ga0207694_10008437 | 3300025924 | Bacteria | 7777 |
| 154 | Ga0207694_10030724 | 3300025924 | Bacteria | 4101 |
| 155 | Ga0207687_10000521 | 3300025927 | Bacteria | 25789 |
| 156 | Ga0207687_10007963 | 3300025927 | Bacteria | 6937 |
| 157 | Ga0207700_10090926 | 3300025928 | Unclassified | 2410 |
| 158 | Ga0207690_10023885 | 3300025932 | Unclassified | 3822 |
| 159 | Ga0207686_10035061 | 3300025934 | Bacteria | 3009 |
| 160 | Ga0207686_10070944 | 3300025934 | Bacteria | 2240 |
| 161 | Ga0207686_10086903 | 3300025934 | Bacteria | 2055 |
| 162 | Ga0207704_10123903 | 3300025938 | Bacteria | 1775 |
| 163 | Ga0207711_10002155 | 3300025941 | Bacteria | 17723 |
| 164 | Ga0207711_10049619 | 3300025941 | Bacteria | 3593 |
| 165 | Ga0207711_10049674 | 3300025941 | Bacteria | 3591 |
| 166 | Ga0207689_10007461 | 3300025942 | Bacteria | 9586 |
| 167 | Ga0207661_10002821 | 3300025944 | Bacteria | 11996 |
| 168 | Ga0207661_10019243 | 3300025944 | Bacteria | 5086 |
| 169 | Ga0207679_10164228 | 3300025945 | Bacteria | 1821 |
| 170 | Ga0207667_10000682 | 3300025949 | Bacteria | 44026 |
| 171 | Ga0207667_10007008 | 3300025949 | Bacteria | 13615 |
| 172 | Ga0207667_10015267 | 3300025949 | Bacteria | 8733 |
| 173 | Ga0207667_10060536 | 3300025949 | Bacteria | 3963 |
| 174 | Ga0207667_10082758 | 3300025949 | Bacteria | 3324 |
| 175 | Ga0207703_10049405 | 3300026035 | Unclassified | 3400 |
| 176 | Ga0207639_10040654 | 3300026041 | Bacteria | 3472 |
| 177 | Ga0207708_10063153 | 3300026075 | Bacteria | 2829 |
| 178 | Ga0207702_10006636 | 3300026078 | Bacteria | 9952 |
| 179 | Ga0207702_10087329 | 3300026078 | Bacteria | 2722 |
| 180 | Ga0207641_10048008 | 3300026088 | Unclassified | 3603 |
| 181 | Ga0207648_10057856 | 3300026089 | Unclassified | 3382 |
| 182 | Ga0207676_10048217 | 3300026095 | Bacteria | 3306 |
| 183 | Ga0207674_10001168 | 3300026116 | Bacteria | 34093 |
| 184 | Ga0207674_10009238 | 3300026116 | Bacteria | 11300 |
| 185 | Ga0207683_10224170 | 3300026121 | Bacteria | 1713 |
| 186 | Ga0268266_10010586 | 3300028379 | Bacteria | 8044 |
| 187 | Ga0268266_10058703 | 3300028379 | Bacteria | 3313 |
| 188 | Ga0268266_10086753 | 3300028379 | Bacteria | 2737 |
| 189 | Ga0268266_10111777 | 3300028379 | Bacteria | 2421 |
| 190 | Ga0268264_10043915 | 3300028381 | Unclassified | 3705 |
| 191 | Ga0268264_10145326 | 3300028381 | Bacteria | 2120 |
| 192 | Ga0265762_1001295 | 3300030760 | Bacteria | 4553 |
| 193 | Ga0265760_10014389 | 3300031090 | Unclassified | 2266 |
| 194 | Ga0265328_10058306 | 3300031239 | Bacteria | 1418 |
| 195 | Ga0265316_10004637 | 3300031344 | Bacteria | 13623 |
| 196 | Ga0265316_10025644 | 3300031344 | Bacteria | 4916 |
| 197 | Ga0265316_10096156 | 3300031344 | Unclassified | 2255 |
| 198 | Ga0265313_10001183 | 3300031595 | Bacteria | 24958 |
| 199 | Ga0307510_10019637 | 3300033180 | Bacteria | 7920 |
| 200 | Ga0373934_0047000 | 3300035086 | Bacteria | 1707 |
| 201 | Ga0373923_0026848 | 3300035111 | Unclassified | 2293 |
| 202 | Ga0373954_0006530 | 3300035118 | Bacteria | 5083 |
| 203 | Ga0373954_0042146 | 3300035118 | Unclassified | 2128 |
| 204 | Ga0373935_0130796 | 3300035692 | Bacteria | 1686 |
| 205 | Ga0373927_0036357 | 3300035695 | Bacteria | 3203 |
| 206 | Ga0373933_0026978 | 3300035724 | Unclassified | 3304 |
| 207 | Ga0373937_0013760 | 3300036401 | Bacteria | 7129 |
| 208 | Ga0373937_0069845 | 3300036401 | Bacteria | 3239 |
| 209 | Ga0373937_0168037 | 3300036401 | Unclassified | 2057 |
| 210 | Ga0436364_0053541 | 3300037853 | Bacteria | 2370 |
| 211 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 212 | Ga0436364_0231805 | 3300037853 | Bacteria | 6135 |
| 213 | Ga0436364_0309246 | 3300037853 | Bacteria | 2355 |
| 214 | Ga0436364_0323341 | 3300037853 | Bacteria | 5861 |
| 215 | Ga0436364_0446012 | 3300037853 | Bacteria | 193523 |
| 216 | Ga0436364_0570827 | 3300037853 | Bacteria | 13350 |
| 217 | Ga0436364_0630110 | 3300037853 | Bacteria | 5135 |
| 218 | Ga0436364_0642579 | 3300037853 | Unclassified | 2125 |
| 219 | Ga0436364_0840931 | 3300037853 | Bacteria | 11199 |
| 220 | Ga0436364_0855073 | 3300037853 | Bacteria | 15706 |
| 221 | Ga0436364_0988131 | 3300037853 | Unclassified | 2101 |
| 222 | Ga0436364_1209777 | 3300037853 | Unclassified | 1877 |
| 223 | Ga0436364_1520570 | 3300037853 | Unclassified | 2274 |
| 224 | Ga0436364_1556172 | 3300037853 | Bacteria | 18276 |
| 225 | Ga0436365_0107208 | 3300039437 | Bacteria | 28932 |
| 226 | Ga0436365_0170096 | 3300039437 | Bacteria | 4416 |
| 227 | Ga0436365_0199967 | 3300039437 | Bacteria | 1916 |
| 228 | Ga0436365_0611496 | 3300039437 | Bacteria | 1368 |
| 229 | Ga0436365_1271418 | 3300039437 | Unclassified | 3182 |
| 230 | Ga0436360_0281016 | 3300039438 | Bacteria | 20162 |
| 231 | Ga0436361_1097729 | 3300039447 | Bacteria | 95612 |
| 232 | Ga0436363_1028599 | 3300039450 | Unclassified | 1947 |
| 233 | Ga0436363_1354498 | 3300039450 | Bacteria | 3311 |
| 234 | Ga0436362_0054350 | 3300039453 | Bacteria | 2735 |
| 235 | Ga0436362_0109449 | 3300039453 | Unclassified | 3488 |
| 236 | Ga0436362_0561686 | 3300039453 | Unclassified | 4279 |
| 237 | Ga0436362_0805691 | 3300039453 | Bacteria | 5720 |
| 238 | Ga0466957_0175965 | 3300044842 | Bacteria | 1395 |
| 239 | Ga0451576_0025479 | 3300045051 | Bacteria | 6371 |
| 240 | Ga0495603_0009323 | 3300046455 | Bacteria | 5935 |
| 241 | Ga0495629_0183961 | 3300046459 | Bacteria | 1448 |
| 242 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 243 | Ga0495580_0027425 | 3300046472 | Bacteria | 4144 |
| 244 | Ga0495580_0041298 | 3300046472 | Unclassified | 3290 |
| 245 | Ga0495580_0053627 | 3300046472 | Unclassified | 2845 |
| 246 | Ga0495582_0003912 | 3300046473 | Bacteria | 8360 |
| 247 | Ga0495639_0001372 | 3300046475 | Bacteria | 10935 |
| 248 | Ga0495585_0110587 | 3300046492 | Bacteria | 1461 |
| 249 | Ga0495628_0080029 | 3300046516 | Bacteria | 2540 |
| 250 | Ga0495630_0078680 | 3300046517 | Bacteria | 2487 |
| 251 | Ga0495644_0000015 | 3300046523 | Bacteria | 89336 |
| 252 | Ga0495642_0046036 | 3300046528 | Bacteria | 1784 |
| 253 | Ga0495652_0003210 | 3300046529 | Bacteria | 16307 |
| 254 | Ga0495652_0043218 | 3300046529 | Bacteria | 3883 |
| 255 | Ga0495586_0073058 | 3300046535 | Unclassified | 1876 |
| 256 | Ga0495587_0002050 | 3300046536 | Bacteria | 13455 |
| 257 | Ga0495609_0028253 | 3300046538 | Bacteria | 2560 |
| 258 | Ga0495645_0120290 | 3300046543 | Bacteria | 1849 |
| 259 | Ga0495622_0084255 | 3300046557 | Bacteria | 1462 |
| 260 | Ga0495633_0014425 | 3300046558 | Bacteria | 4134 |
| 261 | Ga0495667_0049504 | 3300046559 | Bacteria | 2774 |
| 262 | Ga0495611_0064045 | 3300046648 | Bacteria | 1674 |
| 263 | Ga0495625_0000102 | 3300046660 | Bacteria | 138850 |
| 264 | Ga0495625_0090631 | 3300046660 | Bacteria | 2114 |
| 265 | Ga0495599_0020616 | 3300046678 | Bacteria | 4106 |
| 266 | Ga0495669_0000714 | 3300046684 | Bacteria | 14441 |
| 267 | Ga0495613_0011937 | 3300046689 | Bacteria | 6457 |
| 268 | Ga0495613_0035414 | 3300046689 | Bacteria | 3704 |
| 269 | Ga0495624_0017145 | 3300046690 | Bacteria | 4869 |
| 270 | Ga0495600_0014488 | 3300046809 | Bacteria | 4968 |
| 271 | Ga0495581_0002297 | 3300047315 | Bacteria | 10766 |
| 272 | Ga0495604_0016033 | 3300047317 | Bacteria | 5984 |
| 273 | Ga0495676_0021391 | 3300047321 | Bacteria | 5651 |
| 274 | Ga0495675_0103737 | 3300047444 | Bacteria | 1778 |
| 275 | Ga0495673_0040348 | 3300047469 | Bacteria | 2110 |
| 276 | Ga0495684_0010768 | 3300047471 | Bacteria | 7068 |
| 277 | Ga0495684_0026157 | 3300047471 | Bacteria | 4484 |
| 278 | Ga0495686_0036967 | 3300047472 | Bacteria | 3131 |
| 279 | Ga0495602_0015857 | 3300048088 | Bacteria | 7590 |
| 280 | Ga0496112_0011846 | 3300048915 | Bacteria | 7986 |
| 281 | Ga0496112_0042492 | 3300048915 | Bacteria | 4447 |
| 282 | Ga0496114_0053521 | 3300048917 | Bacteria | 3365 |
| 283 | Ga0496115_0194711 | 3300048918 | Bacteria | 1675 |
| 284 | Ga0496126_0000758 | 3300048929 | Bacteria | 58461 |
| 285 | Ga0496126_0019270 | 3300048929 | Bacteria | 6723 |
| 286 | Ga0495682_0024080 | 3300049460 | Bacteria | 2272 |
| 287 | nmdc:mga0rr50_56636_c1 | 3300050513 | Unclassified | 2193 |
| 288 | Ga0500595_000032 | 3300053119 | Bacteria | 111447 |
| 289 | Ga0500661_000704 | 3300055283 | Bacteria | 6236 |
| 290 | Ga0501082_0000249 | 3300060353 | Bacteria | 47254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_1520570 | Ga0436364_1520570_1273_2259 | 328 |
| 2 | 3300006028 | Ga0070717_10016499 | Ga0070717_100164998 | 355 |
| 3 | 3300039437 | Ga0436365_0170096 | Ga0436365_0170096_2964_4082 | 359 |
| 4 | 3300037853 | Ga0436364_0630110 | Ga0436364_0630110_12_1103 | 363 |
| 5 | 3300037853 | Ga0436364_1209777 | Ga0436364_1209777_694_1851 | 363 |
| 6 | 3300006237 | Ga0097621_100286870 | Ga0097621_1002868702 | 370 |
| 7 | 3300021377 | Ga0213874_10029809 | Ga0213874_100298092 | 370 |
| 8 | 3300031239 | Ga0265328_10058306 | Ga0265328_100583062 | 370 |
| 9 | 3300037853 | Ga0436364_0570827 | Ga0436364_0570827_10438_11553 | 371 |
| 10 | 3300005436 | Ga0070713_100022949 | Ga0070713_1000229493 | 372 |
| 11 | 3300006028 | Ga0070717_10003653 | Ga0070717_100036538 | 372 |
| 12 | 3300013104 | Ga0157370_10093805 | Ga0157370_100938053 | 372 |
| 13 | 3300014325 | Ga0163163_10018449 | Ga0163163_100184496 | 372 |
| 14 | 3300014968 | Ga0157379_10011574 | Ga0157379_100115746 | 372 |
| 15 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005289 | 372 |
| 16 | 3300021388 | Ga0213875_10012402 | Ga0213875_100124022 | 372 |
| 17 | 3300021388 | Ga0213875_10091622 | Ga0213875_100916221 | 372 |
| 18 | 3300025916 | Ga0207663_10020484 | Ga0207663_100204843 | 372 |
| 19 | 3300025949 | Ga0207667_10015267 | Ga0207667_100152676 | 372 |
| 20 | 3300036401 | Ga0373937_0069845 | Ga0373937_0069845_2054_3178 | 372 |
| 21 | 3300039450 | Ga0436363_1028599 | Ga0436363_1028599_31_1149 | 372 |
| 22 | 3300039453 | Ga0436362_0054350 | Ga0436362_0054350_1493_2611 | 372 |
| 23 | 3300046472 | Ga0495580_0041298 | Ga0495580_0041298_744_1862 | 372 |
| 24 | 3300046472 | Ga0495580_0053627 | Ga0495580_0053627_144_1268 | 372 |
| 25 | 3300046473 | Ga0495582_0003912 | Ga0495582_0003912_3592_4716 | 372 |
| 26 | 3300046535 | Ga0495586_0073058 | Ga0495586_0073058_172_1296 | 372 |
| 27 | 3300039437 | Ga0436365_0199967 | Ga0436365_0199967_537_1694 | 373 |
| 28 | 3300005548 | Ga0070665_100010863 | Ga0070665_1000108637 | 374 |
| 29 | 3300028379 | Ga0268266_10058703 | Ga0268266_100587034 | 374 |
| 30 | 3300005329 | Ga0070683_100048323 | Ga0070683_1000483233 | 377 |
| 31 | 3300005336 | Ga0070680_100084662 | Ga0070680_1000846622 | 377 |
| 32 | 3300005530 | Ga0070679_100047842 | Ga0070679_1000478424 | 377 |
| 33 | 3300005535 | Ga0070684_100247011 | Ga0070684_1002470112 | 377 |
| 34 | 3300046459 | Ga0495629_0183961 | Ga0495629_0183961_225_1379 | 377 |
| 35 | 3300005366 | Ga0070659_100022432 | Ga0070659_1000224323 | 379 |
| 36 | 3300005614 | Ga0068856_100001623 | Ga0068856_1000016235 | 379 |
| 37 | 3300013105 | Ga0157369_10174483 | Ga0157369_101744832 | 379 |
| 38 | 3300013296 | Ga0157374_10002960 | Ga0157374_100029605 | 379 |
| 39 | 3300025932 | Ga0207690_10023885 | Ga0207690_100238853 | 379 |
| 40 | 3300048915 | Ga0496112_0011846 | Ga0496112_0011846_4173_5330 | 379 |
| 41 | 3300009545 | Ga0105237_10011684 | Ga0105237_100116843 | 380 |
| 42 | 3300025914 | Ga0207671_10136963 | Ga0207671_101369632 | 380 |
| 43 | 3300025911 | Ga0207654_10000598 | Ga0207654_100005983 | 381 |
| 44 | 3300005329 | Ga0070683_100118750 | Ga0070683_1001187503 | 385 |
| 45 | 3300005339 | Ga0070660_100063875 | Ga0070660_1000638752 | 385 |
| 46 | 3300005457 | Ga0070662_100074301 | Ga0070662_1000743012 | 385 |
| 47 | 3300005459 | Ga0068867_100086703 | Ga0068867_1000867032 | 385 |
| 48 | 3300005539 | Ga0068853_100005025 | Ga0068853_1000050258 | 385 |
| 49 | 3300005539 | Ga0068853_100205786 | Ga0068853_1002057862 | 385 |
| 50 | 3300005563 | Ga0068855_100026860 | Ga0068855_1000268603 | 385 |
| 51 | 3300005564 | Ga0070664_100155685 | Ga0070664_1001556852 | 385 |
| 52 | 3300005577 | Ga0068857_100004932 | Ga0068857_1000049324 | 385 |
| 53 | 3300005841 | Ga0068863_100067611 | Ga0068863_1000676113 | 385 |
| 54 | 3300005843 | Ga0068860_100052450 | Ga0068860_1000524503 | 385 |
| 55 | 3300005937 | Ga0081455_10034970 | Ga0081455_100349705 | 385 |
| 56 | 3300006358 | Ga0068871_100096325 | Ga0068871_1000963251 | 385 |
| 57 | 3300007076 | Ga0075435_100121572 | Ga0075435_1001215722 | 385 |
| 58 | 3300009093 | Ga0105240_10009999 | Ga0105240_100099998 | 385 |
| 59 | 3300009101 | Ga0105247_10056152 | Ga0105247_100561523 | 385 |
| 60 | 3300009176 | Ga0105242_10025379 | Ga0105242_100253793 | 385 |
| 61 | 3300009176 | Ga0105242_10220978 | Ga0105242_102209782 | 385 |
| 62 | 3300009545 | Ga0105237_10083219 | Ga0105237_100832192 | 385 |
| 63 | 3300009551 | Ga0105238_10185351 | Ga0105238_101853512 | 385 |
| 64 | 3300009551 | Ga0105238_10263102 | Ga0105238_102631021 | 385 |
| 65 | 3300011119 | Ga0105246_10035569 | Ga0105246_100355693 | 385 |
| 66 | 3300013105 | Ga0157369_10006249 | Ga0157369_1000624913 | 385 |
| 67 | 3300013307 | Ga0157372_10052912 | Ga0157372_100529122 | 385 |
| 68 | 3300014325 | Ga0163163_10014192 | Ga0163163_100141923 | 385 |
| 69 | 3300021361 | Ga0213872_10000466 | Ga0213872_1000046621 | 385 |
| 70 | 3300021388 | Ga0213875_10006277 | Ga0213875_100062774 | 385 |
| 71 | 3300021388 | Ga0213875_10012909 | Ga0213875_100129092 | 385 |
| 72 | 3300025911 | Ga0207654_10139030 | Ga0207654_101390301 | 385 |
| 73 | 3300025913 | Ga0207695_10068479 | Ga0207695_100684792 | 385 |
| 74 | 3300025913 | Ga0207695_10094952 | Ga0207695_100949523 | 385 |
| 75 | 3300025914 | Ga0207671_10031622 | Ga0207671_100316223 | 385 |
| 76 | 3300025915 | Ga0207693_10145035 | Ga0207693_101450352 | 385 |
| 77 | 3300025924 | Ga0207694_10030724 | Ga0207694_100307242 | 385 |
| 78 | 3300025927 | Ga0207687_10007963 | Ga0207687_100079633 | 385 |
| 79 | 3300025934 | Ga0207686_10035061 | Ga0207686_100350612 | 385 |
| 80 | 3300025934 | Ga0207686_10070944 | Ga0207686_100709442 | 385 |
| 81 | 3300025941 | Ga0207711_10049674 | Ga0207711_100496743 | 385 |
| 82 | 3300025942 | Ga0207689_10007461 | Ga0207689_100074619 | 385 |
| 83 | 3300025944 | Ga0207661_10019243 | Ga0207661_100192433 | 385 |
| 84 | 3300025945 | Ga0207679_10164228 | Ga0207679_101642282 | 385 |
| 85 | 3300025949 | Ga0207667_10082758 | Ga0207667_100827582 | 385 |
| 86 | 3300026041 | Ga0207639_10040654 | Ga0207639_100406543 | 385 |
| 87 | 3300026078 | Ga0207702_10087329 | Ga0207702_100873291 | 385 |
| 88 | 3300026088 | Ga0207641_10048008 | Ga0207641_100480083 | 385 |
| 89 | 3300026089 | Ga0207648_10057856 | Ga0207648_100578564 | 385 |
| 90 | 3300026116 | Ga0207674_10009238 | Ga0207674_100092384 | 385 |
| 91 | 3300028381 | Ga0268264_10043915 | Ga0268264_100439153 | 385 |
| 92 | 3300031344 | Ga0265316_10004637 | Ga0265316_1000463711 | 385 |
| 93 | 3300031344 | Ga0265316_10096156 | Ga0265316_100961562 | 385 |
| 94 | 3300031595 | Ga0265313_10001183 | Ga0265313_1000118312 | 385 |
| 95 | 3300035086 | Ga0373934_0047000 | Ga0373934_0047000_19_1182 | 385 |
| 96 | 3300035111 | Ga0373923_0026848 | Ga0373923_0026848_790_1953 | 385 |
| 97 | 3300035118 | Ga0373954_0042146 | Ga0373954_0042146_73_1236 | 385 |
| 98 | 3300037853 | Ga0436364_0053541 | Ga0436364_0053541_1112_2269 | 385 |
| 99 | 3300037853 | Ga0436364_0323341 | Ga0436364_0323341_2811_3968 | 385 |
| 100 | 3300037853 | Ga0436364_0855073 | Ga0436364_0855073_7343_8500 | 385 |
| 101 | 3300039437 | Ga0436365_0611496 | Ga0436365_0611496_152_1309 | 385 |
| 102 | 3300039450 | Ga0436363_1354498 | Ga0436363_1354498_114_1271 | 385 |
| 103 | 3300039453 | Ga0436362_0805691 | Ga0436362_0805691_753_1910 | 385 |
| 104 | 3300047444 | Ga0495675_0103737 | Ga0495675_0103737_191_1348 | 385 |
| 105 | 3300047471 | Ga0495684_0010768 | Ga0495684_0010768_3855_5018 | 385 |
| 106 | 3300048918 | Ga0496115_0194711 | Ga0496115_0194711_485_1642 | 385 |
| 107 | 3300050513 | nmdc:mga0rr50_56636_c1 | nmdc:mga0rr50_56636_c1_913_2070 | 385 |
| 108 | 3300037853 | Ga0436364_0840931 | Ga0436364_0840931_1572_2777 | 387 |
| 109 | 3300014968 | Ga0157379_10037370 | Ga0157379_100373704 | 391 |
| 110 | 3300009545 | Ga0105237_10072325 | Ga0105237_100723252 | 392 |
| 111 | 3300013306 | Ga0163162_10002178 | Ga0163162_100021784 | 392 |
| 112 | 3300003320 | rootH2_10063979 | rootH2_100639793 | 393 |
| 113 | 3300013104 | Ga0157370_10015598 | Ga0157370_100155985 | 393 |
| 114 | 3300031090 | Ga0265760_10014389 | Ga0265760_100143891 | 393 |
| 115 | 3300037853 | Ga0436364_0988131 | Ga0436364_0988131_779_1969 | 394 |
| 116 | 3300005563 | Ga0068855_100037056 | Ga0068855_1000370562 | 397 |
| 117 | 3300005614 | Ga0068856_100004199 | Ga0068856_1000041999 | 397 |
| 118 | 3300013296 | Ga0157374_10216172 | Ga0157374_102161722 | 397 |
| 119 | 3300025912 | Ga0207707_10000469 | Ga0207707_1000046916 | 397 |
| 120 | 3300025913 | Ga0207695_10002673 | Ga0207695_1000267311 | 397 |
| 121 | 3300025914 | Ga0207671_10016568 | Ga0207671_100165683 | 397 |
| 122 | 3300025917 | Ga0207660_10013048 | Ga0207660_100130484 | 397 |
| 123 | 3300025921 | Ga0207652_10003282 | Ga0207652_1000328210 | 397 |
| 124 | 3300025924 | Ga0207694_10001694 | Ga0207694_100016943 | 397 |
| 125 | 3300025949 | Ga0207667_10000682 | Ga0207667_1000068214 | 397 |
| 126 | 3300028379 | Ga0268266_10086753 | Ga0268266_100867533 | 397 |
| 127 | 3300021388 | Ga0213875_10005358 | Ga0213875_100053585 | 400 |
| 128 | 3300037853 | Ga0436364_0642579 | Ga0436364_0642579_438_1640 | 400 |
| 129 | 3300005327 | Ga0070658_10007748 | Ga0070658_100077485 | 401 |
| 130 | 3300005445 | Ga0070708_100111596 | Ga0070708_1001115962 | 401 |
| 131 | 3300005456 | Ga0070678_100211547 | Ga0070678_1002115472 | 401 |
| 132 | 3300005535 | Ga0070684_100178671 | Ga0070684_1001786712 | 401 |
| 133 | 3300005539 | Ga0068853_100309013 | Ga0068853_1003090131 | 401 |
| 134 | 3300005548 | Ga0070665_100155072 | Ga0070665_1001550722 | 401 |
| 135 | 3300005563 | Ga0068855_100050220 | Ga0068855_1000502202 | 401 |
| 136 | 3300009093 | Ga0105240_10000713 | Ga0105240_100007138 | 401 |
| 137 | 3300009093 | Ga0105240_10002246 | Ga0105240_1000224626 | 401 |
| 138 | 3300009093 | Ga0105240_10012690 | Ga0105240_100126906 | 401 |
| 139 | 3300009093 | Ga0105240_10163412 | Ga0105240_101634122 | 401 |
| 140 | 3300009545 | Ga0105237_10017143 | Ga0105237_100171431 | 401 |
| 141 | 3300025909 | Ga0207705_10040361 | Ga0207705_100403612 | 401 |
| 142 | 3300025912 | Ga0207707_10049556 | Ga0207707_100495563 | 401 |
| 143 | 3300025919 | Ga0207657_10246327 | Ga0207657_102463272 | 401 |
| 144 | 3300025949 | Ga0207667_10060536 | Ga0207667_100605362 | 401 |
| 145 | 3300028379 | Ga0268266_10111777 | Ga0268266_101117772 | 401 |
| 146 | 3300031344 | Ga0265316_10025644 | Ga0265316_100256443 | 401 |
| 147 | 3300035695 | Ga0373927_0036357 | Ga0373927_0036357_388_1626 | 401 |
| 148 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_256616_257821 | 401 |
| 149 | 3300037853 | Ga0436364_0446012 | Ga0436364_0446012_51207_52412 | 401 |
| 150 | 3300039437 | Ga0436365_1271418 | Ga0436365_1271418_964_2169 | 401 |
| 151 | 3300039453 | Ga0436362_0109449 | Ga0436362_0109449_1941_3146 | 401 |
| 152 | 3300039453 | Ga0436362_0561686 | Ga0436362_0561686_1747_2952 | 401 |
| 153 | 3300044842 | Ga0466957_0175965 | Ga0466957_0175965_66_1271 | 401 |
| 154 | 3300045051 | Ga0451576_0025479 | Ga0451576_0025479_4600_5805 | 401 |
| 155 | 3300060353 | Ga0501082_0000249 | Ga0501082_0000249_34997_36202 | 401 |
| 156 | 3300009174 | Ga0105241_10000080 | Ga0105241_100000808 | 403 |
| 157 | 3300013105 | Ga0157369_10002000 | Ga0157369_100020002 | 403 |
| 158 | 3300048929 | Ga0496126_0019270 | Ga0496126_0019270_5202_6452 | 404 |
| 159 | 3300030760 | Ga0265762_1001295 | Ga0265762_10012952 | 405 |
| 160 | 3300021384 | Ga0213876_10035843 | Ga0213876_100358433 | 406 |
| 161 | 3300037853 | Ga0436364_0231805 | Ga0436364_0231805_1931_3151 | 406 |
| 162 | 3300039437 | Ga0436365_0107208 | Ga0436365_0107208_27447_28667 | 406 |
| 163 | 3300025928 | Ga0207700_10090926 | Ga0207700_100909263 | 407 |
| 164 | 3300035692 | Ga0373935_0130796 | Ga0373935_0130796_315_1565 | 407 |
| 165 | 3300037853 | Ga0436364_1556172 | Ga0436364_1556172_10156_11403 | 407 |
| 166 | 3300039438 | Ga0436360_0281016 | Ga0436360_0281016_9504_10757 | 407 |
| 167 | 3300039447 | Ga0436361_1097729 | Ga0436361_1097729_76959_78212 | 407 |
| 168 | 3300053119 | Ga0500595_000032 | Ga0500595_000032_102003_103253 | 408 |
| 169 | 3300005535 | Ga0070684_100041083 | Ga0070684_1000410832 | 409 |
| 170 | 3300009098 | Ga0105245_10008232 | Ga0105245_100082326 | 409 |
| 171 | 3300009098 | Ga0105245_10012377 | Ga0105245_100123773 | 409 |
| 172 | 3300009177 | Ga0105248_10143668 | Ga0105248_101436683 | 409 |
| 173 | 3300009545 | Ga0105237_10003585 | Ga0105237_100035854 | 409 |
| 174 | 3300009545 | Ga0105237_10116910 | Ga0105237_101169103 | 409 |
| 175 | 3300009551 | Ga0105238_10004139 | Ga0105238_100041394 | 409 |
| 176 | 3300010375 | Ga0105239_10068336 | Ga0105239_100683362 | 409 |
| 177 | 3300011119 | Ga0105246_10012163 | Ga0105246_100121632 | 409 |
| 178 | 3300013105 | Ga0157369_10099401 | Ga0157369_100994012 | 409 |
| 179 | 3300013296 | Ga0157374_10013303 | Ga0157374_100133034 | 409 |
| 180 | 3300013297 | Ga0157378_10228182 | Ga0157378_102281822 | 409 |
| 181 | 3300013308 | Ga0157375_10006730 | Ga0157375_100067308 | 409 |
| 182 | 3300014969 | Ga0157376_10049626 | Ga0157376_100496263 | 409 |
| 183 | 3300025924 | Ga0207694_10008437 | Ga0207694_100084372 | 409 |
| 184 | 3300025927 | Ga0207687_10000521 | Ga0207687_1000052116 | 409 |
| 185 | 3300025941 | Ga0207711_10002155 | Ga0207711_100021556 | 409 |
| 186 | 3300026035 | Ga0207703_10049405 | Ga0207703_100494055 | 409 |
| 187 | 3300046660 | Ga0495625_0000102 | Ga0495625_0000102_60669_61937 | 409 |
| 188 | 3300047472 | Ga0495686_0036967 | Ga0495686_0036967_1776_3008 | 410 |
| 189 | 3300013296 | Ga0157374_10002041 | Ga0157374_100020418 | 411 |
| 190 | 3300048929 | Ga0496126_0000758 | Ga0496126_0000758_47704_48948 | 411 |
| 191 | 3300005441 | Ga0070700_100047890 | Ga0070700_1000478902 | 412 |
| 192 | 3300005617 | Ga0068859_100124780 | Ga0068859_1001247802 | 412 |
| 193 | 3300005843 | Ga0068860_100219942 | Ga0068860_1002199422 | 412 |
| 194 | 3300006237 | Ga0097621_100003726 | Ga0097621_1000037267 | 412 |
| 195 | 3300006881 | Ga0068865_100160334 | Ga0068865_1001603342 | 412 |
| 196 | 3300006931 | Ga0097620_100124788 | Ga0097620_1001247882 | 412 |
| 197 | 3300009148 | Ga0105243_10085067 | Ga0105243_100850671 | 412 |
| 198 | 3300009176 | Ga0105242_10046886 | Ga0105242_100468864 | 412 |
| 199 | 3300025934 | Ga0207686_10086903 | Ga0207686_100869032 | 412 |
| 200 | 3300025938 | Ga0207704_10123903 | Ga0207704_101239032 | 412 |
| 201 | 3300026075 | Ga0207708_10063153 | Ga0207708_100631533 | 412 |
| 202 | 3300028381 | Ga0268264_10145326 | Ga0268264_101453262 | 412 |
| 203 | 3300037853 | Ga0436364_0309246 | Ga0436364_0309246_826_2106 | 412 |
| 204 | 3300005336 | Ga0070680_100033863 | Ga0070680_1000338633 | 413 |
| 205 | 3300005344 | Ga0070661_100083718 | Ga0070661_1000837181 | 413 |
| 206 | 3300005355 | Ga0070671_100008609 | Ga0070671_1000086098 | 413 |
| 207 | 3300005367 | Ga0070667_100103614 | Ga0070667_1001036141 | 413 |
| 208 | 3300005436 | Ga0070713_100009588 | Ga0070713_1000095886 | 413 |
| 209 | 3300005439 | Ga0070711_100072866 | Ga0070711_1000728662 | 413 |
| 210 | 3300005458 | Ga0070681_10020212 | Ga0070681_100202123 | 413 |
| 211 | 3300005530 | Ga0070679_100000302 | Ga0070679_10000030216 | 413 |
| 212 | 3300005535 | Ga0070684_100002999 | Ga0070684_1000029998 | 413 |
| 213 | 3300005577 | Ga0068857_100006252 | Ga0068857_1000062528 | 413 |
| 214 | 3300005578 | Ga0068854_100134239 | Ga0068854_1001342392 | 413 |
| 215 | 3300005618 | Ga0068864_100079695 | Ga0068864_1000796952 | 413 |
| 216 | 3300005841 | Ga0068863_100011828 | Ga0068863_1000118282 | 413 |
| 217 | 3300009093 | Ga0105240_10007222 | Ga0105240_1000722211 | 413 |
| 218 | 3300009093 | Ga0105240_10033151 | Ga0105240_100331513 | 413 |
| 219 | 3300009093 | Ga0105240_10203544 | Ga0105240_102035442 | 413 |
| 220 | 3300009174 | Ga0105241_10001247 | Ga0105241_100012476 | 413 |
| 221 | 3300009177 | Ga0105248_10016708 | Ga0105248_100167084 | 413 |
| 222 | 3300009545 | Ga0105237_10014420 | Ga0105237_100144205 | 413 |
| 223 | 3300009551 | Ga0105238_10002827 | Ga0105238_100028277 | 413 |
| 224 | 3300010375 | Ga0105239_10004434 | Ga0105239_1000443414 | 413 |
| 225 | 3300013104 | Ga0157370_10002114 | Ga0157370_1000211421 | 413 |
| 226 | 3300013104 | Ga0157370_10004725 | Ga0157370_100047255 | 413 |
| 227 | 3300013105 | Ga0157369_10001335 | Ga0157369_1000133512 | 413 |
| 228 | 3300013105 | Ga0157369_10002554 | Ga0157369_100025549 | 413 |
| 229 | 3300013307 | Ga0157372_10011642 | Ga0157372_100116422 | 413 |
| 230 | 3300013307 | Ga0157372_10036761 | Ga0157372_100367612 | 413 |
| 231 | 3300014325 | Ga0163163_10015113 | Ga0163163_100151132 | 413 |
| 232 | 3300014325 | Ga0163163_10083430 | Ga0163163_100834304 | 413 |
| 233 | 3300025911 | Ga0207654_10014130 | Ga0207654_100141304 | 413 |
| 234 | 3300025913 | Ga0207695_10001695 | Ga0207695_100016956 | 413 |
| 235 | 3300025941 | Ga0207711_10049619 | Ga0207711_100496193 | 413 |
| 236 | 3300025944 | Ga0207661_10002821 | Ga0207661_100028213 | 413 |
| 237 | 3300025949 | Ga0207667_10007008 | Ga0207667_1000700810 | 413 |
| 238 | 3300026078 | Ga0207702_10006636 | Ga0207702_100066368 | 413 |
| 239 | 3300026095 | Ga0207676_10048217 | Ga0207676_100482171 | 413 |
| 240 | 3300026116 | Ga0207674_10001168 | Ga0207674_1000116820 | 413 |
| 241 | 3300026121 | Ga0207683_10224170 | Ga0207683_102241702 | 413 |
| 242 | 3300033180 | Ga0307510_10019637 | Ga0307510_100196373 | 413 |
| 243 | 3300035118 | Ga0373954_0006530 | Ga0373954_0006530_502_1785 | 413 |
| 244 | 3300035724 | Ga0373933_0026978 | Ga0373933_0026978_417_1700 | 413 |
| 245 | 3300036401 | Ga0373937_0013760 | Ga0373937_0013760_4874_6157 | 413 |
| 246 | 3300036401 | Ga0373937_0168037 | Ga0373937_0168037_302_1585 | 413 |
| 247 | 3300046536 | Ga0495587_0002050 | Ga0495587_0002050_7543_8826 | 413 |
| 248 | 3300046557 | Ga0495622_0084255 | Ga0495622_0084255_182_1423 | 413 |
| 249 | 3300046689 | Ga0495613_0035414 | Ga0495613_0035414_72_1313 | 413 |
| 250 | 3300048088 | Ga0495602_0015857 | Ga0495602_0015857_4544_5827 | 413 |
| 251 | 3300048915 | Ga0496112_0042492 | Ga0496112_0042492_315_1556 | 413 |
| 252 | 3300055283 | Ga0500661_000704 | Ga0500661_000704_3258_4499 | 413 |
| 253 | 3300006237 | Ga0097621_100079078 | Ga0097621_1000790782 | 414 |
| 254 | 3300009177 | Ga0105248_10108081 | Ga0105248_101080812 | 414 |
| 255 | 3300046455 | Ga0495603_0009323 | Ga0495603_0009323_2903_4153 | 414 |
| 256 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_269065_270315 | 414 |
| 257 | 3300046472 | Ga0495580_0027425 | Ga0495580_0027425_2064_3314 | 414 |
| 258 | 3300046492 | Ga0495585_0110587 | Ga0495585_0110587_106_1356 | 414 |
| 259 | 3300046523 | Ga0495644_0000015 | Ga0495644_0000015_33985_35235 | 414 |
| 260 | 3300046528 | Ga0495642_0046036 | Ga0495642_0046036_336_1613 | 414 |
| 261 | 3300046529 | Ga0495652_0043218 | Ga0495652_0043218_846_2090 | 414 |
| 262 | 3300046538 | Ga0495609_0028253 | Ga0495609_0028253_228_1478 | 414 |
| 263 | 3300046558 | Ga0495633_0014425 | Ga0495633_0014425_1534_2784 | 414 |
| 264 | 3300046648 | Ga0495611_0064045 | Ga0495611_0064045_76_1326 | 414 |
| 265 | 3300046660 | Ga0495625_0090631 | Ga0495625_0090631_87_1364 | 414 |
| 266 | 3300046684 | Ga0495669_0000714 | Ga0495669_0000714_657_1907 | 414 |
| 267 | 3300047469 | Ga0495673_0040348 | Ga0495673_0040348_41_1318 | 414 |
| 268 | 3300048917 | Ga0496114_0053521 | Ga0496114_0053521_704_1948 | 414 |
| 269 | 3300049460 | Ga0495682_0024080 | Ga0495682_0024080_557_1834 | 414 |
| 270 | 3300005530 | Ga0070679_100003228 | Ga0070679_1000032283 | 415 |
| 271 | 3300025921 | Ga0207652_10002671 | Ga0207652_1000267112 | 415 |
| 272 | 3300005439 | Ga0070711_100111500 | Ga0070711_1001115002 | 416 |
| 273 | 3300005535 | Ga0070684_100065799 | Ga0070684_1000657992 | 417 |
| 274 | 3300046475 | Ga0495639_0001372 | Ga0495639_0001372_703_1989 | 422 |
| 275 | 3300046516 | Ga0495628_0080029 | Ga0495628_0080029_73_1359 | 422 |
| 276 | 3300046517 | Ga0495630_0078680 | Ga0495630_0078680_452_1738 | 422 |
| 277 | 3300046529 | Ga0495652_0003210 | Ga0495652_0003210_227_1513 | 422 |
| 278 | 3300046543 | Ga0495645_0120290 | Ga0495645_0120290_232_1518 | 422 |
| 279 | 3300046559 | Ga0495667_0049504 | Ga0495667_0049504_350_1636 | 422 |
| 280 | 3300046678 | Ga0495599_0020616 | Ga0495599_0020616_2564_3850 | 422 |
| 281 | 3300046689 | Ga0495613_0011937 | Ga0495613_0011937_1257_2543 | 422 |
| 282 | 3300046690 | Ga0495624_0017145 | Ga0495624_0017145_1233_2519 | 422 |
| 283 | 3300046809 | Ga0495600_0014488 | Ga0495600_0014488_3609_4895 | 422 |
| 284 | 3300047315 | Ga0495581_0002297 | Ga0495581_0002297_9123_10409 | 422 |
| 285 | 3300047317 | Ga0495604_0016033 | Ga0495604_0016033_3430_4716 | 422 |
| 286 | 3300047321 | Ga0495676_0021391 | Ga0495676_0021391_130_1416 | 422 |
| 287 | 3300047471 | Ga0495684_0026157 | Ga0495684_0026157_2474_3760 | 422 |
| 288 | 3300028379 | Ga0268266_10010586 | Ga0268266_100105863 | 427 |
| 289 | 3300003320 | rootH2_10061435 | rootH2_100614356 | 434 |
| 290 | 3300005548 | Ga0070665_100026142 | Ga0070665_1000261421 | 434 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g92-assembly1.cif.gz_A | structure of inhibitor 16d-bound spns2 | 0.8573 | 33 | 413 |
| 8jtc-assembly1.cif.gz_A | human vmat2 complex with reserpine | 0.8391 | 35 | 415 |
| 6kkk-assembly3.cif.gz_C | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) | 0.8348 | 36 | 421 |
| 8ex4-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1) | 0.8315 | 33 | 413 |
| 7yub-assembly1.cif.gz_R | s1p-bound human spns2 | 0.8272 | 33 | 414 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24077_14_401_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9313 | 32 | 415 | 1.20.1250.20 |
| af_P24077_14_401_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9151 | 32 | 415 | 1.20.1250.20 |
| af_Q2G1R0_3_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9144 | 29 | 224 | 1.20.1250.20 |
| af_P9WJX9_6_194_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8959 | 35 | 215 | 1.20.1250.20 |
| af_Q2FW71_4_384_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8951 | 38 | 417 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E4JGV3-F1-model_v4 | MFS transporter | 0.9873 | 19 | 414 |
GO:0005886
GO:0022857 |
| AF-A0A496RMH6-F1-model_v4 | MFS transporter | 0.983 | 27 | 417 |
GO:0005886
GO:0022857 |
| AF-A0A7V9QCP5-F1-model_v4 | MFS transporter | 0.9793 | 26 | 417 |
GO:0005886
GO:0022857 |
| AF-A0A3B9YCN6-F1-model_v4 | MFS transporter | 0.9781 | 21 | 418 |
GO:0005886
|
| AF-A0A2T1BYJ3-F1-model_v4 | MFS transporter | 0.9778 | 29 | 414 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar