F389667

General Info

Members Datasets Scaffolds Average Seq Length
290 146 288 298

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10000137|Ga0068851_1000013720
Length 333
Sequence MRDFLCVSASLREQLTPCPLCEVISLYLASQMDWDSTIKGFISFLTLEKGLSGNSIEAYERDVRRMAMYFFNELKVSSPTKVDTVHIEKFLHVLHDLEISRRSQARNLSAMRSFFQYLILEDIIKADPTELVNGPKTDRYLPEVLTYEEIRQMIDAIDRSHPQGTRNVAIIETLYACGLRVSELTGLRISYVYPDLQMIRVIGKNNKERLVPIGDSALHHIRLYLESDRNRMMNIDPASADILFLNRRGKKLSRVMVFNIIKDAAAKAGITKVISPHSLRHSFATHLVEGGADLRAVQEMLGHSSITTTEIYTHMQADYLRETILRFHPLGKF

Samples

Sample ID Description Type Environment
1 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
2 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 0.34
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000012 3300002737 Bacteria 373191
2 rootH1_10024554 3300003316 Bacteria 8245
3 rootH2_10000327 3300003320 Bacteria 51947
4 rootH2_10049983 3300003320 Bacteria 6892
5 rootH1_10003212 3300003323 Bacteria 182359
6 rootH1_10013929 3300003316 Bacteria 4247
7 rootH1_10013929 3300003323 Bacteria 4559
8 rootH1_10071484 3300003323 Bacteria 3254
9 Ga0065714_10008115 3300005288 Bacteria 3585
10 Ga0070658_10000019 3300005327 Bacteria 194742
11 Ga0070658_10033716 3300005327 Bacteria 4120
12 Ga0070658_10038868 3300005327 Bacteria 3838
13 Ga0070658_10492658 3300005327 Bacteria 1058
14 Ga0070683_100045537 3300005329 Bacteria 4049
15 Ga0068869_100216412 3300005334 Bacteria 1516
16 Ga0070680_100027234 3300005336 Bacteria 4577
17 Ga0070680_100054070 3300005336 Bacteria 3278
18 Ga0070680_100442107 3300005336 Bacteria 1110
19 Ga0068868_100199731 3300005338 Bacteria 1666
20 Ga0070660_100010310 3300005339 Bacteria 6599
21 Ga0070660_100014508 3300005339 Bacteria 5679
22 Ga0070660_100037391 3300005339 Bacteria 3680
23 Ga0070660_100060714 3300005339 Bacteria 2935
24 Ga0070691_10032036 3300005341 Bacteria 2468
25 Ga0070671_100016765 3300005355 Bacteria 5924
26 Ga0070659_100000409 3300005366 Bacteria 32536
27 Ga0070659_100031130 3300005366 Bacteria 4132
28 Ga0070662_100000729 3300005457 Bacteria 20118
29 Ga0070681_10047599 3300005458 Bacteria 4287
30 Ga0070679_100000801 3300005530 Bacteria 27256
31 Ga0070679_100001606 3300005530 Bacteria 20303
32 Ga0070679_100109691 3300005530 Bacteria 2746
33 Ga0070684_100071606 3300005535 Bacteria 3051
34 Ga0068853_100020485 3300005539 Bacteria 5500
35 Ga0068853_100027819 3300005539 Bacteria 4754
36 Ga0068853_100062098 3300005539 Bacteria 3232
37 Ga0068853_100388500 3300005539 Bacteria 1304
38 Ga0070665_100000003 3300005548 Bacteria 811857
39 Ga0068855_100001020 3300005563 Bacteria 34917
40 Ga0068855_100002605 3300005563 Bacteria 22234
41 Ga0068855_100014677 3300005563 Bacteria 9435
42 Ga0068855_100014762 3300005563 Bacteria 9412
43 Ga0068856_100000262 3300005614 Bacteria 57470
44 Ga0068856_100001674 3300005614 Bacteria 23218
45 Ga0068856_100081627 3300005614 Bacteria 3208
46 Ga0068856_100353429 3300005614 Bacteria 1488
47 Ga0068852_100000326 3300005616 Bacteria 32458
48 Ga0068852_100009127 3300005616 Bacteria 7343
49 Ga0068852_100071272 3300005616 Bacteria 3051
50 Ga0068859_100049032 3300005617 Bacteria 4241
51 Ga0068864_100143746 3300005618 Bacteria 2154
52 Ga0068851_10000137 3300005834 Bacteria 39295
53 Ga0068870_10053624 3300005840 Bacteria 2142
54 Ga0068860_100021941 3300005843 Bacteria 6178
55 Ga0068862_100138548 3300005844 Bacteria 2158
56 Ga0097621_100000089 3300006237 Bacteria 49511
57 Ga0068871_100000216 3300006358 Bacteria 40288
58 Ga0068871_100004104 3300006358 Bacteria 10072
59 Ga0075431_100072696 3300006847 Bacteria 3549
60 Ga0068865_100206468 3300006881 Bacteria 1528
61 Ga0097620_100049034 3300006931 Bacteria 4241
62 Ga0105240_10011538 3300009093 Bacteria 12298
63 Ga0105240_10074534 3300009093 Bacteria 4189
64 Ga0105240_10094943 3300009093 Bacteria 3637
65 Ga0105240_10108160 3300009093 Bacteria 3369
66 Ga0105240_10295937 3300009093 Bacteria 1853
67 Ga0105240_10644603 3300009093 Bacteria 1162
68 Ga0111539_10253110 3300009094 Bacteria 2051
69 Ga0114129_10000120 3300009147 Bacteria 79454
70 Ga0105243_10282190 3300009148 Bacteria 1496
71 Ga0105241_10001103 3300009174 Bacteria 20558
72 Ga0105241_10005784 3300009174 Bacteria 9129
73 Ga0105241_10005856 3300009174 Bacteria 9074
74 Ga0105237_10000574 3300009545 Bacteria 51427
75 Ga0105237_10001914 3300009545 Bacteria 26581
76 Ga0105237_10072277 3300009545 Bacteria 3443
77 Ga0105237_10079349 3300009545 Bacteria 3272
78 Ga0105237_10491662 3300009545 Bacteria 1233
79 Ga0105238_10010541 3300009551 Bacteria 9281
80 Ga0105249_10074563 3300009553 Bacteria 3141
81 Ga0105239_10000013 3300010375 Bacteria 327371
82 Ga0105239_10000117 3300010375 Bacteria 112291
83 Ga0105239_10000139 3300010375 Bacteria 102090
84 Ga0105239_10012009 3300010375 Bacteria 9659
85 Ga0105239_10197560 3300010375 Bacteria 2253
86 Ga0105239_10204695 3300010375 Bacteria 2211
87 Ga0105239_10392651 3300010375 Unclassified 1570
88 Ga0157373_10003960 3300013100 Bacteria 11180
89 Ga0157373_10030700 3300013100 Bacteria 3867
90 Ga0157371_10001543 3300013102 Bacteria 23683
91 Ga0157371_10008320 3300013102 Bacteria 8282
92 Ga0157371_10017353 3300013102 Bacteria 5351
93 Ga0157371_10019038 3300013102 Bacteria 5068
94 Ga0157370_10001635 3300013104 Bacteria 27664
95 Ga0157370_10012352 3300013104 Bacteria 8862
96 Ga0157370_10047578 3300013104 Bacteria 4111
97 Ga0157370_10296100 3300013104 Bacteria 1494
98 Ga0157370_10305718 3300013104 Bacteria 1468
99 Ga0157369_10008216 3300013105 Bacteria 11969
100 Ga0157369_10011272 3300013105 Bacteria 10157
101 Ga0157369_10084632 3300013105 Bacteria 3390
102 Ga0157374_10001372 3300013296 Bacteria 20693
103 Ga0157374_10001374 3300013296 Bacteria 20684
104 Ga0157374_10008308 3300013296 Bacteria 8857
105 Ga0157374_10122973 3300013296 Bacteria 2506
106 Ga0157374_10445991 3300013296 Bacteria 1295
107 Ga0157378_10036644 3300013297 Bacteria 4340
108 Ga0163162_10000058 3300013306 Bacteria 108298
109 Ga0163162_10122919 3300013306 Bacteria 2701
110 Ga0157372_10000181 3300013307 Bacteria 69472
111 Ga0157372_10008938 3300013307 Bacteria 10647
112 Ga0157372_10015721 3300013307 Bacteria 8116
113 Ga0157372_10413239 3300013307 Bacteria 1572
114 Ga0157372_10623711 3300013307 Bacteria 1256
115 Ga0209437_100041 3300025233 Bacteria 444465
116 Ga0209233_1002793 3300025261 Bacteria 6275
117 Ga0207656_10001184 3300025321 Bacteria 8595
118 Ga0207642_10089938 3300025899 Bacteria 1514
119 Ga0207647_10000063 3300025904 Bacteria 83442
120 Ga0207647_10003913 3300025904 Bacteria 11123
121 Ga0207705_10000069 3300025909 Bacteria 133094
122 Ga0207705_10012153 3300025909 Bacteria 6222
123 Ga0207705_10037333 3300025909 Bacteria 3476
124 Ga0207654_10006276 3300025911 Bacteria 5975
125 Ga0207695_10001774 3300025913 Bacteria 34048
126 Ga0207695_10008676 3300025913 Bacteria 12683
127 Ga0207695_10065902 3300025913 Bacteria 3722
128 Ga0207695_10158774 3300025913 Bacteria 2194
129 Ga0207695_10455369 3300025913 Bacteria 1162
130 Ga0207671_10005361 3300025914 Bacteria 11857
131 Ga0207671_10061029 3300025914 Bacteria 2797
132 Ga0207671_10099923 3300025914 Bacteria 2196
133 Ga0207660_10010115 3300025917 Bacteria 6110
134 Ga0207660_10040042 3300025917 Bacteria 3279
135 Ga0207657_10031431 3300025919 Bacteria 4809
136 Ga0207657_10082033 3300025919 Bacteria 2707
137 Ga0207657_10344367 3300025919 Bacteria 1176
138 Ga0207652_10002352 3300025921 Bacteria 15994
139 Ga0207652_10007343 3300025921 Bacteria 8884
140 Ga0207694_10185425 3300025924 Bacteria 1689
141 Ga0207644_10006730 3300025931 Bacteria 7489
142 Ga0207690_10000317 3300025932 Bacteria 32562
143 Ga0207690_10170255 3300025932 Bacteria 1631
144 Ga0207706_10001974 3300025933 Bacteria 20125
145 Ga0207706_10059807 3300025933 Bacteria 3355
146 Ga0207665_10231822 3300025939 Bacteria 1357
147 Ga0207689_10051333 3300025942 Bacteria 3399
148 Ga0207667_10000896 3300025949 Bacteria 37967
149 Ga0207667_10011470 3300025949 Bacteria 10296
150 Ga0207667_10017492 3300025949 Bacteria 8067
151 Ga0207667_10042050 3300025949 Bacteria 4860
152 Ga0207667_10067439 3300025949 Bacteria 3727
153 Ga0207667_10074489 3300025949 Bacteria 3527
154 Ga0207639_10101131 3300026041 Bacteria 2330
155 Ga0207639_10111428 3300026041 Bacteria 2231
156 Ga0207639_10379111 3300026041 Bacteria 1270
157 Ga0207702_10000492 3300026078 Bacteria 44456
158 Ga0207702_10225692 3300026078 Bacteria 1748
159 Ga0207648_10195755 3300026089 Bacteria 1792
160 Ga0207674_10081038 3300026116 Bacteria 3248
161 Ga0207675_100401724 3300026118 Bacteria 1350
162 Ga0207698_10008847 3300026142 Bacteria 6384
163 Ga0207698_10008954 3300026142 Bacteria 6351
164 Ga0268266_10000078 3300028379 Bacteria 213632
165 Ga0268265_10297105 3300028380 Bacteria 1452
166 Ga0265334_10061641 3300028573 Bacteria 1413
167 Ga0307511_10000122 3300030521 Bacteria 70869
168 Ga0265316_10011459 3300031344 Bacteria 7995
169 Ga0316579_10047009 3300031691 Bacteria 2015
170 Ga0316579_10057401 3300031691 Unclassified 1829
171 Ga0265314_10084190 3300031711 Bacteria 2088
172 Ga0265314_10225890 3300031711 Bacteria 1089
173 Ga0316576_10099146 3300031727 Bacteria 2176
174 Ga0316578_10001598 3300031728 Bacteria 9350
175 Ga0307406_10380238 3300031901 Bacteria 1113
176 Ga0307510_10245459 3300033180 Bacteria 1282
177 Ga0316584_0009791 3300036712 Bacteria 6671
178 Ga0316584_0092762 3300036712 Bacteria 2261
179 Ga0373925_0260824 3300037068 Bacteria 1392
180 Ga0395899_0018676 3300037312 Bacteria 5269
181 Ga0395899_0030241 3300037312 Bacteria 4074
182 Ga0395899_0076045 3300037312 Bacteria 2451
183 Ga0395900_0000501 3300037418 Bacteria 55054
184 Ga0395900_0006437 3300037418 Bacteria 12240
185 Ga0395900_0059951 3300037418 Bacteria 3917
186 Ga0395898_0317221 3300037466 Unclassified 1487
187 Ga0395905_0004006 3300037471 Bacteria 15480
188 Ga0395905_0007115 3300037471 Bacteria 11181
189 Ga0316581_0033186 3300037588 Bacteria 1559
190 Ga0395901_0023984 3300038443 Bacteria 6258
191 Ga0395901_0037687 3300038443 Bacteria 5000
192 Ga0395901_0143424 3300038443 Bacteria 2510
193 Ga0395901_0443821 3300038443 Bacteria 1328
194 Ga0439448_0003579 3300042005 Bacteria 4317
195 Ga0439456_009137 3300042013 Bacteria 2047
196 Ga0451577_0000291 3300042876 Bacteria 97511
197 Ga0451577_0000565 3300042876 Bacteria 60301
198 Ga0451577_0291998 3300042876 Unclassified 1477
199 Ga0451577_0322753 3300042876 Bacteria 1400
200 Ga0451577_0371602 3300042876 Bacteria 1297
201 Ga0466969_0175458 3300044656 Bacteria 982
202 Ga0453683_0000055 3300044673 Bacteria 192588
203 Ga0453683_0000072 3300044673 Bacteria 154688
204 Ga0453683_0017097 3300044673 Bacteria 4676
205 Ga0453683_0076728 3300044673 Bacteria 2092
206 Ga0453683_0266245 3300044673 Unclassified 1093
207 Ga0453684_0001781 3300044712 Bacteria 57459
208 Ga0453684_0010277 3300044712 Bacteria 16028
209 Ga0453684_0021207 3300044712 Bacteria 9725
210 Ga0453684_0049452 3300044712 Bacteria 5545
211 Ga0453684_0144561 3300044712 Bacteria 2835
212 Ga0453684_0292442 3300044712 Bacteria 1854
213 Ga0453684_0427783 3300044712 Unclassified 1478
214 Ga0453684_0588759 3300044712 Bacteria 1221
215 Ga0451576_0000991 3300045051 Bacteria 52576
216 Ga0451576_0002219 3300045051 Bacteria 29870
217 Ga0451576_0002269 3300045051 Bacteria 29343
218 Ga0451576_0033955 3300045051 Bacteria 5419
219 Ga0451576_0055270 3300045051 Bacteria 4154
220 Ga0495650_0029997 3300046471 Bacteria 2470
221 Ga0495606_0027032 3300046507 Bacteria 4076
222 Ga0495616_0046610 3300046513 Bacteria 2187
223 Ga0495625_0022234 3300046660 Bacteria 4866
224 Ga0495661_0000244 3300046665 Bacteria 62633
225 Ga0495686_0000106 3300047472 Bacteria 175852
226 Ga0495686_0003562 3300047472 Bacteria 13388
227 Ga0495686_0028628 3300047472 Bacteria 3628
228 Ga0495686_0163268 3300047472 Bacteria 1300
229 Ga0496115_0238750 3300048918 Bacteria 1498
230 Ga0495678_024090 3300049459 Bacteria 2634
231 Ga0501033_0092782 3300049570 Bacteria 2208
232 Ga0501034_0000043 3300049571 Bacteria 229049
233 Ga0501034_0058874 3300049571 Bacteria 3859
234 Ga0501034_0073740 3300049571 Bacteria 3422
235 Ga0501034_0082605 3300049571 Bacteria 3214
236 Ga0501036_0000122 3300049572 Bacteria 48784
237 Ga0501036_0119895 3300049572 Bacteria 2222
238 Ga0501037_0117120 3300049573 Bacteria 1917
239 Ga0501038_0007490 3300049574 Bacteria 10067
240 Ga0501038_0051149 3300049574 Bacteria 3568
241 Ga0501039_0007512 3300049575 Bacteria 8324
242 Ga0501039_0073742 3300049575 Bacteria 2652
243 Ga0501039_0179122 3300049575 Bacteria 1667
244 Ga0501040_0000379 3300049576 Bacteria 26179
245 Ga0501040_0137385 3300049576 Bacteria 1721
246 Ga0501041_0001121 3300049577 Bacteria 14690
247 Ga0501041_0030161 3300049577 Bacteria 3273
248 Ga0501042_0008895 3300049578 Bacteria 6660
249 Ga0501042_0024438 3300049578 Bacteria 4238
250 Ga0501042_0226274 3300049578 Bacteria 1349
251 Ga0501047_0071162 3300049581 Bacteria 3348
252 Ga0501048_0005356 3300049582 Bacteria 9758
253 Ga0501068_0002088 3300049584 Bacteria 10653
254 Ga0501071_0000016 3300049587 Bacteria 56789
255 Ga0501071_0261559 3300049587 Bacteria 1307
256 Ga0501072_0001492 3300049588 Bacteria 17529
257 Ga0501072_0005767 3300049588 Bacteria 9425
258 Ga0501072_0008319 3300049588 Bacteria 7880
259 Ga0501074_0028699 3300049590 Bacteria 4033
260 Ga0501075_0000774 3300049591 Bacteria 19960
261 Ga0501075_0018709 3300049591 Bacteria 5017
262 Ga0501075_0162074 3300049591 Bacteria 1706
263 Ga0501076_0000617 3300049592 Bacteria 22782
264 Ga0501076_0003090 3300049592 Bacteria 11594
265 Ga0501077_0024814 3300049593 Bacteria 3807
266 Ga0501077_0187095 3300049593 Bacteria 1316
267 Ga0501219_000616 3300049703 Bacteria 5116
268 Ga0501079_0002256 3300049741 Bacteria 13905
269 Ga0501079_0151202 3300049741 Bacteria 1810
270 Ga0501080_0000372 3300049742 Bacteria 34540
271 Ga0501081_0000072 3300049743 Bacteria 39157
272 Ga0501081_0003594 3300049743 Bacteria 9920
273 Ga0501241_001340 3300049758 Bacteria 5073
274 Ga0501035_0027211 3300049822 Bacteria 5227
275 Ga0501044_0024919 3300049823 Bacteria 6344
276 Ga0501044_0115504 3300049823 Bacteria 2689
277 Ga0501044_0372126 3300049823 Bacteria 1345
278 Ga0501045_0003949 3300049824 Bacteria 10204
279 Ga0501284_00127 3300050005 Bacteria 11013
280 nmdc:mga0k408_279784_c1 3300050493 Bacteria 996
281 nmdc:mga05p37_3379_c1 3300050507 Bacteria 18626
282 Ga0500624_000449 3300053157 Bacteria 12370
283 Ga0501084_0018534 3300054114 Bacteria 5793
284 Ga0501084_0018583 3300054114 Bacteria 5785
285 Ga0501082_0000834 3300060353 Bacteria 27112
286 Ga0501082_0003120 3300060353 Bacteria 14450
287 Ga0530510_0000010 3300061734 Bacteria 155647
288 Ga0530510_0005286 3300061734 Bacteria 8919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0033186 Ga0316581_0033186_770_1519 245
2 3300044656 Ga0466969_0175458 Ga0466969_0175458_168_938 255
3 3300006881 Ga0068865_100206468 Ga0068865_1002064682 261
4 3300025899 Ga0207642_10089938 Ga0207642_100899382 261
5 3300026118 Ga0207675_100401724 Ga0207675_1004017242 261
6 3300042876 Ga0451577_0291998 Ga0451577_0291998_659_1444 261
7 3300044673 Ga0453683_0000055 Ga0453683_0000055_104603_105388 261
8 3300044712 Ga0453684_0049452 Ga0453684_0049452_680_1465 261
9 3300006358 Ga0068871_100004104 Ga0068871_1000041043 265
10 3300044712 Ga0453684_0588759 Ga0453684_0588759_413_1210 265
11 3300031901 Ga0307406_10380238 Ga0307406_103802382 276
12 3300031691 Ga0316579_10057401 Ga0316579_100574012 277
13 3300031691 Ga0316579_10047009 Ga0316579_100470092 279
14 3300013307 Ga0157372_10413239 Ga0157372_104132391 281
15 3300038443 Ga0395901_0143424 Ga0395901_0143424_1633_2487 284
16 3300047472 Ga0495686_0028628 Ga0495686_0028628_759_1613 284
17 3300049570 Ga0501033_0092782 Ga0501033_0092782_382_1290 284
18 3300049572 Ga0501036_0000122 Ga0501036_0000122_23443_24351 284
19 3300049573 Ga0501037_0117120 Ga0501037_0117120_215_1123 284
20 3300049574 Ga0501038_0007490 Ga0501038_0007490_5478_6386 284
21 3300049575 Ga0501039_0007512 Ga0501039_0007512_4817_5725 284
22 3300049576 Ga0501040_0000379 Ga0501040_0000379_7494_8402 284
23 3300049577 Ga0501041_0001121 Ga0501041_0001121_6639_7547 284
24 3300049578 Ga0501042_0008895 Ga0501042_0008895_937_1845 284
25 3300049582 Ga0501048_0005356 Ga0501048_0005356_2257_3165 284
26 3300049584 Ga0501068_0002088 Ga0501068_0002088_3490_4398 284
27 3300049587 Ga0501071_0000016 Ga0501071_0000016_37180_38088 284
28 3300049588 Ga0501072_0001492 Ga0501072_0001492_14637_15545 284
29 3300049591 Ga0501075_0018709 Ga0501075_0018709_1310_2218 284
30 3300049592 Ga0501076_0003090 Ga0501076_0003090_342_1250 284
31 3300049741 Ga0501079_0002256 Ga0501079_0002256_12696_13604 284
32 3300049742 Ga0501080_0000372 Ga0501080_0000372_24393_25301 284
33 3300049743 Ga0501081_0000072 Ga0501081_0000072_20199_21107 284
34 3300049823 Ga0501044_0372126 Ga0501044_0372126_47_955 284
35 3300049824 Ga0501045_0003949 Ga0501045_0003949_6566_7474 284
36 3300054114 Ga0501084_0018534 Ga0501084_0018534_4689_5597 284
37 3300060353 Ga0501082_0000834 Ga0501082_0000834_8577_9485 284
38 3300049577 Ga0501041_0030161 Ga0501041_0030161_1917_2825 285
39 3300049578 Ga0501042_0024438 Ga0501042_0024438_459_1367 285
40 3300049588 Ga0501072_0005767 Ga0501072_0005767_7411_8319 285
41 3300049591 Ga0501075_0000774 Ga0501075_0000774_1180_2088 285
42 3300049592 Ga0501076_0000617 Ga0501076_0000617_17846_18754 285
43 3300049593 Ga0501077_0024814 Ga0501077_0024814_2696_3604 285
44 3300049743 Ga0501081_0003594 Ga0501081_0003594_5254_6162 285
45 3300061734 Ga0530510_0000010 Ga0530510_0000010_18832_19740 285
46 3300031344 Ga0265316_10011459 Ga0265316_100114594 288
47 3300049574 Ga0501038_0051149 Ga0501038_0051149_1336_2244 288
48 3300049578 Ga0501042_0226274 Ga0501042_0226274_134_1042 288
49 3300049593 Ga0501077_0187095 Ga0501077_0187095_307_1215 288
50 3300049741 Ga0501079_0151202 Ga0501079_0151202_647_1555 288
51 iso_pu_bacteria 2883068021 2883068589 290
52 3300013105 Ga0157369_10008216 Ga0157369_100082164 292
53 3300006847 Ga0075431_100072696 Ga0075431_1000726963 295
54 3300009094 Ga0111539_10253110 Ga0111539_102531102 295
55 3300009147 Ga0114129_10000120 Ga0114129_1000012014 295
56 3300025933 Ga0207706_10059807 Ga0207706_100598072 295
57 3300042013 Ga0439456_009137 Ga0439456_009137_501_1409 295
58 3300049575 Ga0501039_0073742 Ga0501039_0073742_1066_1974 295
59 3300049576 Ga0501040_0137385 Ga0501040_0137385_346_1254 295
60 3300049587 Ga0501071_0261559 Ga0501071_0261559_117_1025 295
61 3300049588 Ga0501072_0008319 Ga0501072_0008319_244_1152 295
62 3300049590 Ga0501074_0028699 Ga0501074_0028699_2406_3314 295
63 3300049591 Ga0501075_0162074 Ga0501075_0162074_472_1380 295
64 3300050507 nmdc:mga05p37_3379_c1 nmdc:mga05p37_3379_c1_15992_16897 295
65 3300054114 Ga0501084_0018583 Ga0501084_0018583_4367_5275 295
66 3300060353 Ga0501082_0003120 Ga0501082_0003120_580_1488 295
67 3300061734 Ga0530510_0005286 Ga0530510_0005286_5848_6756 295
68 iso_pu_bacteria 2839989709 2839989759 295
69 iso_pu_bacteria 2919437846 2919439200 295
70 3300031728 Ga0316578_10001598 Ga0316578_100015983 296
71 3300036712 Ga0316584_0009791 Ga0316584_0009791_3253_4161 296
72 3300042876 Ga0451577_0371602 Ga0451577_0371602_17_916 296
73 3300044673 Ga0453683_0000072 Ga0453683_0000072_8193_9092 296
74 3300044673 Ga0453683_0017097 Ga0453683_0017097_1505_2404 296
75 3300044673 Ga0453683_0266245 Ga0453683_0266245_111_1016 296
76 3300044712 Ga0453684_0010277 Ga0453684_0010277_9350_10252 296
77 3300044712 Ga0453684_0144561 Ga0453684_0144561_475_1374 296
78 3300045051 Ga0451576_0002219 Ga0451576_0002219_8342_9241 296
79 3300045051 Ga0451576_0002269 Ga0451576_0002269_8184_9083 296
80 3300003316 rootH1_10024554 rootH1_100245544 297
81 3300005327 Ga0070658_10000019 Ga0070658_10000019112 297
82 3300005539 Ga0068853_100027819 Ga0068853_1000278193 297
83 3300005563 Ga0068855_100014762 Ga0068855_1000147628 297
84 3300005614 Ga0068856_100001674 Ga0068856_10000167413 297
85 3300013104 Ga0157370_10296100 Ga0157370_102961002 297
86 3300013296 Ga0157374_10008308 Ga0157374_100083083 297
87 3300013296 Ga0157374_10445991 Ga0157374_104459912 297
88 3300013297 Ga0157378_10036644 Ga0157378_100366445 297
89 3300025909 Ga0207705_10000069 Ga0207705_10000069114 297
90 3300025949 Ga0207667_10074489 Ga0207667_100744892 297
91 3300026041 Ga0207639_10111428 Ga0207639_101114282 297
92 3300037312 Ga0395899_0030241 Ga0395899_0030241_2995_3888 297
93 3300037418 Ga0395900_0000501 Ga0395900_0000501_39503_40396 297
94 3300037466 Ga0395898_0317221 Ga0395898_0317221_333_1226 297
95 3300037471 Ga0395905_0004006 Ga0395905_0004006_12784_13677 297
96 3300003320 rootH2_10000327 rootH2_100003275 298
97 3300003320 rootH2_10049983 rootH2_100499835 298
98 3300005327 Ga0070658_10033716 Ga0070658_100337162 298
99 3300005327 Ga0070658_10038868 Ga0070658_100388684 298
100 3300005334 Ga0068869_100216412 Ga0068869_1002164121 298
101 3300005336 Ga0070680_100054070 Ga0070680_1000540703 298
102 3300005336 Ga0070680_100442107 Ga0070680_1004421072 298
103 3300005339 Ga0070660_100010310 Ga0070660_1000103102 298
104 3300005339 Ga0070660_100037391 Ga0070660_1000373912 298
105 3300005341 Ga0070691_10032036 Ga0070691_100320362 298
106 3300005530 Ga0070679_100000801 Ga0070679_10000080124 298
107 3300005530 Ga0070679_100109691 Ga0070679_1001096912 298
108 3300005535 Ga0070684_100071606 Ga0070684_1000716063 298
109 3300005539 Ga0068853_100062098 Ga0068853_1000620982 298
110 3300005563 Ga0068855_100002605 Ga0068855_10000260517 298
111 3300005614 Ga0068856_100081627 Ga0068856_1000816272 298
112 3300005614 Ga0068856_100353429 Ga0068856_1003534292 298
113 3300005616 Ga0068852_100009127 Ga0068852_1000091278 298
114 3300005617 Ga0068859_100049032 Ga0068859_1000490324 298
115 3300005618 Ga0068864_100143746 Ga0068864_1001437462 298
116 3300005843 Ga0068860_100021941 Ga0068860_1000219413 298
117 3300005844 Ga0068862_100138548 Ga0068862_1001385481 298
118 3300006931 Ga0097620_100049034 Ga0097620_1000490344 298
119 3300009148 Ga0105243_10282190 Ga0105243_102821902 298
120 3300009174 Ga0105241_10005784 Ga0105241_100057847 298
121 3300009545 Ga0105237_10072277 Ga0105237_100722773 298
122 3300010375 Ga0105239_10392651 Ga0105239_103926512 298
123 3300013102 Ga0157371_10001543 Ga0157371_1000154319 298
124 3300013102 Ga0157371_10008320 Ga0157371_100083206 298
125 3300013102 Ga0157371_10017353 Ga0157371_100173532 298
126 3300013104 Ga0157370_10001635 Ga0157370_1000163524 298
127 3300013104 Ga0157370_10012352 Ga0157370_100123528 298
128 3300013105 Ga0157369_10011272 Ga0157369_100112727 298
129 3300013296 Ga0157374_10122973 Ga0157374_101229732 298
130 3300013306 Ga0163162_10122919 Ga0163162_101229193 298
131 3300013307 Ga0157372_10015721 Ga0157372_100157215 298
132 3300025909 Ga0207705_10012153 Ga0207705_100121531 298
133 3300025909 Ga0207705_10037333 Ga0207705_100373334 298
134 3300025913 Ga0207695_10065902 Ga0207695_100659023 298
135 3300025917 Ga0207660_10040042 Ga0207660_100400421 298
136 3300025919 Ga0207657_10031431 Ga0207657_100314315 298
137 3300025919 Ga0207657_10344367 Ga0207657_103443671 298
138 3300025921 Ga0207652_10002352 Ga0207652_100023526 298
139 3300025942 Ga0207689_10051333 Ga0207689_100513332 298
140 3300025949 Ga0207667_10011470 Ga0207667_100114703 298
141 3300025949 Ga0207667_10042050 Ga0207667_100420503 298
142 3300026041 Ga0207639_10379111 Ga0207639_103791111 298
143 3300026089 Ga0207648_10195755 Ga0207648_101957552 298
144 3300026142 Ga0207698_10008847 Ga0207698_100088473 298
145 3300028380 Ga0268265_10297105 Ga0268265_102971051 298
146 3300030521 Ga0307511_10000122 Ga0307511_1000012245 298
147 3300031711 Ga0265314_10084190 Ga0265314_100841902 298
148 3300033180 Ga0307510_10245459 Ga0307510_102454592 298
149 3300036712 Ga0316584_0092762 Ga0316584_0092762_1211_2116 298
150 3300037068 Ga0373925_0260824 Ga0373925_0260824_120_1025 298
151 3300037312 Ga0395899_0076045 Ga0395899_0076045_698_1603 298
152 3300038443 Ga0395901_0023984 Ga0395901_0023984_2951_3856 298
153 3300048918 Ga0496115_0238750 Ga0496115_0238750_414_1313 298
154 3300049571 Ga0501034_0000043 Ga0501034_0000043_80228_81133 298
155 3300049571 Ga0501034_0058874 Ga0501034_0058874_661_1566 298
156 3300049571 Ga0501034_0073740 Ga0501034_0073740_2438_3337 298
157 3300049571 Ga0501034_0082605 Ga0501034_0082605_2183_3088 298
158 3300049572 Ga0501036_0119895 Ga0501036_0119895_741_1646 298
159 3300049575 Ga0501039_0179122 Ga0501039_0179122_76_981 298
160 3300049581 Ga0501047_0071162 Ga0501047_0071162_1907_2812 298
161 3300049703 Ga0501219_000616 Ga0501219_000616_837_1745 298
162 3300049758 Ga0501241_001340 Ga0501241_001340_793_1701 298
163 3300049822 Ga0501035_0027211 Ga0501035_0027211_3285_4190 298
164 3300049823 Ga0501044_0024919 Ga0501044_0024919_2268_3173 298
165 3300049823 Ga0501044_0115504 Ga0501044_0115504_296_1195 298
166 3300050005 Ga0501284_00127 Ga0501284_00127_6699_7607 298
167 3300002737 JGI25162J39368_1000012 JGI25162J39368_100001282 299
168 3300003323 rootH1_10003212 rootH1_1000321272 299
169 3300003323 rootH1_10013929 rootH1_100139292 299
170 3300003323 rootH1_10071484 rootH1_100714843 299
171 3300005288 Ga0065714_10008115 Ga0065714_100081153 299
172 3300005327 Ga0070658_10492658 Ga0070658_104926581 299
173 3300005329 Ga0070683_100045537 Ga0070683_1000455374 299
174 3300005336 Ga0070680_100027234 Ga0070680_1000272343 299
175 3300005338 Ga0068868_100199731 Ga0068868_1001997312 299
176 3300005339 Ga0070660_100014508 Ga0070660_1000145084 299
177 3300005339 Ga0070660_100060714 Ga0070660_1000607144 299
178 3300005355 Ga0070671_100016765 Ga0070671_1000167653 299
179 3300005366 Ga0070659_100000409 Ga0070659_1000004095 299
180 3300005366 Ga0070659_100031130 Ga0070659_1000311302 299
181 3300005457 Ga0070662_100000729 Ga0070662_1000007291 299
182 3300005458 Ga0070681_10047599 Ga0070681_100475992 299
183 3300005530 Ga0070679_100001606 Ga0070679_1000016064 299
184 3300005539 Ga0068853_100020485 Ga0068853_1000204853 299
185 3300005539 Ga0068853_100388500 Ga0068853_1003885002 299
186 3300005548 Ga0070665_100000003 Ga0070665_100000003372 299
187 3300005563 Ga0068855_100001020 Ga0068855_10000102031 299
188 3300005563 Ga0068855_100014677 Ga0068855_10001467710 299
189 3300005614 Ga0068856_100000262 Ga0068856_10000026232 299
190 3300005616 Ga0068852_100000326 Ga0068852_10000032610 299
191 3300005616 Ga0068852_100071272 Ga0068852_1000712724 299
192 3300005834 Ga0068851_10000137 Ga0068851_1000013720 299
193 3300005840 Ga0068870_10053624 Ga0068870_100536243 299
194 3300006237 Ga0097621_100000089 Ga0097621_1000000894 299
195 3300006358 Ga0068871_100000216 Ga0068871_10000021637 299
196 3300009093 Ga0105240_10011538 Ga0105240_1001153815 299
197 3300009093 Ga0105240_10074534 Ga0105240_100745343 299
198 3300009093 Ga0105240_10094943 Ga0105240_100949433 299
199 3300009093 Ga0105240_10108160 Ga0105240_101081604 299
200 3300009093 Ga0105240_10295937 Ga0105240_102959371 299
201 3300009093 Ga0105240_10644603 Ga0105240_106446031 299
202 3300009174 Ga0105241_10001103 Ga0105241_1000110320 299
203 3300009174 Ga0105241_10005856 Ga0105241_100058565 299
204 3300009545 Ga0105237_10000574 Ga0105237_100005747 299
205 3300009545 Ga0105237_10001914 Ga0105237_1000191413 299
206 3300009545 Ga0105237_10079349 Ga0105237_100793493 299
207 3300009545 Ga0105237_10491662 Ga0105237_104916621 299
208 3300009551 Ga0105238_10010541 Ga0105238_1001054110 299
209 3300009553 Ga0105249_10074563 Ga0105249_100745632 299
210 3300010375 Ga0105239_10000013 Ga0105239_1000001320 299
211 3300010375 Ga0105239_10000117 Ga0105239_1000011756 299
212 3300010375 Ga0105239_10000139 Ga0105239_1000013942 299
213 3300010375 Ga0105239_10012009 Ga0105239_1001200911 299
214 3300010375 Ga0105239_10197560 Ga0105239_101975603 299
215 3300010375 Ga0105239_10204695 Ga0105239_102046952 299
216 3300013100 Ga0157373_10003960 Ga0157373_100039609 299
217 3300013100 Ga0157373_10030700 Ga0157373_100307002 299
218 3300013102 Ga0157371_10019038 Ga0157371_100190383 299
219 3300013104 Ga0157370_10047578 Ga0157370_100475781 299
220 3300013104 Ga0157370_10305718 Ga0157370_103057181 299
221 3300013105 Ga0157369_10084632 Ga0157369_100846324 299
222 3300013296 Ga0157374_10001372 Ga0157374_1000137220 299
223 3300013296 Ga0157374_10001374 Ga0157374_1000137420 299
224 3300013306 Ga0163162_10000058 Ga0163162_1000005874 299
225 3300013307 Ga0157372_10000181 Ga0157372_1000018142 299
226 3300013307 Ga0157372_10008938 Ga0157372_100089383 299
227 3300013307 Ga0157372_10623711 Ga0157372_106237112 299
228 3300025233 Ga0209437_100041 Ga0209437_100041127 299
229 3300025261 Ga0209233_1002793 Ga0209233_10027934 299
230 3300025321 Ga0207656_10001184 Ga0207656_100011848 299
231 3300025904 Ga0207647_10000063 Ga0207647_1000006351 299
232 3300025904 Ga0207647_10003913 Ga0207647_100039131 299
233 3300025911 Ga0207654_10006276 Ga0207654_100062764 299
234 3300025913 Ga0207695_10001774 Ga0207695_1000177430 299
235 3300025913 Ga0207695_10008676 Ga0207695_100086763 299
236 3300025913 Ga0207695_10158774 Ga0207695_101587743 299
237 3300025913 Ga0207695_10455369 Ga0207695_104553691 299
238 3300025914 Ga0207671_10005361 Ga0207671_100053619 299
239 3300025914 Ga0207671_10061029 Ga0207671_100610292 299
240 3300025914 Ga0207671_10099923 Ga0207671_100999231 299
241 3300025917 Ga0207660_10010115 Ga0207660_100101153 299
242 3300025919 Ga0207657_10082033 Ga0207657_100820333 299
243 3300025921 Ga0207652_10007343 Ga0207652_100073438 299
244 3300025924 Ga0207694_10185425 Ga0207694_101854252 299
245 3300025931 Ga0207644_10006730 Ga0207644_100067305 299
246 3300025932 Ga0207690_10000317 Ga0207690_100003175 299
247 3300025932 Ga0207690_10170255 Ga0207690_101702552 299
248 3300025933 Ga0207706_10001974 Ga0207706_1000197419 299
249 3300025939 Ga0207665_10231822 Ga0207665_102318222 299
250 3300025949 Ga0207667_10000896 Ga0207667_1000089619 299
251 3300025949 Ga0207667_10017492 Ga0207667_100174926 299
252 3300025949 Ga0207667_10067439 Ga0207667_100674393 299
253 3300026041 Ga0207639_10101131 Ga0207639_101011313 299
254 3300026078 Ga0207702_10000492 Ga0207702_1000049215 299
255 3300026078 Ga0207702_10225692 Ga0207702_102256922 299
256 3300026116 Ga0207674_10081038 Ga0207674_100810385 299
257 3300026142 Ga0207698_10008954 Ga0207698_100089543 299
258 3300028379 Ga0268266_10000078 Ga0268266_10000078162 299
259 3300028573 Ga0265334_10061641 Ga0265334_100616412 299
260 3300031711 Ga0265314_10225890 Ga0265314_102258901 299
261 3300031727 Ga0316576_10099146 Ga0316576_100991462 299
262 3300037312 Ga0395899_0018676 Ga0395899_0018676_3393_4292 299
263 3300037418 Ga0395900_0006437 Ga0395900_0006437_5600_6499 299
264 3300037418 Ga0395900_0059951 Ga0395900_0059951_2777_3679 299
265 3300037471 Ga0395905_0007115 Ga0395905_0007115_9559_10458 299
266 3300038443 Ga0395901_0037687 Ga0395901_0037687_2810_3709 299
267 3300038443 Ga0395901_0443821 Ga0395901_0443821_255_1154 299
268 3300042005 Ga0439448_0003579 Ga0439448_0003579_1115_2014 299
269 3300042876 Ga0451577_0000291 Ga0451577_0000291_27917_28912 299
270 3300042876 Ga0451577_0000565 Ga0451577_0000565_25721_26620 299
271 3300042876 Ga0451577_0322753 Ga0451577_0322753_287_1186 299
272 3300044673 Ga0453683_0076728 Ga0453683_0076728_641_1540 299
273 3300044712 Ga0453684_0001781 Ga0453684_0001781_30840_31739 299
274 3300044712 Ga0453684_0021207 Ga0453684_0021207_2420_3415 299
275 3300044712 Ga0453684_0292442 Ga0453684_0292442_447_1346 299
276 3300044712 Ga0453684_0427783 Ga0453684_0427783_269_1171 299
277 3300045051 Ga0451576_0000991 Ga0451576_0000991_25957_26856 299
278 3300045051 Ga0451576_0033955 Ga0451576_0033955_2562_3461 299
279 3300045051 Ga0451576_0055270 Ga0451576_0055270_440_1339 299
280 3300046471 Ga0495650_0029997 Ga0495650_0029997_539_1438 299
281 3300046507 Ga0495606_0027032 Ga0495606_0027032_1771_2670 299
282 3300046513 Ga0495616_0046610 Ga0495616_0046610_964_1863 299
283 3300046660 Ga0495625_0022234 Ga0495625_0022234_1377_2276 299
284 3300046665 Ga0495661_0000244 Ga0495661_0000244_15979_16878 299
285 3300047472 Ga0495686_0000106 Ga0495686_0000106_163892_164791 299
286 3300047472 Ga0495686_0003562 Ga0495686_0003562_5519_6418 299
287 3300047472 Ga0495686_0163268 Ga0495686_0163268_182_1081 299
288 3300049459 Ga0495678_024090 Ga0495678_024090_867_1766 299
289 3300050493 nmdc:mga0k408_279784_c1 nmdc:mga0k408_279784_c1_26_952 299
290 3300053157 Ga0500624_000449 Ga0500624_000449_8783_9682 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

143

318

0.95

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

38

122

0.94

PF13495

Phage_int_SAM_4

Phage integrase, N-terminal SAM-like domain

38

125

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.906 1 104
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.874 1 104
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8146 1 110
3lys-assembly6.cif.gz_F crystal structure of the n-terminal domain of the prophage pi2 protein 01 (integrase) from lactococcus lactis, northeast structural genomics consortium target kr124f 0.8052 1 100
1ae9-assembly1.cif.gz_A structure of the lambda integrase catalytic core 0.7874 112 271
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.944 5 99 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.932 5 99 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9251 5 99 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.919 6 98 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9163 5 98 1.10.150.130
ID Description Score Start End GO Terms
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9592 110 251 GO:0003677
GO:0006310
GO:0015074
AF-X1MZN5-F1-model_v4 Tyr recombinase domain-containing protein 0.9513 121 273 GO:0003677
GO:0006310
GO:0015074
AF-X1KSG8-F1-model_v4 Tyr recombinase domain-containing protein 0.9462 110 251 GO:0003677
GO:0006310
GO:0015074
AF-X1RXX8-F1-model_v4 Tyr recombinase domain-containing protein 0.943 109 273 GO:0003677
GO:0006310
GO:0015074
AF-A0A090W357-F1-model_v4 Integrase 0.933 141 299 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
87.16 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map