F389672

General Info

Members Datasets Scaffolds Average Seq Length
290 158 290 402

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100219942|Ga0068860_1002199422
Length 464
Sequence MKHWKTGNTRCPPTVPTPFSVSRFIRVTPDLLKSPLHLLPEYRRLALPTEQAKSLPEKDSSALIGRIFKAFQFRDFRLMWTGACTSQIGTQMQTAAQSWLVYDLSKHSSVFLGLDNFLGTLPIVLFSLVGGVFADRHDRRKVLLGSQYVQTVCAFLLAALVFTGVVHVWHVLCLSVVVGMAQSFGGPAYSALIPSLVPKEHLQNAISLNSIQFNLARVIGPALGGIALIKLGAAWNFTFNGISFVGVIITLYLIQTTFIPAKSREPIMTSMKEGIRFMRQQPGMESLIALAFLMTTLGFPVIIFLVVFAEEVFKGGTQTFTWLLCSSGAGAVTGALIAAGGRQKRKGLAALIMLAALGLFTMAFAQSPSTPVACAMLFLAGASLMGVFSMITTLVQMIIPDNMRGRVMSVYNLALRGGGPVGSLLVGTIMIPRFGAPLTFTIAGALEILLAIYFLTVNRRVAVL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 1.38
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 12.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10061435 3300003320 Bacteria 5244
2 rootH2_10063979 3300003320 Bacteria 4290
3 Ga0070658_10007748 3300005327 Bacteria 8654
4 Ga0070683_100048323 3300005329 Bacteria 3933
5 Ga0070683_100118750 3300005329 Bacteria 2497
6 Ga0070680_100033863 3300005336 Bacteria 4119
7 Ga0070680_100084662 3300005336 Bacteria 2619
8 Ga0070660_100063875 3300005339 Bacteria 2863
9 Ga0070661_100083718 3300005344 Bacteria 2356
10 Ga0070671_100008609 3300005355 Bacteria 8179
11 Ga0070659_100022432 3300005366 Unclassified 4820
12 Ga0070667_100103614 3300005367 Bacteria 2460
13 Ga0070713_100009588 3300005436 Bacteria 6944
14 Ga0070713_100022949 3300005436 Bacteria 4831
15 Ga0070711_100072866 3300005439 Bacteria 2424
16 Ga0070711_100111500 3300005439 Bacteria 2009
17 Ga0070700_100047890 3300005441 Bacteria 2647
18 Ga0070708_100111596 3300005445 Unclassified 2514
19 Ga0070678_100211547 3300005456 Bacteria 1607
20 Ga0070662_100074301 3300005457 Unclassified 2514
21 Ga0070681_10020212 3300005458 Bacteria 6675
22 Ga0068867_100086703 3300005459 Unclassified 2369
23 Ga0070679_100000302 3300005530 Bacteria 42063
24 Ga0070679_100003228 3300005530 Bacteria 14891
25 Ga0070679_100047842 3300005530 Bacteria 4262
26 Ga0070684_100002999 3300005535 Bacteria 12566
27 Ga0070684_100041083 3300005535 Bacteria 3986
28 Ga0070684_100065799 3300005535 Bacteria 3182
29 Ga0070684_100178671 3300005535 Bacteria 1929
30 Ga0070684_100247011 3300005535 Bacteria 1631
31 Ga0068853_100005025 3300005539 Bacteria 10314
32 Ga0068853_100205786 3300005539 Unclassified 1792
33 Ga0068853_100309013 3300005539 Unclassified 1463
34 Ga0070665_100010863 3300005548 Bacteria 9211
35 Ga0070665_100026142 3300005548 Bacteria 5878
36 Ga0070665_100155072 3300005548 Bacteria 2292
37 Ga0068855_100026860 3300005563 Bacteria 6888
38 Ga0068855_100037056 3300005563 Bacteria 5802
39 Ga0068855_100050220 3300005563 Bacteria 4917
40 Ga0070664_100155685 3300005564 Bacteria 2019
41 Ga0068857_100004932 3300005577 Bacteria 11327
42 Ga0068857_100006252 3300005577 Bacteria 10183
43 Ga0068854_100134239 3300005578 Bacteria 1893
44 Ga0068856_100001623 3300005614 Bacteria 23549
45 Ga0068856_100004199 3300005614 Bacteria 14388
46 Ga0068859_100124780 3300005617 Unclassified 2643
47 Ga0068864_100079695 3300005618 Bacteria 2868
48 Ga0068863_100011828 3300005841 Bacteria 8435
49 Ga0068863_100067611 3300005841 Unclassified 3380
50 Ga0068860_100052450 3300005843 Unclassified 3880
51 Ga0068860_100219942 3300005843 Bacteria 1844
52 Ga0081455_10034970 3300005937 Unclassified 4496
53 Ga0070717_10003653 3300006028 Bacteria 11042
54 Ga0070717_10016499 3300006028 Bacteria 5726
55 Ga0097621_100003726 3300006237 Bacteria 10555
56 Ga0097621_100079078 3300006237 Bacteria 2733
57 Ga0097621_100286870 3300006237 Unclassified 1450
58 Ga0068871_100096325 3300006358 Bacteria 2472
59 Ga0068865_100160334 3300006881 Bacteria 1715
60 Ga0097620_100124788 3300006931 Unclassified 2643
61 Ga0075435_100121572 3300007076 Unclassified 2179
62 Ga0105240_10000713 3300009093 Bacteria 60923
63 Ga0105240_10002246 3300009093 Bacteria 31374
64 Ga0105240_10007222 3300009093 Bacteria 16180
65 Ga0105240_10009999 3300009093 Bacteria 13368
66 Ga0105240_10012690 3300009093 Bacteria 11611
67 Ga0105240_10033151 3300009093 Bacteria 6675
68 Ga0105240_10163412 3300009093 Bacteria 2642
69 Ga0105240_10203544 3300009093 Bacteria 2318
70 Ga0105245_10008232 3300009098 Bacteria 9113
71 Ga0105245_10012377 3300009098 Bacteria 7424
72 Ga0105247_10056152 3300009101 Bacteria 2431
73 Ga0105243_10085067 3300009148 Bacteria 2592
74 Ga0105241_10000080 3300009174 Bacteria 71562
75 Ga0105241_10001247 3300009174 Bacteria 19418
76 Ga0105242_10025379 3300009176 Bacteria 4690
77 Ga0105242_10046886 3300009176 Unclassified 3508
78 Ga0105242_10220978 3300009176 Bacteria 1693
79 Ga0105248_10016708 3300009177 Bacteria 8079
80 Ga0105248_10108081 3300009177 Bacteria 3137
81 Ga0105248_10143668 3300009177 Unclassified 2692
82 Ga0105237_10003585 3300009545 Bacteria 18365
83 Ga0105237_10011684 3300009545 Bacteria 9289
84 Ga0105237_10014420 3300009545 Bacteria 8266
85 Ga0105237_10017143 3300009545 Bacteria 7513
86 Ga0105237_10072325 3300009545 Bacteria 3442
87 Ga0105237_10083219 3300009545 Bacteria 3191
88 Ga0105237_10116910 3300009545 Unclassified 2660
89 Ga0105238_10002827 3300009551 Bacteria 17320
90 Ga0105238_10004139 3300009551 Bacteria 14390
91 Ga0105238_10185351 3300009551 Bacteria 2057
92 Ga0105238_10263102 3300009551 Bacteria 1705
93 Ga0105239_10004434 3300010375 Bacteria 16782
94 Ga0105239_10068336 3300010375 Bacteria 3904
95 Ga0105246_10012163 3300011119 Bacteria 5363
96 Ga0105246_10035569 3300011119 Bacteria 3329
97 Ga0157370_10002114 3300013104 Bacteria 24266
98 Ga0157370_10004725 3300013104 Bacteria 15528
99 Ga0157370_10015598 3300013104 Bacteria 7720
100 Ga0157370_10093805 3300013104 Unclassified 2817
101 Ga0157369_10001335 3300013105 Bacteria 30481
102 Ga0157369_10002000 3300013105 Bacteria 24536
103 Ga0157369_10002554 3300013105 Bacteria 21788
104 Ga0157369_10006249 3300013105 Bacteria 13823
105 Ga0157369_10099401 3300013105 Bacteria 3102
106 Ga0157369_10174483 3300013105 Unclassified 2263
107 Ga0157374_10002041 3300013296 Bacteria 16965
108 Ga0157374_10002960 3300013296 Bacteria 14224
109 Ga0157374_10013303 3300013296 Bacteria 7180
110 Ga0157374_10216172 3300013296 Bacteria 1880
111 Ga0157378_10228182 3300013297 Unclassified 1773
112 Ga0163162_10002178 3300013306 Bacteria 18377
113 Ga0157372_10011642 3300013307 Bacteria 9364
114 Ga0157372_10036761 3300013307 Bacteria 5400
115 Ga0157372_10052912 3300013307 Bacteria 4523
116 Ga0157375_10006730 3300013308 Bacteria 10011
117 Ga0163163_10014192 3300014325 Bacteria 7317
118 Ga0163163_10015113 3300014325 Bacteria 7124
119 Ga0163163_10018449 3300014325 Bacteria 6531
120 Ga0163163_10083430 3300014325 Bacteria 3201
121 Ga0157379_10011574 3300014968 Bacteria 7702
122 Ga0157379_10037370 3300014968 Bacteria 4329
123 Ga0157376_10049626 3300014969 Unclassified 3477
124 Ga0213872_10000466 3300021361 Bacteria 32902
125 Ga0213874_10029809 3300021377 Archaea 1568
126 Ga0213876_10035843 3300021384 Bacteria 2616
127 Ga0213875_10000005 3300021388 Bacteria 595146
128 Ga0213875_10005358 3300021388 Bacteria 6896
129 Ga0213875_10006277 3300021388 Bacteria 6256
130 Ga0213875_10012402 3300021388 Bacteria 4214
131 Ga0213875_10012909 3300021388 Bacteria 4114
132 Ga0213875_10091622 3300021388 Unclassified 1418
133 Ga0207705_10040361 3300025909 Unclassified 3347
134 Ga0207654_10000598 3300025911 Bacteria 20314
135 Ga0207654_10014130 3300025911 Bacteria 4119
136 Ga0207654_10139030 3300025911 Bacteria 1547
137 Ga0207707_10000469 3300025912 Bacteria 41694
138 Ga0207707_10049556 3300025912 Unclassified 3659
139 Ga0207695_10001695 3300025913 Bacteria 35368
140 Ga0207695_10002673 3300025913 Bacteria 26047
141 Ga0207695_10068479 3300025913 Bacteria 3637
142 Ga0207695_10094952 3300025913 Bacteria 2988
143 Ga0207671_10016568 3300025914 Bacteria 5723
144 Ga0207671_10031622 3300025914 Bacteria 3943
145 Ga0207671_10136963 3300025914 Unclassified 1883
146 Ga0207693_10145035 3300025915 Bacteria 1867
147 Ga0207663_10020484 3300025916 Unclassified 3745
148 Ga0207660_10013048 3300025917 Bacteria 5440
149 Ga0207657_10246327 3300025919 Bacteria 1426
150 Ga0207652_10002671 3300025921 Bacteria 14956
151 Ga0207652_10003282 3300025921 Bacteria 13394
152 Ga0207694_10001694 3300025924 Bacteria 18474
153 Ga0207694_10008437 3300025924 Bacteria 7777
154 Ga0207694_10030724 3300025924 Bacteria 4101
155 Ga0207687_10000521 3300025927 Bacteria 25789
156 Ga0207687_10007963 3300025927 Bacteria 6937
157 Ga0207700_10090926 3300025928 Unclassified 2410
158 Ga0207690_10023885 3300025932 Unclassified 3822
159 Ga0207686_10035061 3300025934 Bacteria 3009
160 Ga0207686_10070944 3300025934 Bacteria 2240
161 Ga0207686_10086903 3300025934 Bacteria 2055
162 Ga0207704_10123903 3300025938 Bacteria 1775
163 Ga0207711_10002155 3300025941 Bacteria 17723
164 Ga0207711_10049619 3300025941 Bacteria 3593
165 Ga0207711_10049674 3300025941 Bacteria 3591
166 Ga0207689_10007461 3300025942 Bacteria 9586
167 Ga0207661_10002821 3300025944 Bacteria 11996
168 Ga0207661_10019243 3300025944 Bacteria 5086
169 Ga0207679_10164228 3300025945 Bacteria 1821
170 Ga0207667_10000682 3300025949 Bacteria 44026
171 Ga0207667_10007008 3300025949 Bacteria 13615
172 Ga0207667_10015267 3300025949 Bacteria 8733
173 Ga0207667_10060536 3300025949 Bacteria 3963
174 Ga0207667_10082758 3300025949 Bacteria 3324
175 Ga0207703_10049405 3300026035 Unclassified 3400
176 Ga0207639_10040654 3300026041 Bacteria 3472
177 Ga0207708_10063153 3300026075 Bacteria 2829
178 Ga0207702_10006636 3300026078 Bacteria 9952
179 Ga0207702_10087329 3300026078 Bacteria 2722
180 Ga0207641_10048008 3300026088 Unclassified 3603
181 Ga0207648_10057856 3300026089 Unclassified 3382
182 Ga0207676_10048217 3300026095 Bacteria 3306
183 Ga0207674_10001168 3300026116 Bacteria 34093
184 Ga0207674_10009238 3300026116 Bacteria 11300
185 Ga0207683_10224170 3300026121 Bacteria 1713
186 Ga0268266_10010586 3300028379 Bacteria 8044
187 Ga0268266_10058703 3300028379 Bacteria 3313
188 Ga0268266_10086753 3300028379 Bacteria 2737
189 Ga0268266_10111777 3300028379 Bacteria 2421
190 Ga0268264_10043915 3300028381 Unclassified 3705
191 Ga0268264_10145326 3300028381 Bacteria 2120
192 Ga0265762_1001295 3300030760 Bacteria 4553
193 Ga0265760_10014389 3300031090 Unclassified 2266
194 Ga0265328_10058306 3300031239 Bacteria 1418
195 Ga0265316_10004637 3300031344 Bacteria 13623
196 Ga0265316_10025644 3300031344 Bacteria 4916
197 Ga0265316_10096156 3300031344 Unclassified 2255
198 Ga0265313_10001183 3300031595 Bacteria 24958
199 Ga0307510_10019637 3300033180 Bacteria 7920
200 Ga0373934_0047000 3300035086 Bacteria 1707
201 Ga0373923_0026848 3300035111 Unclassified 2293
202 Ga0373954_0006530 3300035118 Bacteria 5083
203 Ga0373954_0042146 3300035118 Unclassified 2128
204 Ga0373935_0130796 3300035692 Bacteria 1686
205 Ga0373927_0036357 3300035695 Bacteria 3203
206 Ga0373933_0026978 3300035724 Unclassified 3304
207 Ga0373937_0013760 3300036401 Bacteria 7129
208 Ga0373937_0069845 3300036401 Bacteria 3239
209 Ga0373937_0168037 3300036401 Unclassified 2057
210 Ga0436364_0053541 3300037853 Bacteria 2370
211 Ga0436364_0157811 3300037853 Bacteria 430293
212 Ga0436364_0231805 3300037853 Bacteria 6135
213 Ga0436364_0309246 3300037853 Bacteria 2355
214 Ga0436364_0323341 3300037853 Bacteria 5861
215 Ga0436364_0446012 3300037853 Bacteria 193523
216 Ga0436364_0570827 3300037853 Bacteria 13350
217 Ga0436364_0630110 3300037853 Bacteria 5135
218 Ga0436364_0642579 3300037853 Unclassified 2125
219 Ga0436364_0840931 3300037853 Bacteria 11199
220 Ga0436364_0855073 3300037853 Bacteria 15706
221 Ga0436364_0988131 3300037853 Unclassified 2101
222 Ga0436364_1209777 3300037853 Unclassified 1877
223 Ga0436364_1520570 3300037853 Unclassified 2274
224 Ga0436364_1556172 3300037853 Bacteria 18276
225 Ga0436365_0107208 3300039437 Bacteria 28932
226 Ga0436365_0170096 3300039437 Bacteria 4416
227 Ga0436365_0199967 3300039437 Bacteria 1916
228 Ga0436365_0611496 3300039437 Bacteria 1368
229 Ga0436365_1271418 3300039437 Unclassified 3182
230 Ga0436360_0281016 3300039438 Bacteria 20162
231 Ga0436361_1097729 3300039447 Bacteria 95612
232 Ga0436363_1028599 3300039450 Unclassified 1947
233 Ga0436363_1354498 3300039450 Bacteria 3311
234 Ga0436362_0054350 3300039453 Bacteria 2735
235 Ga0436362_0109449 3300039453 Unclassified 3488
236 Ga0436362_0561686 3300039453 Unclassified 4279
237 Ga0436362_0805691 3300039453 Bacteria 5720
238 Ga0466957_0175965 3300044842 Bacteria 1395
239 Ga0451576_0025479 3300045051 Bacteria 6371
240 Ga0495603_0009323 3300046455 Bacteria 5935
241 Ga0495629_0183961 3300046459 Bacteria 1448
242 Ga0495650_0000038 3300046471 Bacteria 377530
243 Ga0495580_0027425 3300046472 Bacteria 4144
244 Ga0495580_0041298 3300046472 Unclassified 3290
245 Ga0495580_0053627 3300046472 Unclassified 2845
246 Ga0495582_0003912 3300046473 Bacteria 8360
247 Ga0495639_0001372 3300046475 Bacteria 10935
248 Ga0495585_0110587 3300046492 Bacteria 1461
249 Ga0495628_0080029 3300046516 Bacteria 2540
250 Ga0495630_0078680 3300046517 Bacteria 2487
251 Ga0495644_0000015 3300046523 Bacteria 89336
252 Ga0495642_0046036 3300046528 Bacteria 1784
253 Ga0495652_0003210 3300046529 Bacteria 16307
254 Ga0495652_0043218 3300046529 Bacteria 3883
255 Ga0495586_0073058 3300046535 Unclassified 1876
256 Ga0495587_0002050 3300046536 Bacteria 13455
257 Ga0495609_0028253 3300046538 Bacteria 2560
258 Ga0495645_0120290 3300046543 Bacteria 1849
259 Ga0495622_0084255 3300046557 Bacteria 1462
260 Ga0495633_0014425 3300046558 Bacteria 4134
261 Ga0495667_0049504 3300046559 Bacteria 2774
262 Ga0495611_0064045 3300046648 Bacteria 1674
263 Ga0495625_0000102 3300046660 Bacteria 138850
264 Ga0495625_0090631 3300046660 Bacteria 2114
265 Ga0495599_0020616 3300046678 Bacteria 4106
266 Ga0495669_0000714 3300046684 Bacteria 14441
267 Ga0495613_0011937 3300046689 Bacteria 6457
268 Ga0495613_0035414 3300046689 Bacteria 3704
269 Ga0495624_0017145 3300046690 Bacteria 4869
270 Ga0495600_0014488 3300046809 Bacteria 4968
271 Ga0495581_0002297 3300047315 Bacteria 10766
272 Ga0495604_0016033 3300047317 Bacteria 5984
273 Ga0495676_0021391 3300047321 Bacteria 5651
274 Ga0495675_0103737 3300047444 Bacteria 1778
275 Ga0495673_0040348 3300047469 Bacteria 2110
276 Ga0495684_0010768 3300047471 Bacteria 7068
277 Ga0495684_0026157 3300047471 Bacteria 4484
278 Ga0495686_0036967 3300047472 Bacteria 3131
279 Ga0495602_0015857 3300048088 Bacteria 7590
280 Ga0496112_0011846 3300048915 Bacteria 7986
281 Ga0496112_0042492 3300048915 Bacteria 4447
282 Ga0496114_0053521 3300048917 Bacteria 3365
283 Ga0496115_0194711 3300048918 Bacteria 1675
284 Ga0496126_0000758 3300048929 Bacteria 58461
285 Ga0496126_0019270 3300048929 Bacteria 6723
286 Ga0495682_0024080 3300049460 Bacteria 2272
287 nmdc:mga0rr50_56636_c1 3300050513 Unclassified 2193
288 Ga0500595_000032 3300053119 Bacteria 111447
289 Ga0500661_000704 3300055283 Bacteria 6236
290 Ga0501082_0000249 3300060353 Bacteria 47254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1520570 Ga0436364_1520570_1273_2259 328
2 3300006028 Ga0070717_10016499 Ga0070717_100164998 355
3 3300039437 Ga0436365_0170096 Ga0436365_0170096_2964_4082 359
4 3300037853 Ga0436364_0630110 Ga0436364_0630110_12_1103 363
5 3300037853 Ga0436364_1209777 Ga0436364_1209777_694_1851 363
6 3300006237 Ga0097621_100286870 Ga0097621_1002868702 370
7 3300021377 Ga0213874_10029809 Ga0213874_100298092 370
8 3300031239 Ga0265328_10058306 Ga0265328_100583062 370
9 3300037853 Ga0436364_0570827 Ga0436364_0570827_10438_11553 371
10 3300005436 Ga0070713_100022949 Ga0070713_1000229493 372
11 3300006028 Ga0070717_10003653 Ga0070717_100036538 372
12 3300013104 Ga0157370_10093805 Ga0157370_100938053 372
13 3300014325 Ga0163163_10018449 Ga0163163_100184496 372
14 3300014968 Ga0157379_10011574 Ga0157379_100115746 372
15 3300021388 Ga0213875_10000005 Ga0213875_10000005289 372
16 3300021388 Ga0213875_10012402 Ga0213875_100124022 372
17 3300021388 Ga0213875_10091622 Ga0213875_100916221 372
18 3300025916 Ga0207663_10020484 Ga0207663_100204843 372
19 3300025949 Ga0207667_10015267 Ga0207667_100152676 372
20 3300036401 Ga0373937_0069845 Ga0373937_0069845_2054_3178 372
21 3300039450 Ga0436363_1028599 Ga0436363_1028599_31_1149 372
22 3300039453 Ga0436362_0054350 Ga0436362_0054350_1493_2611 372
23 3300046472 Ga0495580_0041298 Ga0495580_0041298_744_1862 372
24 3300046472 Ga0495580_0053627 Ga0495580_0053627_144_1268 372
25 3300046473 Ga0495582_0003912 Ga0495582_0003912_3592_4716 372
26 3300046535 Ga0495586_0073058 Ga0495586_0073058_172_1296 372
27 3300039437 Ga0436365_0199967 Ga0436365_0199967_537_1694 373
28 3300005548 Ga0070665_100010863 Ga0070665_1000108637 374
29 3300028379 Ga0268266_10058703 Ga0268266_100587034 374
30 3300005329 Ga0070683_100048323 Ga0070683_1000483233 377
31 3300005336 Ga0070680_100084662 Ga0070680_1000846622 377
32 3300005530 Ga0070679_100047842 Ga0070679_1000478424 377
33 3300005535 Ga0070684_100247011 Ga0070684_1002470112 377
34 3300046459 Ga0495629_0183961 Ga0495629_0183961_225_1379 377
35 3300005366 Ga0070659_100022432 Ga0070659_1000224323 379
36 3300005614 Ga0068856_100001623 Ga0068856_1000016235 379
37 3300013105 Ga0157369_10174483 Ga0157369_101744832 379
38 3300013296 Ga0157374_10002960 Ga0157374_100029605 379
39 3300025932 Ga0207690_10023885 Ga0207690_100238853 379
40 3300048915 Ga0496112_0011846 Ga0496112_0011846_4173_5330 379
41 3300009545 Ga0105237_10011684 Ga0105237_100116843 380
42 3300025914 Ga0207671_10136963 Ga0207671_101369632 380
43 3300025911 Ga0207654_10000598 Ga0207654_100005983 381
44 3300005329 Ga0070683_100118750 Ga0070683_1001187503 385
45 3300005339 Ga0070660_100063875 Ga0070660_1000638752 385
46 3300005457 Ga0070662_100074301 Ga0070662_1000743012 385
47 3300005459 Ga0068867_100086703 Ga0068867_1000867032 385
48 3300005539 Ga0068853_100005025 Ga0068853_1000050258 385
49 3300005539 Ga0068853_100205786 Ga0068853_1002057862 385
50 3300005563 Ga0068855_100026860 Ga0068855_1000268603 385
51 3300005564 Ga0070664_100155685 Ga0070664_1001556852 385
52 3300005577 Ga0068857_100004932 Ga0068857_1000049324 385
53 3300005841 Ga0068863_100067611 Ga0068863_1000676113 385
54 3300005843 Ga0068860_100052450 Ga0068860_1000524503 385
55 3300005937 Ga0081455_10034970 Ga0081455_100349705 385
56 3300006358 Ga0068871_100096325 Ga0068871_1000963251 385
57 3300007076 Ga0075435_100121572 Ga0075435_1001215722 385
58 3300009093 Ga0105240_10009999 Ga0105240_100099998 385
59 3300009101 Ga0105247_10056152 Ga0105247_100561523 385
60 3300009176 Ga0105242_10025379 Ga0105242_100253793 385
61 3300009176 Ga0105242_10220978 Ga0105242_102209782 385
62 3300009545 Ga0105237_10083219 Ga0105237_100832192 385
63 3300009551 Ga0105238_10185351 Ga0105238_101853512 385
64 3300009551 Ga0105238_10263102 Ga0105238_102631021 385
65 3300011119 Ga0105246_10035569 Ga0105246_100355693 385
66 3300013105 Ga0157369_10006249 Ga0157369_1000624913 385
67 3300013307 Ga0157372_10052912 Ga0157372_100529122 385
68 3300014325 Ga0163163_10014192 Ga0163163_100141923 385
69 3300021361 Ga0213872_10000466 Ga0213872_1000046621 385
70 3300021388 Ga0213875_10006277 Ga0213875_100062774 385
71 3300021388 Ga0213875_10012909 Ga0213875_100129092 385
72 3300025911 Ga0207654_10139030 Ga0207654_101390301 385
73 3300025913 Ga0207695_10068479 Ga0207695_100684792 385
74 3300025913 Ga0207695_10094952 Ga0207695_100949523 385
75 3300025914 Ga0207671_10031622 Ga0207671_100316223 385
76 3300025915 Ga0207693_10145035 Ga0207693_101450352 385
77 3300025924 Ga0207694_10030724 Ga0207694_100307242 385
78 3300025927 Ga0207687_10007963 Ga0207687_100079633 385
79 3300025934 Ga0207686_10035061 Ga0207686_100350612 385
80 3300025934 Ga0207686_10070944 Ga0207686_100709442 385
81 3300025941 Ga0207711_10049674 Ga0207711_100496743 385
82 3300025942 Ga0207689_10007461 Ga0207689_100074619 385
83 3300025944 Ga0207661_10019243 Ga0207661_100192433 385
84 3300025945 Ga0207679_10164228 Ga0207679_101642282 385
85 3300025949 Ga0207667_10082758 Ga0207667_100827582 385
86 3300026041 Ga0207639_10040654 Ga0207639_100406543 385
87 3300026078 Ga0207702_10087329 Ga0207702_100873291 385
88 3300026088 Ga0207641_10048008 Ga0207641_100480083 385
89 3300026089 Ga0207648_10057856 Ga0207648_100578564 385
90 3300026116 Ga0207674_10009238 Ga0207674_100092384 385
91 3300028381 Ga0268264_10043915 Ga0268264_100439153 385
92 3300031344 Ga0265316_10004637 Ga0265316_1000463711 385
93 3300031344 Ga0265316_10096156 Ga0265316_100961562 385
94 3300031595 Ga0265313_10001183 Ga0265313_1000118312 385
95 3300035086 Ga0373934_0047000 Ga0373934_0047000_19_1182 385
96 3300035111 Ga0373923_0026848 Ga0373923_0026848_790_1953 385
97 3300035118 Ga0373954_0042146 Ga0373954_0042146_73_1236 385
98 3300037853 Ga0436364_0053541 Ga0436364_0053541_1112_2269 385
99 3300037853 Ga0436364_0323341 Ga0436364_0323341_2811_3968 385
100 3300037853 Ga0436364_0855073 Ga0436364_0855073_7343_8500 385
101 3300039437 Ga0436365_0611496 Ga0436365_0611496_152_1309 385
102 3300039450 Ga0436363_1354498 Ga0436363_1354498_114_1271 385
103 3300039453 Ga0436362_0805691 Ga0436362_0805691_753_1910 385
104 3300047444 Ga0495675_0103737 Ga0495675_0103737_191_1348 385
105 3300047471 Ga0495684_0010768 Ga0495684_0010768_3855_5018 385
106 3300048918 Ga0496115_0194711 Ga0496115_0194711_485_1642 385
107 3300050513 nmdc:mga0rr50_56636_c1 nmdc:mga0rr50_56636_c1_913_2070 385
108 3300037853 Ga0436364_0840931 Ga0436364_0840931_1572_2777 387
109 3300014968 Ga0157379_10037370 Ga0157379_100373704 391
110 3300009545 Ga0105237_10072325 Ga0105237_100723252 392
111 3300013306 Ga0163162_10002178 Ga0163162_100021784 392
112 3300003320 rootH2_10063979 rootH2_100639793 393
113 3300013104 Ga0157370_10015598 Ga0157370_100155985 393
114 3300031090 Ga0265760_10014389 Ga0265760_100143891 393
115 3300037853 Ga0436364_0988131 Ga0436364_0988131_779_1969 394
116 3300005563 Ga0068855_100037056 Ga0068855_1000370562 397
117 3300005614 Ga0068856_100004199 Ga0068856_1000041999 397
118 3300013296 Ga0157374_10216172 Ga0157374_102161722 397
119 3300025912 Ga0207707_10000469 Ga0207707_1000046916 397
120 3300025913 Ga0207695_10002673 Ga0207695_1000267311 397
121 3300025914 Ga0207671_10016568 Ga0207671_100165683 397
122 3300025917 Ga0207660_10013048 Ga0207660_100130484 397
123 3300025921 Ga0207652_10003282 Ga0207652_1000328210 397
124 3300025924 Ga0207694_10001694 Ga0207694_100016943 397
125 3300025949 Ga0207667_10000682 Ga0207667_1000068214 397
126 3300028379 Ga0268266_10086753 Ga0268266_100867533 397
127 3300021388 Ga0213875_10005358 Ga0213875_100053585 400
128 3300037853 Ga0436364_0642579 Ga0436364_0642579_438_1640 400
129 3300005327 Ga0070658_10007748 Ga0070658_100077485 401
130 3300005445 Ga0070708_100111596 Ga0070708_1001115962 401
131 3300005456 Ga0070678_100211547 Ga0070678_1002115472 401
132 3300005535 Ga0070684_100178671 Ga0070684_1001786712 401
133 3300005539 Ga0068853_100309013 Ga0068853_1003090131 401
134 3300005548 Ga0070665_100155072 Ga0070665_1001550722 401
135 3300005563 Ga0068855_100050220 Ga0068855_1000502202 401
136 3300009093 Ga0105240_10000713 Ga0105240_100007138 401
137 3300009093 Ga0105240_10002246 Ga0105240_1000224626 401
138 3300009093 Ga0105240_10012690 Ga0105240_100126906 401
139 3300009093 Ga0105240_10163412 Ga0105240_101634122 401
140 3300009545 Ga0105237_10017143 Ga0105237_100171431 401
141 3300025909 Ga0207705_10040361 Ga0207705_100403612 401
142 3300025912 Ga0207707_10049556 Ga0207707_100495563 401
143 3300025919 Ga0207657_10246327 Ga0207657_102463272 401
144 3300025949 Ga0207667_10060536 Ga0207667_100605362 401
145 3300028379 Ga0268266_10111777 Ga0268266_101117772 401
146 3300031344 Ga0265316_10025644 Ga0265316_100256443 401
147 3300035695 Ga0373927_0036357 Ga0373927_0036357_388_1626 401
148 3300037853 Ga0436364_0157811 Ga0436364_0157811_256616_257821 401
149 3300037853 Ga0436364_0446012 Ga0436364_0446012_51207_52412 401
150 3300039437 Ga0436365_1271418 Ga0436365_1271418_964_2169 401
151 3300039453 Ga0436362_0109449 Ga0436362_0109449_1941_3146 401
152 3300039453 Ga0436362_0561686 Ga0436362_0561686_1747_2952 401
153 3300044842 Ga0466957_0175965 Ga0466957_0175965_66_1271 401
154 3300045051 Ga0451576_0025479 Ga0451576_0025479_4600_5805 401
155 3300060353 Ga0501082_0000249 Ga0501082_0000249_34997_36202 401
156 3300009174 Ga0105241_10000080 Ga0105241_100000808 403
157 3300013105 Ga0157369_10002000 Ga0157369_100020002 403
158 3300048929 Ga0496126_0019270 Ga0496126_0019270_5202_6452 404
159 3300030760 Ga0265762_1001295 Ga0265762_10012952 405
160 3300021384 Ga0213876_10035843 Ga0213876_100358433 406
161 3300037853 Ga0436364_0231805 Ga0436364_0231805_1931_3151 406
162 3300039437 Ga0436365_0107208 Ga0436365_0107208_27447_28667 406
163 3300025928 Ga0207700_10090926 Ga0207700_100909263 407
164 3300035692 Ga0373935_0130796 Ga0373935_0130796_315_1565 407
165 3300037853 Ga0436364_1556172 Ga0436364_1556172_10156_11403 407
166 3300039438 Ga0436360_0281016 Ga0436360_0281016_9504_10757 407
167 3300039447 Ga0436361_1097729 Ga0436361_1097729_76959_78212 407
168 3300053119 Ga0500595_000032 Ga0500595_000032_102003_103253 408
169 3300005535 Ga0070684_100041083 Ga0070684_1000410832 409
170 3300009098 Ga0105245_10008232 Ga0105245_100082326 409
171 3300009098 Ga0105245_10012377 Ga0105245_100123773 409
172 3300009177 Ga0105248_10143668 Ga0105248_101436683 409
173 3300009545 Ga0105237_10003585 Ga0105237_100035854 409
174 3300009545 Ga0105237_10116910 Ga0105237_101169103 409
175 3300009551 Ga0105238_10004139 Ga0105238_100041394 409
176 3300010375 Ga0105239_10068336 Ga0105239_100683362 409
177 3300011119 Ga0105246_10012163 Ga0105246_100121632 409
178 3300013105 Ga0157369_10099401 Ga0157369_100994012 409
179 3300013296 Ga0157374_10013303 Ga0157374_100133034 409
180 3300013297 Ga0157378_10228182 Ga0157378_102281822 409
181 3300013308 Ga0157375_10006730 Ga0157375_100067308 409
182 3300014969 Ga0157376_10049626 Ga0157376_100496263 409
183 3300025924 Ga0207694_10008437 Ga0207694_100084372 409
184 3300025927 Ga0207687_10000521 Ga0207687_1000052116 409
185 3300025941 Ga0207711_10002155 Ga0207711_100021556 409
186 3300026035 Ga0207703_10049405 Ga0207703_100494055 409
187 3300046660 Ga0495625_0000102 Ga0495625_0000102_60669_61937 409
188 3300047472 Ga0495686_0036967 Ga0495686_0036967_1776_3008 410
189 3300013296 Ga0157374_10002041 Ga0157374_100020418 411
190 3300048929 Ga0496126_0000758 Ga0496126_0000758_47704_48948 411
191 3300005441 Ga0070700_100047890 Ga0070700_1000478902 412
192 3300005617 Ga0068859_100124780 Ga0068859_1001247802 412
193 3300005843 Ga0068860_100219942 Ga0068860_1002199422 412
194 3300006237 Ga0097621_100003726 Ga0097621_1000037267 412
195 3300006881 Ga0068865_100160334 Ga0068865_1001603342 412
196 3300006931 Ga0097620_100124788 Ga0097620_1001247882 412
197 3300009148 Ga0105243_10085067 Ga0105243_100850671 412
198 3300009176 Ga0105242_10046886 Ga0105242_100468864 412
199 3300025934 Ga0207686_10086903 Ga0207686_100869032 412
200 3300025938 Ga0207704_10123903 Ga0207704_101239032 412
201 3300026075 Ga0207708_10063153 Ga0207708_100631533 412
202 3300028381 Ga0268264_10145326 Ga0268264_101453262 412
203 3300037853 Ga0436364_0309246 Ga0436364_0309246_826_2106 412
204 3300005336 Ga0070680_100033863 Ga0070680_1000338633 413
205 3300005344 Ga0070661_100083718 Ga0070661_1000837181 413
206 3300005355 Ga0070671_100008609 Ga0070671_1000086098 413
207 3300005367 Ga0070667_100103614 Ga0070667_1001036141 413
208 3300005436 Ga0070713_100009588 Ga0070713_1000095886 413
209 3300005439 Ga0070711_100072866 Ga0070711_1000728662 413
210 3300005458 Ga0070681_10020212 Ga0070681_100202123 413
211 3300005530 Ga0070679_100000302 Ga0070679_10000030216 413
212 3300005535 Ga0070684_100002999 Ga0070684_1000029998 413
213 3300005577 Ga0068857_100006252 Ga0068857_1000062528 413
214 3300005578 Ga0068854_100134239 Ga0068854_1001342392 413
215 3300005618 Ga0068864_100079695 Ga0068864_1000796952 413
216 3300005841 Ga0068863_100011828 Ga0068863_1000118282 413
217 3300009093 Ga0105240_10007222 Ga0105240_1000722211 413
218 3300009093 Ga0105240_10033151 Ga0105240_100331513 413
219 3300009093 Ga0105240_10203544 Ga0105240_102035442 413
220 3300009174 Ga0105241_10001247 Ga0105241_100012476 413
221 3300009177 Ga0105248_10016708 Ga0105248_100167084 413
222 3300009545 Ga0105237_10014420 Ga0105237_100144205 413
223 3300009551 Ga0105238_10002827 Ga0105238_100028277 413
224 3300010375 Ga0105239_10004434 Ga0105239_1000443414 413
225 3300013104 Ga0157370_10002114 Ga0157370_1000211421 413
226 3300013104 Ga0157370_10004725 Ga0157370_100047255 413
227 3300013105 Ga0157369_10001335 Ga0157369_1000133512 413
228 3300013105 Ga0157369_10002554 Ga0157369_100025549 413
229 3300013307 Ga0157372_10011642 Ga0157372_100116422 413
230 3300013307 Ga0157372_10036761 Ga0157372_100367612 413
231 3300014325 Ga0163163_10015113 Ga0163163_100151132 413
232 3300014325 Ga0163163_10083430 Ga0163163_100834304 413
233 3300025911 Ga0207654_10014130 Ga0207654_100141304 413
234 3300025913 Ga0207695_10001695 Ga0207695_100016956 413
235 3300025941 Ga0207711_10049619 Ga0207711_100496193 413
236 3300025944 Ga0207661_10002821 Ga0207661_100028213 413
237 3300025949 Ga0207667_10007008 Ga0207667_1000700810 413
238 3300026078 Ga0207702_10006636 Ga0207702_100066368 413
239 3300026095 Ga0207676_10048217 Ga0207676_100482171 413
240 3300026116 Ga0207674_10001168 Ga0207674_1000116820 413
241 3300026121 Ga0207683_10224170 Ga0207683_102241702 413
242 3300033180 Ga0307510_10019637 Ga0307510_100196373 413
243 3300035118 Ga0373954_0006530 Ga0373954_0006530_502_1785 413
244 3300035724 Ga0373933_0026978 Ga0373933_0026978_417_1700 413
245 3300036401 Ga0373937_0013760 Ga0373937_0013760_4874_6157 413
246 3300036401 Ga0373937_0168037 Ga0373937_0168037_302_1585 413
247 3300046536 Ga0495587_0002050 Ga0495587_0002050_7543_8826 413
248 3300046557 Ga0495622_0084255 Ga0495622_0084255_182_1423 413
249 3300046689 Ga0495613_0035414 Ga0495613_0035414_72_1313 413
250 3300048088 Ga0495602_0015857 Ga0495602_0015857_4544_5827 413
251 3300048915 Ga0496112_0042492 Ga0496112_0042492_315_1556 413
252 3300055283 Ga0500661_000704 Ga0500661_000704_3258_4499 413
253 3300006237 Ga0097621_100079078 Ga0097621_1000790782 414
254 3300009177 Ga0105248_10108081 Ga0105248_101080812 414
255 3300046455 Ga0495603_0009323 Ga0495603_0009323_2903_4153 414
256 3300046471 Ga0495650_0000038 Ga0495650_0000038_269065_270315 414
257 3300046472 Ga0495580_0027425 Ga0495580_0027425_2064_3314 414
258 3300046492 Ga0495585_0110587 Ga0495585_0110587_106_1356 414
259 3300046523 Ga0495644_0000015 Ga0495644_0000015_33985_35235 414
260 3300046528 Ga0495642_0046036 Ga0495642_0046036_336_1613 414
261 3300046529 Ga0495652_0043218 Ga0495652_0043218_846_2090 414
262 3300046538 Ga0495609_0028253 Ga0495609_0028253_228_1478 414
263 3300046558 Ga0495633_0014425 Ga0495633_0014425_1534_2784 414
264 3300046648 Ga0495611_0064045 Ga0495611_0064045_76_1326 414
265 3300046660 Ga0495625_0090631 Ga0495625_0090631_87_1364 414
266 3300046684 Ga0495669_0000714 Ga0495669_0000714_657_1907 414
267 3300047469 Ga0495673_0040348 Ga0495673_0040348_41_1318 414
268 3300048917 Ga0496114_0053521 Ga0496114_0053521_704_1948 414
269 3300049460 Ga0495682_0024080 Ga0495682_0024080_557_1834 414
270 3300005530 Ga0070679_100003228 Ga0070679_1000032283 415
271 3300025921 Ga0207652_10002671 Ga0207652_1000267112 415
272 3300005439 Ga0070711_100111500 Ga0070711_1001115002 416
273 3300005535 Ga0070684_100065799 Ga0070684_1000657992 417
274 3300046475 Ga0495639_0001372 Ga0495639_0001372_703_1989 422
275 3300046516 Ga0495628_0080029 Ga0495628_0080029_73_1359 422
276 3300046517 Ga0495630_0078680 Ga0495630_0078680_452_1738 422
277 3300046529 Ga0495652_0003210 Ga0495652_0003210_227_1513 422
278 3300046543 Ga0495645_0120290 Ga0495645_0120290_232_1518 422
279 3300046559 Ga0495667_0049504 Ga0495667_0049504_350_1636 422
280 3300046678 Ga0495599_0020616 Ga0495599_0020616_2564_3850 422
281 3300046689 Ga0495613_0011937 Ga0495613_0011937_1257_2543 422
282 3300046690 Ga0495624_0017145 Ga0495624_0017145_1233_2519 422
283 3300046809 Ga0495600_0014488 Ga0495600_0014488_3609_4895 422
284 3300047315 Ga0495581_0002297 Ga0495581_0002297_9123_10409 422
285 3300047317 Ga0495604_0016033 Ga0495604_0016033_3430_4716 422
286 3300047321 Ga0495676_0021391 Ga0495676_0021391_130_1416 422
287 3300047471 Ga0495684_0026157 Ga0495684_0026157_2474_3760 422
288 3300028379 Ga0268266_10010586 Ga0268266_100105863 427
289 3300003320 rootH2_10061435 rootH2_100614356 434
290 3300005548 Ga0070665_100026142 Ga0070665_1000261421 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

67

463

0.92

PF07690

MFS_1

Major Facilitator Superfamily

79

423

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.8573 33 413
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8391 35 415
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8348 36 421
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.8315 33 413
7yub-assembly1.cif.gz_R s1p-bound human spns2 0.8272 33 414
ID Description Score Start End Superfamily
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9313 32 415 1.20.1250.20
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9151 32 415 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9144 29 224 1.20.1250.20
af_P9WJX9_6_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8959 35 215 1.20.1250.20
af_Q2FW71_4_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8951 38 417 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2E4JGV3-F1-model_v4 MFS transporter 0.9873 19 414 GO:0005886
GO:0022857
AF-A0A496RMH6-F1-model_v4 MFS transporter 0.983 27 417 GO:0005886
GO:0022857
AF-A0A7V9QCP5-F1-model_v4 MFS transporter 0.9793 26 417 GO:0005886
GO:0022857
AF-A0A3B9YCN6-F1-model_v4 MFS transporter 0.9781 21 418 GO:0005886
AF-A0A2T1BYJ3-F1-model_v4 MFS transporter 0.9778 29 414 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
83.55 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map